


| Basic Information | |
|---|---|
| Family ID | F027348 |
| Family Type | Metagenome |
| Number of Sequences | 195 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MRNLELLRDKFLDMSKKAKMITIFAGLVVGIIILDWLF |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.62 % |
| % of genes from short scaffolds (< 2000 bps) | 69.74 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.359 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (23.077 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.692 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 21.54 |
| PF13884 | Peptidase_S74 | 1.54 |
| PF13936 | HTH_38 | 0.51 |
| PF04545 | Sigma70_r4 | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.36 % |
| All Organisms | root | All Organisms | 45.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10001623 | Not Available | 17969 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10028915 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10049951 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10105987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1151 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10071549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1408 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10200215 | Not Available | 640 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10018492 | Not Available | 3693 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10050040 | Not Available | 1852 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10104843 | Not Available | 1025 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10147948 | Not Available | 780 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10239272 | Not Available | 536 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1011538 | Not Available | 1176 | Open in IMG/M |
| 3300000928|OpTDRAFT_10114305 | Not Available | 543 | Open in IMG/M |
| 3300001450|JGI24006J15134_10018173 | Not Available | 3281 | Open in IMG/M |
| 3300001450|JGI24006J15134_10031384 | Not Available | 2326 | Open in IMG/M |
| 3300001460|JGI24003J15210_10017352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2792 | Open in IMG/M |
| 3300001460|JGI24003J15210_10041176 | Not Available | 1602 | Open in IMG/M |
| 3300001460|JGI24003J15210_10044931 | Not Available | 1506 | Open in IMG/M |
| 3300001460|JGI24003J15210_10121086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 713 | Open in IMG/M |
| 3300001460|JGI24003J15210_10154582 | Not Available | 583 | Open in IMG/M |
| 3300001460|JGI24003J15210_10182887 | Not Available | 506 | Open in IMG/M |
| 3300001472|JGI24004J15324_10123925 | Not Available | 629 | Open in IMG/M |
| 3300001472|JGI24004J15324_10138385 | Not Available | 576 | Open in IMG/M |
| 3300001567|Draft_10001538 | All Organisms → cellular organisms → Bacteria | 34343 | Open in IMG/M |
| 3300001589|JGI24005J15628_10222497 | Not Available | 514 | Open in IMG/M |
| 3300001939|GOS2225_1005002 | Not Available | 1142 | Open in IMG/M |
| 3300005731|Ga0076919_1027095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2782 | Open in IMG/M |
| 3300006026|Ga0075478_10082427 | Not Available | 1035 | Open in IMG/M |
| 3300006027|Ga0075462_10208829 | Not Available | 586 | Open in IMG/M |
| 3300006027|Ga0075462_10221039 | Not Available | 566 | Open in IMG/M |
| 3300006029|Ga0075466_1018505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2281 | Open in IMG/M |
| 3300006029|Ga0075466_1123843 | Not Available | 683 | Open in IMG/M |
| 3300006735|Ga0098038_1018316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2684 | Open in IMG/M |
| 3300006735|Ga0098038_1034015 | Not Available | 1893 | Open in IMG/M |
| 3300006735|Ga0098038_1137527 | Not Available | 821 | Open in IMG/M |
| 3300006752|Ga0098048_1012728 | Not Available | 2931 | Open in IMG/M |
| 3300006789|Ga0098054_1006699 | All Organisms → cellular organisms → Bacteria | 4949 | Open in IMG/M |
| 3300006789|Ga0098054_1133565 | Not Available | 920 | Open in IMG/M |
| 3300006802|Ga0070749_10023309 | All Organisms → cellular organisms → Bacteria | 3904 | Open in IMG/M |
| 3300006810|Ga0070754_10044173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2392 | Open in IMG/M |
| 3300006810|Ga0070754_10259426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 791 | Open in IMG/M |
| 3300006916|Ga0070750_10018878 | All Organisms → cellular organisms → Bacteria | 3518 | Open in IMG/M |
| 3300006916|Ga0070750_10181183 | Not Available | 941 | Open in IMG/M |
| 3300006916|Ga0070750_10320221 | Not Available | 659 | Open in IMG/M |
| 3300006916|Ga0070750_10346807 | Not Available | 627 | Open in IMG/M |
| 3300006919|Ga0070746_10440065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300006920|Ga0070748_1130913 | Not Available | 941 | Open in IMG/M |
| 3300006920|Ga0070748_1262849 | Not Available | 619 | Open in IMG/M |
| 3300006921|Ga0098060_1032783 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300007229|Ga0075468_10010923 | Not Available | 3552 | Open in IMG/M |
| 3300007229|Ga0075468_10023742 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300007229|Ga0075468_10103073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 902 | Open in IMG/M |
| 3300007229|Ga0075468_10201995 | Not Available | 580 | Open in IMG/M |
| 3300007276|Ga0070747_1254270 | Not Available | 610 | Open in IMG/M |
| 3300007637|Ga0102906_1050555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1199 | Open in IMG/M |
| 3300007960|Ga0099850_1088428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1288 | Open in IMG/M |
| 3300009052|Ga0102886_1104937 | Not Available | 857 | Open in IMG/M |
| 3300009124|Ga0118687_10238543 | Not Available | 671 | Open in IMG/M |
| 3300009420|Ga0114994_10531675 | Not Available | 773 | Open in IMG/M |
| 3300009497|Ga0115569_10043243 | All Organisms → Viruses → Predicted Viral | 2539 | Open in IMG/M |
| 3300009505|Ga0115564_10253355 | Not Available | 896 | Open in IMG/M |
| 3300009507|Ga0115572_10224471 | Not Available | 1080 | Open in IMG/M |
| 3300009507|Ga0115572_10426275 | Not Available | 740 | Open in IMG/M |
| 3300009512|Ga0115003_10850276 | Not Available | 530 | Open in IMG/M |
| 3300010149|Ga0098049_1119942 | Not Available | 818 | Open in IMG/M |
| 3300010149|Ga0098049_1203246 | Not Available | 606 | Open in IMG/M |
| 3300010149|Ga0098049_1246236 | Not Available | 544 | Open in IMG/M |
| 3300010149|Ga0098049_1250832 | Not Available | 538 | Open in IMG/M |
| 3300010150|Ga0098056_1016812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2627 | Open in IMG/M |
| 3300010296|Ga0129348_1242310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 607 | Open in IMG/M |
| 3300010368|Ga0129324_10136360 | Not Available | 1032 | Open in IMG/M |
| 3300011129|Ga0151672_114475 | Not Available | 1369 | Open in IMG/M |
| 3300011258|Ga0151677_1025564 | Not Available | 9124 | Open in IMG/M |
| 3300011258|Ga0151677_1088098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 800 | Open in IMG/M |
| 3300012953|Ga0163179_10045884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2994 | Open in IMG/M |
| 3300012953|Ga0163179_11001533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 729 | Open in IMG/M |
| 3300013010|Ga0129327_10305737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 824 | Open in IMG/M |
| 3300017706|Ga0181377_1023403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1334 | Open in IMG/M |
| 3300017710|Ga0181403_1020255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium | 1413 | Open in IMG/M |
| 3300017710|Ga0181403_1024804 | Not Available | 1269 | Open in IMG/M |
| 3300017710|Ga0181403_1033469 | Not Available | 1083 | Open in IMG/M |
| 3300017717|Ga0181404_1086562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300017717|Ga0181404_1174670 | Not Available | 515 | Open in IMG/M |
| 3300017717|Ga0181404_1179666 | Not Available | 506 | Open in IMG/M |
| 3300017720|Ga0181383_1021794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
| 3300017726|Ga0181381_1079409 | Not Available | 702 | Open in IMG/M |
| 3300017727|Ga0181401_1005259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 4465 | Open in IMG/M |
| 3300017727|Ga0181401_1073168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 902 | Open in IMG/M |
| 3300017727|Ga0181401_1153135 | Not Available | 561 | Open in IMG/M |
| 3300017734|Ga0187222_1023343 | Not Available | 1493 | Open in IMG/M |
| 3300017734|Ga0187222_1096996 | Not Available | 667 | Open in IMG/M |
| 3300017740|Ga0181418_1138095 | Not Available | 587 | Open in IMG/M |
| 3300017743|Ga0181402_1019814 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300017743|Ga0181402_1099075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 754 | Open in IMG/M |
| 3300017743|Ga0181402_1161956 | Not Available | 563 | Open in IMG/M |
| 3300017746|Ga0181389_1020894 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300017750|Ga0181405_1062956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 964 | Open in IMG/M |
| 3300017751|Ga0187219_1002260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8918 | Open in IMG/M |
| 3300017756|Ga0181382_1014881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 2545 | Open in IMG/M |
| 3300017756|Ga0181382_1060160 | Not Available | 1079 | Open in IMG/M |
| 3300017756|Ga0181382_1161007 | Not Available | 581 | Open in IMG/M |
| 3300017760|Ga0181408_1134780 | Not Available | 638 | Open in IMG/M |
| 3300017765|Ga0181413_1027347 | Not Available | 1789 | Open in IMG/M |
| 3300017765|Ga0181413_1129238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 765 | Open in IMG/M |
| 3300017767|Ga0181406_1145926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 710 | Open in IMG/M |
| 3300017768|Ga0187220_1181272 | Not Available | 636 | Open in IMG/M |
| 3300017769|Ga0187221_1009301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 3776 | Open in IMG/M |
| 3300017769|Ga0187221_1019593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2385 | Open in IMG/M |
| 3300017769|Ga0187221_1039940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1546 | Open in IMG/M |
| 3300017782|Ga0181380_1011454 | Not Available | 3405 | Open in IMG/M |
| 3300017782|Ga0181380_1112038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 942 | Open in IMG/M |
| 3300017782|Ga0181380_1226660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 623 | Open in IMG/M |
| 3300019751|Ga0194029_1000734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 4088 | Open in IMG/M |
| 3300019751|Ga0194029_1026366 | Not Available | 905 | Open in IMG/M |
| 3300020166|Ga0206128_1274284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300020185|Ga0206131_10448405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300020385|Ga0211677_10165524 | Not Available | 931 | Open in IMG/M |
| 3300020388|Ga0211678_10191239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 862 | Open in IMG/M |
| 3300020388|Ga0211678_10388109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 556 | Open in IMG/M |
| 3300020404|Ga0211659_10004909 | All Organisms → cellular organisms → Bacteria | 7024 | Open in IMG/M |
| 3300020406|Ga0211668_10413671 | Not Available | 502 | Open in IMG/M |
| 3300020421|Ga0211653_10119309 | Not Available | 1170 | Open in IMG/M |
| 3300020469|Ga0211577_10038667 | Not Available | 3562 | Open in IMG/M |
| 3300021085|Ga0206677_10002656 | Not Available | 15517 | Open in IMG/M |
| 3300021185|Ga0206682_10404686 | Not Available | 576 | Open in IMG/M |
| 3300022069|Ga0212026_1054009 | Not Available | 607 | Open in IMG/M |
| 3300022072|Ga0196889_1038896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 945 | Open in IMG/M |
| 3300022074|Ga0224906_1001402 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 11853 | Open in IMG/M |
| 3300022074|Ga0224906_1002081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 9367 | Open in IMG/M |
| 3300022074|Ga0224906_1005790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 5165 | Open in IMG/M |
| 3300022074|Ga0224906_1064031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1146 | Open in IMG/M |
| 3300022074|Ga0224906_1072975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1052 | Open in IMG/M |
| 3300022074|Ga0224906_1156161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 642 | Open in IMG/M |
| 3300022164|Ga0212022_1005679 | Not Available | 1628 | Open in IMG/M |
| 3300022164|Ga0212022_1012021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1228 | Open in IMG/M |
| 3300022178|Ga0196887_1040513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1240 | Open in IMG/M |
| 3300022178|Ga0196887_1062539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 916 | Open in IMG/M |
| 3300022183|Ga0196891_1020780 | Not Available | 1254 | Open in IMG/M |
| 3300022183|Ga0196891_1054802 | Not Available | 721 | Open in IMG/M |
| 3300022187|Ga0196899_1118846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 764 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10269272 | Not Available | 804 | Open in IMG/M |
| 3300024343|Ga0244777_10130152 | Not Available | 1627 | Open in IMG/M |
| 3300024346|Ga0244775_10131071 | Not Available | 2122 | Open in IMG/M |
| 3300024417|Ga0228650_1165930 | Not Available | 567 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10049599 | Not Available | 2107 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10002198 | All Organisms → cellular organisms → Bacteria | 13075 | Open in IMG/M |
| 3300025070|Ga0208667_1000760 | Not Available | 13039 | Open in IMG/M |
| 3300025070|Ga0208667_1001552 | Not Available | 8230 | Open in IMG/M |
| 3300025070|Ga0208667_1038479 | Not Available | 818 | Open in IMG/M |
| 3300025102|Ga0208666_1105396 | Not Available | 688 | Open in IMG/M |
| 3300025120|Ga0209535_1008687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 5897 | Open in IMG/M |
| 3300025120|Ga0209535_1009020 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 5769 | Open in IMG/M |
| 3300025120|Ga0209535_1016277 | All Organisms → cellular organisms → Bacteria | 3913 | Open in IMG/M |
| 3300025120|Ga0209535_1027289 | Not Available | 2759 | Open in IMG/M |
| 3300025120|Ga0209535_1034457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2344 | Open in IMG/M |
| 3300025120|Ga0209535_1049769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1796 | Open in IMG/M |
| 3300025120|Ga0209535_1057562 | Not Available | 1610 | Open in IMG/M |
| 3300025127|Ga0209348_1099618 | Not Available | 904 | Open in IMG/M |
| 3300025127|Ga0209348_1112513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 834 | Open in IMG/M |
| 3300025128|Ga0208919_1011584 | All Organisms → cellular organisms → Bacteria | 3557 | Open in IMG/M |
| 3300025132|Ga0209232_1000940 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 16627 | Open in IMG/M |
| 3300025132|Ga0209232_1044983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1636 | Open in IMG/M |
| 3300025138|Ga0209634_1001987 | Not Available | 14539 | Open in IMG/M |
| 3300025138|Ga0209634_1007346 | Not Available | 6923 | Open in IMG/M |
| 3300025168|Ga0209337_1180847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 879 | Open in IMG/M |
| 3300025508|Ga0208148_1003047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5843 | Open in IMG/M |
| 3300025508|Ga0208148_1099907 | Not Available | 625 | Open in IMG/M |
| 3300025610|Ga0208149_1132879 | Not Available | 578 | Open in IMG/M |
| 3300025645|Ga0208643_1010598 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| 3300025652|Ga0208134_1057921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1198 | Open in IMG/M |
| 3300025759|Ga0208899_1002490 | All Organisms → cellular organisms → Bacteria | 12256 | Open in IMG/M |
| 3300025759|Ga0208899_1005050 | All Organisms → cellular organisms → Bacteria | 8155 | Open in IMG/M |
| 3300025769|Ga0208767_1163073 | Not Available | 795 | Open in IMG/M |
| 3300025769|Ga0208767_1243633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 568 | Open in IMG/M |
| 3300025816|Ga0209193_1131980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300025887|Ga0208544_10098948 | Not Available | 1318 | Open in IMG/M |
| 3300028125|Ga0256368_1021258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300028125|Ga0256368_1073087 | Not Available | 587 | Open in IMG/M |
| 3300029448|Ga0183755_1023776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1951 | Open in IMG/M |
| 3300031519|Ga0307488_10040451 | Not Available | 3668 | Open in IMG/M |
| 3300031519|Ga0307488_10043321 | Not Available | 3528 | Open in IMG/M |
| 3300031519|Ga0307488_10076037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2511 | Open in IMG/M |
| 3300031519|Ga0307488_10076776 | Not Available | 2496 | Open in IMG/M |
| 3300031519|Ga0307488_10145327 | Not Available | 1668 | Open in IMG/M |
| 3300031519|Ga0307488_10206570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1326 | Open in IMG/M |
| 3300031519|Ga0307488_10382414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 876 | Open in IMG/M |
| 3300031519|Ga0307488_10444656 | Not Available | 789 | Open in IMG/M |
| 3300031519|Ga0307488_10486612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 740 | Open in IMG/M |
| 3300031519|Ga0307488_10558584 | Not Available | 672 | Open in IMG/M |
| 3300031569|Ga0307489_11386382 | Not Available | 511 | Open in IMG/M |
| 3300032274|Ga0316203_1190695 | Not Available | 565 | Open in IMG/M |
| 3300032277|Ga0316202_10201475 | Not Available | 924 | Open in IMG/M |
| 3300033742|Ga0314858_045435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
| 3300033742|Ga0314858_060337 | Not Available | 931 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.08% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.03% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 20.51% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 5.64% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.64% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.56% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 2.05% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.54% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.54% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.54% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.54% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.03% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.03% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.03% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.03% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.03% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.51% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.51% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.51% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.51% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.51% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.51% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001567 | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada | Engineered | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001939 | Marine microbial communities from Block Island, New York, USA - GS009 | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000162321 | 3300000101 | Marine | MRNLEILKDKFLDMSKKGKMITIFAGLVVGIIIIDWLF* |
| DelMOSum2010_100289153 | 3300000101 | Marine | MRNLEILKDKFLDMSSKAKMITILVGLVVGIIVLDWLF* |
| DelMOSum2010_100499512 | 3300000101 | Marine | MRNLELLKDKFMDMSKKGKMITIFASLVVGIVILDWLF* |
| DelMOSum2010_101059872 | 3300000101 | Marine | MKNLKMLAEQFSVMSKKAKMITIFVGLVAGIIILDWLF* |
| DelMOSpr2010_100715493 | 3300000116 | Marine | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDCLF* |
| DelMOSpr2010_102002152 | 3300000116 | Marine | MRNLEILKDKFMDMSKKAKMITIFAGLVVGIIILDWLF* |
| DelMOWin2010_100184927 | 3300000117 | Marine | MRNFELLRDKFLDLSKKGKMITVFVGLVVGIIILDLLF* |
| DelMOWin2010_100500403 | 3300000117 | Marine | MKNLKLLKDKFLSMSQKGKMLTVFVGLIIGIIILDWLF* |
| DelMOWin2010_101048431 | 3300000117 | Marine | ELLRDKFLELSKKGKMITVFVGLVVGIIILDLLF* |
| DelMOWin2010_101479483 | 3300000117 | Marine | MKNIELLKDKFLSLSQKGKMITIFVGLIIGIVILDCLF* |
| DelMOWin2010_102392722 | 3300000117 | Marine | MKNLELLKDKFLSLSKKGKMLTVFVTLIVTLIVIDWLF* |
| LPaug09P1610mDRAFT_10115383 | 3300000149 | Marine | MKNLEILKDKFLSLSKKGKMLTIFVGIVVGIIILDWLF* |
| OpTDRAFT_101143051 | 3300000928 | Freshwater And Marine | MRNLELLRDKFLDMSKKAKMITIFASLVVGIVILDW |
| JGI24006J15134_100181734 | 3300001450 | Marine | MRNLEILRDKFLDMSKKGKMITIFAGLVVGIIILDWLF* |
| JGI24006J15134_100313843 | 3300001450 | Marine | MKNLEILRDKFLDMSKKGKMLTIFVGLVVGIIILDWLF* |
| JGI24003J15210_100173523 | 3300001460 | Marine | MRNLELLRDKFLDMSKKAKMITIFASLVVGIVILDWLF* |
| JGI24003J15210_100411763 | 3300001460 | Marine | MRNLELLKDKFMDLSKKAKMITIFASLVVGIIILDWLF* |
| JGI24003J15210_100449313 | 3300001460 | Marine | MKNLEILKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF* |
| JGI24003J15210_101210861 | 3300001460 | Marine | KNLELLKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF* |
| JGI24003J15210_101545822 | 3300001460 | Marine | MKNLELLKEKFLSLSKKGKMLTVFVGLIIGIIILDWLF* |
| JGI24003J15210_101828873 | 3300001460 | Marine | EMRNLELLRDKFLDMSKKAKMITIFASLVVGIIVLDWLF* |
| JGI24004J15324_101239252 | 3300001472 | Marine | MRNLEILKDKFMDMSKKGKMITIFAGLVVGIIILDWLF* |
| JGI24004J15324_101383852 | 3300001472 | Marine | MRNIELLKDKFLDMSKKGKMITIFASLVVGIIILDWLF* |
| Draft_1000153828 | 3300001567 | Hydrocarbon Resource Environments | MRNLELLKDKFLDMSKKGKMITIFASLVVGIIVLDWLF* |
| JGI24005J15628_102224972 | 3300001589 | Marine | MRNLEILRDKFLDMSKKAQMLTLLFGLVAGIIIIDWLF* |
| GOS2225_10050023 | 3300001939 | Marine | VKNLKLLADQFSTLSIKAKMFTVLAGLVVGIIILDCLF* |
| Ga0076919_10270955 | 3300005731 | M | MKNLELLKDKFLDMSKKGKMITVLVGLVVGIIILDWLF* |
| Ga0075478_100824272 | 3300006026 | Aqueous | MRNLELLKDKFLDMSKKGKMITIFASLVVGIVILDWLF* |
| Ga0075462_102088292 | 3300006027 | Aqueous | MRNLELLKDKFMDMSKKGKMITILAGLVVGIIILDWLF* |
| Ga0075462_102210392 | 3300006027 | Aqueous | MKNLELLKDKFMEMSSKAKMITIFAGLVVGIIILDWLF* |
| Ga0075466_10185054 | 3300006029 | Aqueous | MRNLELLRDKFLDLSKKGKMITVFVGLVVGIIILDLLF* |
| Ga0075466_11238432 | 3300006029 | Aqueous | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDWLF* |
| Ga0098038_10183164 | 3300006735 | Marine | MKNLELLKDKFLSLSQKGKMLTLFVGLIIGIIILDCLF* |
| Ga0098038_10340153 | 3300006735 | Marine | MRNLEILRDKFLDMSKKAQMLTVFVGLIVGIIILDWLF* |
| Ga0098038_11375272 | 3300006735 | Marine | MKNLELLKDKFLSLSKKGKMITVFVGLIIGIIILDCLF* |
| Ga0098048_10127284 | 3300006752 | Marine | MKNFKLLAQQFSTLSTKAKMVTIFVGLVVGIIVLDCLF* |
| Ga0098054_10066993 | 3300006789 | Marine | MRNLELLKDKFLDMSTKAKMITIFAGLVVGIIILDCLF* |
| Ga0098054_11335651 | 3300006789 | Marine | MRNLELLRDKFLDMSKKGKMLTIFVGLVVLIIILD |
| Ga0070749_100233092 | 3300006802 | Aqueous | MRNLEILRDKFLDMSKKAQMITILAGLVVGIIILDWLF* |
| Ga0070754_100441734 | 3300006810 | Aqueous | MRNLELLKDKFMDMSKKAKMITIFASLVVGIIILDWLF* |
| Ga0070754_102594262 | 3300006810 | Aqueous | MRNLEILKDKFLDMPSKAKMITILVGLVVGIIVLDWLF* |
| Ga0070750_100188782 | 3300006916 | Aqueous | MKNLEILKDKFLSLSKKGKMLTVFVTLVVTLIIFDWLF* |
| Ga0070750_101811834 | 3300006916 | Aqueous | MRNLELLKDKFMDMSKKAQMITILAGLVVGIIILD |
| Ga0070750_103202211 | 3300006916 | Aqueous | MRNLELLKDKFMDMSKKAKMITIFASLVVGIVILD |
| Ga0070750_103468072 | 3300006916 | Aqueous | MKNLEILKDKFLSLSKKGKMLTVFVGLVVGIIILDWLF* |
| Ga0070746_104400651 | 3300006919 | Aqueous | NLKILADQFSTLSTKAKMFTIFAGLVIGIIILDWLF* |
| Ga0070748_11309133 | 3300006920 | Aqueous | PVKNLKLLADQFSTLSKKAKMFTVLAGLVIGIIILDCLF* |
| Ga0070748_12628491 | 3300006920 | Aqueous | MRNLELLRDKFLDMSTKAKMITIFAGLVVGIIILD |
| Ga0070748_13633821 | 3300006920 | Aqueous | HPPVKNLKLLADQFSTLSTKAKMFTVLAGLIIGIIILDWLF* |
| Ga0098060_10327833 | 3300006921 | Marine | MRNLELLRDKFLDMSAKAKMITIFAGLVVGIIILDWLF* |
| Ga0075468_100109233 | 3300007229 | Aqueous | MRNFELLRDKFLELSKKGKMITVFVGLVVGIIILDLLF* |
| Ga0075468_100237426 | 3300007229 | Aqueous | MRNLELLKDKFLDMSKKAKMITIFASLVVGIVILDWLF* |
| Ga0075468_101030731 | 3300007229 | Aqueous | MRNLEILKDKFLDMSKKGKMITIFAGLVVGIIILDCLF* |
| Ga0075468_102019952 | 3300007229 | Aqueous | MRNLELLKDKFMDMSKKAQMITILAGLVVGIIILDWLF |
| Ga0070747_12542703 | 3300007276 | Aqueous | MRNLELLKDKFMDMSKKAKMITIFASLVVGIVILDWLF* |
| Ga0102906_10505552 | 3300007637 | Estuarine | MRNLEILRDKFLDMSKKGKMITILAGLVVGIVIIDWLF* |
| Ga0099850_10884281 | 3300007960 | Aqueous | RNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDCLF* |
| Ga0102886_11049373 | 3300009052 | Estuarine | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIVIIDWLF* |
| Ga0118687_102385431 | 3300009124 | Sediment | MRNLELLRDKFLDLSRKGKMITVFVGLVVGIIILDLLF* |
| Ga0114994_105316752 | 3300009420 | Marine | MRNLEILVDKFLDLSKKAKMVTIFAALVVGIIIIDWLF* |
| Ga0115569_100432436 | 3300009497 | Pelagic Marine | MRNLELLKDKFLDMSKKAKMITIFAGLVVGIIILDCLF* |
| Ga0115564_102533551 | 3300009505 | Pelagic Marine | LKLLADQFSTLSKKAKMFTVLAGLVVGIIILDWLF* |
| Ga0115572_102244713 | 3300009507 | Pelagic Marine | VKNLKLLADQFSTLSKKAKMFTVLAGLVIGIIILDWLF* |
| Ga0115572_104262753 | 3300009507 | Pelagic Marine | VKNLKLLADQFSTLSKKAKMFTVLAGLVVGIIILDWLF* |
| Ga0115003_108502762 | 3300009512 | Marine | MRNLEILVDKFLDLSKKGKMVTIFAALVVGIIILDWLF* |
| Ga0098049_11199422 | 3300010149 | Marine | MKNLKMLAEQFSVMSKKAKMITIFVGLVLGIIVLDWLF* |
| Ga0098049_12032462 | 3300010149 | Marine | MKNIELLKDKFLSLSQKGKMITILVGLIIGIVILDCLF* |
| Ga0098049_12462361 | 3300010149 | Marine | MKNLELLKDKFLDMSKKGKMITVLVGLIVGIIILDWLF* |
| Ga0098049_12508323 | 3300010149 | Marine | MRNLELLRDKFLDLSKKGKMITVFVGLVVGIIILDVLF* |
| Ga0098056_10168121 | 3300010150 | Marine | VMRNLELLRDKFLDMSKKGKMLTIFVGLVVGIIILDCLF* |
| Ga0129348_12423103 | 3300010296 | Freshwater To Marine Saline Gradient | RNLEILRDKFLDMSKKGKMLTIFVGLVVGIIILDWLF* |
| Ga0129324_101363603 | 3300010368 | Freshwater To Marine Saline Gradient | MKNIKLLKDKFLSMSQKGKMLTVFVGLIIGIIILDWLF* |
| Ga0151672_1144753 | 3300011129 | Marine | MRNLELLKDKFLDMSKKAKMITIFAGLVVGIVILDWLF* |
| Ga0151677_10255643 | 3300011258 | Marine | MNNLKLLAEQFSVMSKKAKMITIFVGLVAGIIILDWLF* |
| Ga0151677_10880983 | 3300011258 | Marine | MRNLELLKDKFLDMSKKAKMITIFASLVVGIIILDWLF* |
| Ga0163179_100458843 | 3300012953 | Seawater | MKNLKMLAEQFSVMSKKAKMIAIFVGLVVGIIILDWLF* |
| Ga0163179_110015332 | 3300012953 | Seawater | MKNLEILKDKFLSLSKKGKMLTVFVGLIIGIIILDCLF* |
| Ga0129327_103057373 | 3300013010 | Freshwater To Marine Saline Gradient | MRNLELLKDKFMDMSKKVKMITIFAGLVVGIIILDWLF* |
| Ga0181377_10234033 | 3300017706 | Marine | MRNLELLRDKFLDLSKKGKMITVFVGLVVGLIILDLLF |
| Ga0181403_10202552 | 3300017710 | Seawater | MKNLEILKDKFLSLSKKGKMLTIFVGLVVGIIIIDWLF |
| Ga0181403_10248042 | 3300017710 | Seawater | MKNLELLKDKFLSLSKKGKMLTVFVGLIIGIIILDWLF |
| Ga0181403_10334691 | 3300017710 | Seawater | PTLRPQMKNFKLLAQQFSTLSKKAKMVTIFVGLIVGIIILDWLF |
| Ga0181404_10865622 | 3300017717 | Seawater | MKNLELLKEKFLSLPKKGKMLTVFVGLIIGIIILDCLF |
| Ga0181404_11746701 | 3300017717 | Seawater | MKNLEILRDKFLDMSKKGKMLTIFVGLVVGIIILDW |
| Ga0181404_11796663 | 3300017717 | Seawater | SKRPQMKNFKLLAQQFSTLSKKAKMITIFVGLVVGIIILDWLF |
| Ga0181383_10217941 | 3300017720 | Seawater | MRNLELLKDKFLDMSKKAKMITIFAGLVVGIVILDWLF |
| Ga0181381_10794091 | 3300017726 | Seawater | MKNFKLLAQQFSTLSKKAKMITIFVGLIVGIIILDWLF |
| Ga0181401_10052594 | 3300017727 | Seawater | MRNLELLKDKFLDMSKKGKMITIFASLVVGIVILDWLF |
| Ga0181401_10731683 | 3300017727 | Seawater | RPQMKNFKLLAQQFSTLSKKAKMITIFVGLVVGIIILDWLF |
| Ga0181401_11531353 | 3300017727 | Seawater | RPQMKNFKLLAQQFSTLSKKAKMITIFVGLIVGIIILDWLF |
| Ga0187222_10233434 | 3300017734 | Seawater | MRNLELLRDKFLDMSKKAKMITIFAGLVVGIIILDWLF |
| Ga0187222_10969963 | 3300017734 | Seawater | MRNFELLKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0181418_11380952 | 3300017740 | Seawater | MRNLELLRDKFLDLSKKGKMITVFVGLVVGIIILDCLF |
| Ga0181402_10198145 | 3300017743 | Seawater | MKNLEILKDKFLSLSKKGKMLTIFVGLVVGIIIIDW |
| Ga0181402_10990751 | 3300017743 | Seawater | NLEILKDKFLSLSKKGKMLTIFVGLVVGIIIIDWLF |
| Ga0181402_11619562 | 3300017743 | Seawater | MNNFKLLKEKFLSLPKKGKMLTVFVGLIIGIIILDCLF |
| Ga0181389_10208946 | 3300017746 | Seawater | MRNLELLRDKFMDMSKKAKMITIFASLVVGIVILDWLF |
| Ga0181405_10629562 | 3300017750 | Seawater | MRNLEILKDKFLSLSKKGKMLTIFVGLVVGIIIIDWLF |
| Ga0187219_10022609 | 3300017751 | Seawater | NLELLRDKFLDMSKKAKMITIFASLVVGIVILDWLF |
| Ga0181382_10148811 | 3300017756 | Seawater | MKNFKLLAQQFSTLSKKAKMVTIFVGLIVGIIILDWLF |
| Ga0181382_10601601 | 3300017756 | Seawater | PQMKNFKLLAQQFSTLSKKAKMITIFVGLVVGIIILDWLF |
| Ga0181382_11610071 | 3300017756 | Seawater | MKNLELLKDKFLSLSKKGKMLTIFVGLVVGIIILDW |
| Ga0181408_11347801 | 3300017760 | Seawater | MRNLELLRDKFMELSTKAKMITIFTGLVVGIIILDWL |
| Ga0181413_10273472 | 3300017765 | Seawater | MRNLEILKDKFLSLSKKGKMLTIFVGLVVGIIILDWLF |
| Ga0181413_11292383 | 3300017765 | Seawater | LEILKDKFLSLSKKGKMLTVFVGLVVGIIILDWLF |
| Ga0181406_11459261 | 3300017767 | Seawater | NLELLKDKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0187220_11812723 | 3300017768 | Seawater | MRNLELLRDKFLDMSKKAKMITIFASLVVGIIVLDWL |
| Ga0187221_10093011 | 3300017769 | Seawater | HEMKNLELLKDKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0187221_10195931 | 3300017769 | Seawater | PIRPQMKNFKLLAQQFSTLSKKAKMITIFVGLVVGIIILDWLF |
| Ga0187221_10399403 | 3300017769 | Seawater | HEMKNLELLKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0181380_10114543 | 3300017782 | Seawater | MRNLELLRDKFMDMSKKAKMITIFASLVVGIIVLDWLF |
| Ga0181380_11120381 | 3300017782 | Seawater | HPPVMRNLELLRDKFLDMSKKGKMLTIFVGLVVGIIILDWLF |
| Ga0181380_12266603 | 3300017782 | Seawater | LELLKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0194029_10007343 | 3300019751 | Freshwater | MKNLELLKDKFLSLSKKGKMLTVFVTLIVTLIVIDWLF |
| Ga0194029_10263662 | 3300019751 | Freshwater | MRNLELLKDKFMDMSKKGKMITILAGLVVGILILDWLF |
| Ga0206128_12742843 | 3300020166 | Seawater | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDCLF |
| Ga0206131_104484053 | 3300020185 | Seawater | RNLELLKDKFLDMSTKAKMITIFAGLVVGIIILDCLF |
| Ga0211677_101655243 | 3300020385 | Marine | MKNLELLKDKFLDMSKKGKMITVLVGLVVGIIILDWLF |
| Ga0211678_101912391 | 3300020388 | Marine | MKNLEILKDKFLSLSKKGKMLTVFVGLVVGIIILDWLF |
| Ga0211678_103881093 | 3300020388 | Marine | MRNLEILKDKFLSLSKKGKMLTVFVGLVVGIIILDWLF |
| Ga0211659_100049097 | 3300020404 | Marine | MRNLEILRDKFLDMSKKAQMLTVFVGLIVGIIILDWLF |
| Ga0211668_104136712 | 3300020406 | Marine | MKNLEILKEKFLSLSKKGKMLTVFVTLIVTLIVIDWLF |
| Ga0211653_101193092 | 3300020421 | Marine | MKNLELLKEKFLSMSQKAKMLTVFVGLIIGIIILDCLF |
| Ga0211577_100386671 | 3300020469 | Marine | MKNIKLLTEKFNSLNKRGKMITIFAGLVITIVILDWLF |
| Ga0206677_1000265622 | 3300021085 | Seawater | MRNLELLRDKFLDMSKKAKMITIFAGLVVGIIIIDWLF |
| Ga0206682_104046861 | 3300021185 | Seawater | MRNLELLKDKFLDMSKKGKMITIFASLVVGIIVLDWLF |
| Ga0212026_10540092 | 3300022069 | Aqueous | MRNLELLKDKFMDMSKKAKMITIFASLVVGIIILDWLF |
| Ga0196889_10388963 | 3300022072 | Aqueous | MRNLELLRDKFLDLSKKGKMITVFVGLVVGIIILDLLF |
| Ga0224906_100140219 | 3300022074 | Seawater | MRNFELLRDKFMELSTKAKMLTIFAGLVVGIIILDWLF |
| Ga0224906_10020818 | 3300022074 | Seawater | MKNLEILRDKFLDMSKKGKMLTIFVGLVVGIIILDWLF |
| Ga0224906_10057906 | 3300022074 | Seawater | MKNLELLKEKFLSLSKKGKMLTVFVTLIVTLIIFDWLF |
| Ga0224906_10640313 | 3300022074 | Seawater | MKNLELLKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0224906_10729753 | 3300022074 | Seawater | MRNFELLRDKFMELSTKAKMLTIFVGLVIGIILLDWIF |
| Ga0224906_11561613 | 3300022074 | Seawater | MKNLEILKDKFLSLSKKGKMLTIFVGLVVGIIILDWLF |
| Ga0212022_10056791 | 3300022164 | Aqueous | MRNLELLKDKFLDMSKKAKMITIFASLVVGIVILDWLF |
| Ga0212022_10120213 | 3300022164 | Aqueous | PPEMRNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDWLF |
| Ga0196887_10405132 | 3300022178 | Aqueous | MRNLEILKDKFLDMSKKGKMITIFAGLVVGIIILDCLF |
| Ga0196887_10625392 | 3300022178 | Aqueous | MKNLKMLAEQFSVMSKKAKMITIFVGLVAGIIILDWLF |
| Ga0196891_10207804 | 3300022183 | Aqueous | MKNFKLLAQQFSTLSTKAKMVTIFVGLVVGIIVLDCLF |
| Ga0196891_10548022 | 3300022183 | Aqueous | MRNLELLKDKFMDMSKKGKMITILAGLVVGIIILDWLF |
| Ga0196899_11188463 | 3300022187 | Aqueous | PMRNLELLRDKFLDMSTKAKMITIFAGLVVGIIILDCLF |
| (restricted) Ga0233432_102692722 | 3300023109 | Seawater | MRNLEILKDKFLDMSKKGKMITIFAGLVVGIIIIDWLF |
| Ga0244777_101301523 | 3300024343 | Estuarine | MRNLEILRDKFLDMSKKGKMITILAGLVVGIVIIDWLF |
| Ga0244775_101310714 | 3300024346 | Estuarine | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDWLF |
| Ga0228650_11659302 | 3300024417 | Seawater | MKNIELLKDKFLSLSQKGKMITIFVGLIIGIVILDCLF |
| (restricted) Ga0255048_100495993 | 3300024518 | Seawater | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIIIIDWLF |
| (restricted) Ga0255047_1000219817 | 3300024520 | Seawater | MRNLELLKDKFMDMSKKAKMITIFAGLVVGIVILDWLF |
| Ga0208667_10007603 | 3300025070 | Marine | MRNFELLRDKFLDLSKKGKMITVFVGLVVGIIILDLLF |
| Ga0208667_10015527 | 3300025070 | Marine | MRNLELLKDKFLDMSTKAKMITIFAGLVVGIIILDCLF |
| Ga0208667_10384792 | 3300025070 | Marine | MKNLELLKDKFLSLSKKGKMITVFVGLIIGIIILDCLF |
| Ga0208666_11053963 | 3300025102 | Marine | MKNLELLKDKFLSLSQKGKMLTLFVGLIIGIIILDCLF |
| Ga0209535_10086873 | 3300025120 | Marine | MRNLELLRDKFLDMSKKAKMITIFASLVVGIVILDWLF |
| Ga0209535_10090203 | 3300025120 | Marine | MRNLEILRDKFLDMSKKGKMITIFASLVVGIIILDWLF |
| Ga0209535_10162775 | 3300025120 | Marine | MKNLELLKEKFLSLSKKGKMLTVFVGLIIGIIILDWLF |
| Ga0209535_10272893 | 3300025120 | Marine | MRNLELLKDKFMDLSKKAKMITIFASLVVGIIILDWLF |
| Ga0209535_10344571 | 3300025120 | Marine | PPEMRNLELLRDKFLDMSKKAKMITIFASLVVGIIVLDWLF |
| Ga0209535_10497693 | 3300025120 | Marine | MKNLEILKDKFLSLSKKGKMLTIFVGIVVGIIILDWLF |
| Ga0209535_10575623 | 3300025120 | Marine | MKNLEILKEKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0209348_10996183 | 3300025127 | Marine | MRNLEILKEKFLSLPKKGKMLTIFVGLVVGIIILDWLF |
| Ga0209348_11125133 | 3300025127 | Marine | MRNLELLRDKFLDLSKKGKMITVFVGLVIGIIILDLLF |
| Ga0208919_10115847 | 3300025128 | Marine | MRNLELLRDKFLDMSAKAKMITIFAGLVVGIIILDWLF |
| Ga0209232_10009408 | 3300025132 | Marine | MRNLELLRDKFLDMSTKAKMITIFAGLVVGIIILDCLF |
| Ga0209232_10449833 | 3300025132 | Marine | MKNFKLLAQQFSTLSKKAKMITIFVGLVVGIIILDWLF |
| Ga0209634_10019875 | 3300025138 | Marine | MRNLEILRDKFLDMSKKAQMLTLLFGLVAGIIIIDLLF |
| Ga0209634_10073466 | 3300025138 | Marine | MRNLEILRDKFLDMSKKGKMITIFAGLVVGIIILDWLF |
| Ga0209337_11808473 | 3300025168 | Marine | KTSLQNMRNLEILRDKFLDMSKKAQMLTLLFGLVAGIIIIDWLF |
| Ga0208148_10030476 | 3300025508 | Aqueous | MRNLEILRDKFLDMSKKAQMITILAGLVVGIIILDWLF |
| Ga0208148_10999073 | 3300025508 | Aqueous | MKNLKLLKDKFLSMSQKGKMLTVFVGLIIGIIILDWLF |
| Ga0208149_11328792 | 3300025610 | Aqueous | MRNLELLKDKFMDMSKKAKMITIFASLVVGIVILDWLF |
| Ga0208643_10105986 | 3300025645 | Aqueous | MKNLELLKDKFLDMSKKAQMITIFASLVVGIIILDWLF |
| Ga0208134_10579212 | 3300025652 | Aqueous | MRNFELLRDKFLELSKKGKMITVFVGLVVGIIILDLLF |
| Ga0208899_10024904 | 3300025759 | Aqueous | MKNLELLKDKFMEMSSKAKMITIFAGLVVGIIILDWLF |
| Ga0208899_10050509 | 3300025759 | Aqueous | MKNLEILKDKFLSLSKKGKMLTVFVTLVVTLIIFDWLF |
| Ga0208767_11630732 | 3300025769 | Aqueous | MRNLELLKDKFMDMSKKGKMITIFASLVVGIVILDWLF |
| Ga0208767_12436331 | 3300025769 | Aqueous | LELLKDKFLDMSKKGKMITVLVGLVVGIIILDWLF |
| Ga0209193_11319801 | 3300025816 | Pelagic Marine | NHPPEMRNLELLKDKFMDMSKKAKMITIFAGLVVGIIILDCLF |
| Ga0208544_100989481 | 3300025887 | Aqueous | MKNLKLLKDKFLSMSQKGKMLTVFVGLIIGIIILDW |
| Ga0256368_10212582 | 3300028125 | Sea-Ice Brine | MRNLELLKDKFLDMSKKGKMITIFAGLVVGIVILDWLF |
| Ga0256368_10730872 | 3300028125 | Sea-Ice Brine | MRNLELLKDKFMDMSKKAKMITIFAGLVAGIIILDWLF |
| Ga0183755_10237763 | 3300029448 | Marine | MKNLELLKDKFLSLSKKGKMLTVFVGLIIGIIILDCLF |
| Ga0307488_100404513 | 3300031519 | Sackhole Brine | MRNLELLRDKFLDLSRKGKMITVFVGLVVGIIILDLLF |
| Ga0307488_100433217 | 3300031519 | Sackhole Brine | MKNFKLLAQQFSTLSKKAKMVTIFVGLIVGIIIIDWLF |
| Ga0307488_100760373 | 3300031519 | Sackhole Brine | MRNLEILRDKFLDMSKKAKMITILVGLVVGIIVLDWLF |
| Ga0307488_100767761 | 3300031519 | Sackhole Brine | MRNLEILRDKFLDMSKKAQMVTIFAALVVGIIIIDWLF |
| Ga0307488_101453274 | 3300031519 | Sackhole Brine | MRNLEILRDKFLDMSNKAKMVTIFAALVVGIIIIDWLF |
| Ga0307488_102065703 | 3300031519 | Sackhole Brine | MRNLEILRDKFLDMSKKAKMITILVGLVVGIIILDWLF |
| Ga0307488_103824143 | 3300031519 | Sackhole Brine | MRNLEILKDKFLDMSSKAKMITILAGLVVGIIVLDWLF |
| Ga0307488_104446561 | 3300031519 | Sackhole Brine | MRNLEILKDKFLDMSKKGKMITIFASLVVGIVILDWLF |
| Ga0307488_104866123 | 3300031519 | Sackhole Brine | MRNLEILRDKFLDMSKKAQMVTIFASLVVGIIILDFLF |
| Ga0307488_105585842 | 3300031519 | Sackhole Brine | MRNLELLKDKFLDLSKKAKMITIFAGLVVGIIIIDWLF |
| Ga0307489_113863821 | 3300031569 | Sackhole Brine | MRNLEILKDKFLDMSKKGKMITILAGLVVGIIIIDWLF |
| Ga0316203_11906953 | 3300032274 | Microbial Mat | IELLKDKFLSLSQKGKMITIFVGLIIGIVILDCLF |
| Ga0316202_102014753 | 3300032277 | Microbial Mat | MKNLKMLAEQFSVMSKKAKMITIFVGLVLGIIVLDWLF |
| Ga0314858_045435_944_1051 | 3300033742 | Sea-Ice Brine | LEILRDKFLDMSKKAKMVTIFAALVVGIIILDFLF |
| Ga0314858_060337_794_910 | 3300033742 | Sea-Ice Brine | MRNLEILRDKFLDLSKKSKMITIFAALVVGIIIIDWLF |
| ⦗Top⦘ |