


| Basic Information | |
|---|---|
| Family ID | F027213 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 45 residues |
| Representative Sequence | YIVSPQKFGVDEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.59 % |
| % of genes near scaffold ends (potentially truncated) | 96.41 % |
| % of genes from short scaffolds (< 2000 bps) | 89.23 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.205 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.513 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.974 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.641 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 2.56 |
| PF01619 | Pro_dh | 2.05 |
| PF00903 | Glyoxalase | 1.54 |
| PF02771 | Acyl-CoA_dh_N | 1.54 |
| PF14329 | DUF4386 | 1.54 |
| PF00069 | Pkinase | 1.54 |
| PF02353 | CMAS | 1.54 |
| PF00106 | adh_short | 1.03 |
| PF13561 | adh_short_C2 | 1.03 |
| PF08327 | AHSA1 | 1.03 |
| PF03328 | HpcH_HpaI | 1.03 |
| PF14534 | DUF4440 | 1.03 |
| PF04073 | tRNA_edit | 1.03 |
| PF12697 | Abhydrolase_6 | 1.03 |
| PF03466 | LysR_substrate | 1.03 |
| PF03061 | 4HBT | 1.03 |
| PF04365 | BrnT_toxin | 0.51 |
| PF04248 | NTP_transf_9 | 0.51 |
| PF14690 | zf-ISL3 | 0.51 |
| PF03403 | PAF-AH_p_II | 0.51 |
| PF13432 | TPR_16 | 0.51 |
| PF00583 | Acetyltransf_1 | 0.51 |
| PF08281 | Sigma70_r4_2 | 0.51 |
| PF04075 | F420H2_quin_red | 0.51 |
| PF00107 | ADH_zinc_N | 0.51 |
| PF00732 | GMC_oxred_N | 0.51 |
| PF00380 | Ribosomal_S9 | 0.51 |
| PF08332 | CaMKII_AD | 0.51 |
| PF01546 | Peptidase_M20 | 0.51 |
| PF04542 | Sigma70_r2 | 0.51 |
| PF07681 | DoxX | 0.51 |
| PF02276 | CytoC_RC | 0.51 |
| PF07978 | NIPSNAP | 0.51 |
| PF08818 | DUF1801 | 0.51 |
| PF07238 | PilZ | 0.51 |
| PF04191 | PEMT | 0.51 |
| PF14384 | BrnA_antitoxin | 0.51 |
| PF07080 | DUF1348 | 0.51 |
| PF14279 | HNH_5 | 0.51 |
| PF00355 | Rieske | 0.51 |
| PF13517 | FG-GAP_3 | 0.51 |
| PF13414 | TPR_11 | 0.51 |
| PF07995 | GSDH | 0.51 |
| PF01381 | HTH_3 | 0.51 |
| PF04916 | Phospholip_B | 0.51 |
| PF13673 | Acetyltransf_10 | 0.51 |
| PF04909 | Amidohydro_2 | 0.51 |
| PF13751 | DDE_Tnp_1_6 | 0.51 |
| PF00082 | Peptidase_S8 | 0.51 |
| PF09859 | Oxygenase-NA | 0.51 |
| PF13649 | Methyltransf_25 | 0.51 |
| PF12704 | MacB_PCD | 0.51 |
| PF00572 | Ribosomal_L13 | 0.51 |
| PF00753 | Lactamase_B | 0.51 |
| PF03699 | UPF0182 | 0.51 |
| PF13193 | AMP-binding_C | 0.51 |
| PF04185 | Phosphoesterase | 0.51 |
| PF07366 | SnoaL | 0.51 |
| PF00561 | Abhydrolase_1 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.15 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 2.05 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.54 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.54 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.54 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 1.54 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.03 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 1.03 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 1.03 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.51 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.51 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.51 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.51 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.51 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.51 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.51 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.51 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.51 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.51 |
| COG4188 | Predicted dienelactone hydrolase | General function prediction only [R] | 0.51 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.51 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.51 |
| COG4875 | Protein kinase association domain CaMKII_AD, NTF2-like superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.51 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.21 % |
| Unclassified | root | N/A | 11.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10037651 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300001593|JGI12635J15846_10031011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4273 | Open in IMG/M |
| 3300001593|JGI12635J15846_10234239 | Not Available | 1189 | Open in IMG/M |
| 3300002909|JGI25388J43891_1042808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300002914|JGI25617J43924_10335980 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005166|Ga0066674_10444068 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005445|Ga0070708_100480303 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005445|Ga0070708_101864878 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005536|Ga0070697_101802246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005544|Ga0070686_100440614 | Not Available | 999 | Open in IMG/M |
| 3300005556|Ga0066707_10765343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300005586|Ga0066691_10436418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300005602|Ga0070762_11306140 | Not Available | 504 | Open in IMG/M |
| 3300005983|Ga0081540_1266629 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006028|Ga0070717_10621693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300006237|Ga0097621_101329507 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006794|Ga0066658_10333755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300006796|Ga0066665_11123379 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006797|Ga0066659_11131845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300006852|Ga0075433_10907135 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300007076|Ga0075435_100948858 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300007255|Ga0099791_10219700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300007255|Ga0099791_10286942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300007258|Ga0099793_10043917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1949 | Open in IMG/M |
| 3300007258|Ga0099793_10162732 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300007258|Ga0099793_10463439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300009038|Ga0099829_10637405 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300009038|Ga0099829_10676186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300009089|Ga0099828_11105438 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009090|Ga0099827_11329532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300009162|Ga0075423_10410148 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300009665|Ga0116135_1408552 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010159|Ga0099796_10382392 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010866|Ga0126344_1454568 | Not Available | 518 | Open in IMG/M |
| 3300011120|Ga0150983_12130892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1659 | Open in IMG/M |
| 3300011269|Ga0137392_10312913 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300011269|Ga0137392_10434040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300011269|Ga0137392_10524606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300011270|Ga0137391_10293464 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300011270|Ga0137391_10508131 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300011271|Ga0137393_10104956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2313 | Open in IMG/M |
| 3300011271|Ga0137393_10249925 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300012096|Ga0137389_10385753 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300012096|Ga0137389_11166805 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012096|Ga0137389_11786241 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012096|Ga0137389_11802027 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012189|Ga0137388_10136657 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300012189|Ga0137388_10965128 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012189|Ga0137388_11870541 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012198|Ga0137364_11197563 | Not Available | 569 | Open in IMG/M |
| 3300012198|Ga0137364_11384729 | Not Available | 521 | Open in IMG/M |
| 3300012202|Ga0137363_10264836 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300012202|Ga0137363_10544793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300012202|Ga0137363_11736231 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012203|Ga0137399_10053605 | All Organisms → cellular organisms → Bacteria | 2944 | Open in IMG/M |
| 3300012203|Ga0137399_10554107 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012203|Ga0137399_10680945 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012203|Ga0137399_11578249 | Not Available | 544 | Open in IMG/M |
| 3300012203|Ga0137399_11806330 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012205|Ga0137362_10037276 | All Organisms → cellular organisms → Bacteria | 3893 | Open in IMG/M |
| 3300012205|Ga0137362_10199909 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300012205|Ga0137362_10974975 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012361|Ga0137360_10257156 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300012361|Ga0137360_10635149 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012361|Ga0137360_11426627 | Not Available | 596 | Open in IMG/M |
| 3300012361|Ga0137360_11428324 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012362|Ga0137361_11627134 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 566 | Open in IMG/M |
| 3300012582|Ga0137358_10349509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300012582|Ga0137358_10483133 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012582|Ga0137358_10696457 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012582|Ga0137358_10983797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300012582|Ga0137358_11090302 | Not Available | 510 | Open in IMG/M |
| 3300012685|Ga0137397_10128964 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300012685|Ga0137397_11082524 | Not Available | 585 | Open in IMG/M |
| 3300012917|Ga0137395_10082403 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300012918|Ga0137396_10715191 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012918|Ga0137396_11106193 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012922|Ga0137394_11425151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300012923|Ga0137359_11417798 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012923|Ga0137359_11579772 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012925|Ga0137419_11456066 | Not Available | 579 | Open in IMG/M |
| 3300012925|Ga0137419_11525164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300012927|Ga0137416_10276142 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300012927|Ga0137416_10991590 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012927|Ga0137416_11112725 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012927|Ga0137416_11596590 | Not Available | 594 | Open in IMG/M |
| 3300012927|Ga0137416_12102130 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012929|Ga0137404_11367520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012944|Ga0137410_10000502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 27878 | Open in IMG/M |
| 3300014169|Ga0181531_10636511 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300014489|Ga0182018_10452651 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300015054|Ga0137420_1288349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300015054|Ga0137420_1312372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4658 | Open in IMG/M |
| 3300015054|Ga0137420_1384970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
| 3300015264|Ga0137403_10034584 | All Organisms → cellular organisms → Bacteria | 5320 | Open in IMG/M |
| 3300016294|Ga0182041_11285425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300016422|Ga0182039_11081924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300017972|Ga0187781_11015484 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300018468|Ga0066662_12321282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300018482|Ga0066669_10001301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9396 | Open in IMG/M |
| 3300020006|Ga0193735_1029713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1672 | Open in IMG/M |
| 3300020170|Ga0179594_10373105 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300020199|Ga0179592_10506660 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300020579|Ga0210407_10916347 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300020581|Ga0210399_11032728 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300020583|Ga0210401_10430437 | Not Available | 1182 | Open in IMG/M |
| 3300020583|Ga0210401_10584908 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300021046|Ga0215015_10071326 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300021088|Ga0210404_10171343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300021088|Ga0210404_10398499 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021088|Ga0210404_10495925 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021088|Ga0210404_10549703 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300021168|Ga0210406_10348732 | Not Available | 1195 | Open in IMG/M |
| 3300021168|Ga0210406_10474958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300021168|Ga0210406_10713917 | Not Available | 771 | Open in IMG/M |
| 3300021170|Ga0210400_10786333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 780 | Open in IMG/M |
| 3300021170|Ga0210400_11212671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300021171|Ga0210405_10653558 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300021171|Ga0210405_11418406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300021180|Ga0210396_10019895 | All Organisms → cellular organisms → Bacteria | 6222 | Open in IMG/M |
| 3300021180|Ga0210396_10668807 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300021180|Ga0210396_11622330 | Not Available | 528 | Open in IMG/M |
| 3300021181|Ga0210388_10304394 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300021405|Ga0210387_10063119 | All Organisms → cellular organisms → Bacteria | 3011 | Open in IMG/M |
| 3300021405|Ga0210387_10542255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1034 | Open in IMG/M |
| 3300021406|Ga0210386_10076426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2705 | Open in IMG/M |
| 3300021420|Ga0210394_10880577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 780 | Open in IMG/M |
| 3300021432|Ga0210384_11409586 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021479|Ga0210410_11256714 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300021559|Ga0210409_11051192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300021559|Ga0210409_11354572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300022504|Ga0242642_1021409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300022721|Ga0242666_1150889 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300022726|Ga0242654_10315845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300023259|Ga0224551_1097368 | Not Available | 520 | Open in IMG/M |
| 3300024176|Ga0224565_1036928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 560 | Open in IMG/M |
| 3300024330|Ga0137417_1141836 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300024330|Ga0137417_1324728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300024330|Ga0137417_1466020 | Not Available | 1298 | Open in IMG/M |
| 3300026285|Ga0209438_1088064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300026298|Ga0209236_1073213 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300026301|Ga0209238_1050545 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300026304|Ga0209240_1048002 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300026318|Ga0209471_1109918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300026359|Ga0257163_1025539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300026377|Ga0257171_1042023 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300026469|Ga0257169_1089859 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026494|Ga0257159_1025328 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300026496|Ga0257157_1051635 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300026524|Ga0209690_1037042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2288 | Open in IMG/M |
| 3300026532|Ga0209160_1258128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300026551|Ga0209648_10815983 | Not Available | 510 | Open in IMG/M |
| 3300026557|Ga0179587_10851019 | Not Available | 601 | Open in IMG/M |
| 3300027174|Ga0207948_1016829 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027297|Ga0208241_1072378 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027334|Ga0209529_1047094 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300027546|Ga0208984_1076574 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300027629|Ga0209422_1009246 | All Organisms → cellular organisms → Bacteria | 2429 | Open in IMG/M |
| 3300027629|Ga0209422_1068344 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027629|Ga0209422_1158009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300027633|Ga0208988_1027809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300027738|Ga0208989_10152884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300027846|Ga0209180_10332500 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027862|Ga0209701_10013791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5295 | Open in IMG/M |
| 3300027882|Ga0209590_10025760 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300027884|Ga0209275_10161045 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300027884|Ga0209275_10353869 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027889|Ga0209380_10833505 | Not Available | 521 | Open in IMG/M |
| 3300027903|Ga0209488_10025792 | All Organisms → cellular organisms → Bacteria | 4271 | Open in IMG/M |
| 3300027908|Ga0209006_10161507 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300028047|Ga0209526_10134723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1733 | Open in IMG/M |
| 3300028047|Ga0209526_10456607 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300028536|Ga0137415_11214596 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028906|Ga0308309_10785550 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300028906|Ga0308309_11526507 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300029636|Ga0222749_10143811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1157 | Open in IMG/M |
| 3300029636|Ga0222749_10388019 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300029636|Ga0222749_10752065 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031231|Ga0170824_108901155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp14 | 992 | Open in IMG/M |
| 3300031590|Ga0307483_1010555 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031708|Ga0310686_117130258 | All Organisms → cellular organisms → Bacteria | 3741 | Open in IMG/M |
| 3300031708|Ga0310686_119138866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2080 | Open in IMG/M |
| 3300031715|Ga0307476_10054465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 2734 | Open in IMG/M |
| 3300031720|Ga0307469_10181544 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300031753|Ga0307477_11097152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031754|Ga0307475_10257802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1398 | Open in IMG/M |
| 3300031823|Ga0307478_10400581 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300031962|Ga0307479_10347851 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300031962|Ga0307479_11577058 | Not Available | 612 | Open in IMG/M |
| 3300031962|Ga0307479_12046838 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031962|Ga0307479_12102112 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032174|Ga0307470_11500752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300032180|Ga0307471_103553357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300032180|Ga0307471_104123509 | Not Available | 513 | Open in IMG/M |
| 3300032515|Ga0348332_13183219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.03% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.51% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.51% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.51% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.51% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.51% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.51% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100376511 | 3300001545 | Forest Soil | PAGEKQLRYFVSPRNFGVDEINALSKQVQANVLEAFGLDADTKFIKGKAVGSV* |
| JGI12635J15846_100310113 | 3300001593 | Forest Soil | VGEKQLRYRISAASFGVDEINALSRQVQASLLEAFGIAAGTKFLKGEGVGSV* |
| JGI12635J15846_102342392 | 3300001593 | Forest Soil | FGVDEINALSKQVQASLLGAFGIAADTKFLKGKAVSSV* |
| JGI25388J43891_10428081 | 3300002909 | Grasslands Soil | NFGVDEINALSKQVQAKILAAFGLAADTKFLKGKAVGTV* |
| JGI25617J43924_103359801 | 3300002914 | Grasslands Soil | LRYFVSPQNFGVDEINALSKQVQANILAAFGLAADTKFLKGKAVGTV* |
| Ga0066674_104440682 | 3300005166 | Soil | PAGERQLRYFVSPQNFGVEEINALSKQVQASVIEAFGLAVDTKFRKGKAAGTV* |
| Ga0070708_1004803033 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KQLRYFVGPQDFGLNQINALAKQVQTSMLEAFGLAADTKFLKGETVGSV* |
| Ga0070708_1018648781 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QDFGVTEINALTKQVQANILEAFGVAADIKFLKGKAVGSV* |
| Ga0070697_1018022461 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPRNLGIDEINALSKQVQAKLLEAFGLAADTKFLRGKAVGSV* |
| Ga0070686_1004406141 | 3300005544 | Switchgrass Rhizosphere | PESFGVDQINTLSKQVQDNLLEALGLAADTRFLKGKAAGSL* |
| Ga0066707_107653432 | 3300005556 | Soil | VDEINALTKQVQANILEAFGLAADTKFRKGKAAGSA* |
| Ga0066691_104364181 | 3300005586 | Soil | EINALSKQVQASVIEAFGLAVDTKFRKGKAAGTV* |
| Ga0070762_113061401 | 3300005602 | Soil | AASFGVDEINALSRQVQASLLEAFGIAADAKFLKGEAVGSI* |
| Ga0081540_12666292 | 3300005983 | Tabebuia Heterophylla Rhizosphere | SPQDFGLNEINALAKQVQTSLLEAFGLAADTKFLKGKAVGSP* |
| Ga0070717_106216932 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QLRYLVSAASFGVDKINALSKQVQANVLEAFGLAGDTKFVKTKAVASVLD* |
| Ga0097621_1013295072 | 3300006237 | Miscanthus Rhizosphere | GEKQLRYFVSPQDFGLNEINALAKQVQTSVLEAFGLAADTKFLKGRAVGSV* |
| Ga0066658_103337551 | 3300006794 | Soil | FGVDEINALSKRVQANVLEAFGLAADTKFLKGKAVGSV* |
| Ga0066665_111233791 | 3300006796 | Soil | TPAGERQLRYFVSPQNFGVEEINALSKQVQASVIEAFGLAVDTKFRKGKAAGTV* |
| Ga0066659_111318451 | 3300006797 | Soil | RSIGVDEINALTKQVQANILEAFGLAADTKFLKGKAAGSA* |
| Ga0075433_109071353 | 3300006852 | Populus Rhizosphere | DQINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV* |
| Ga0075435_1009488581 | 3300007076 | Populus Rhizosphere | RYLVSPEGFGVDQINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV* |
| Ga0099791_102197001 | 3300007255 | Vadose Zone Soil | EKQLRYFVGPQDFGLNEINALSKRVQTSMLEAFGLAADTKFLKGKAAGTA* |
| Ga0099791_102869423 | 3300007255 | Vadose Zone Soil | GVDQINALSKQVQAKLLEAFGLAADTKFFKDKPVASA* |
| Ga0099793_100439173 | 3300007258 | Vadose Zone Soil | SRASFGVDQMNSLSKQVQGNLLEAFGLAADTKFVKGKAAASV* |
| Ga0099793_101627321 | 3300007258 | Vadose Zone Soil | GERQLRYFVSPQNFGVDEINALSKQVQANILAAFGLAADTKFLKGKAVGTF* |
| Ga0099793_104634392 | 3300007258 | Vadose Zone Soil | DEINAVSKQVQANVLEAFGLAADTKFLKGKAVGSV* |
| Ga0099829_106374051 | 3300009038 | Vadose Zone Soil | KQLRYFVSPQDFGLNEINALAKRVQTSVLEAFGLAADTKFLKGKAVGSI* |
| Ga0099829_106761861 | 3300009038 | Vadose Zone Soil | FGVDEINALSKQVQAKVLEAFGLAADTKFRKGKAVGSV* |
| Ga0099828_111054381 | 3300009089 | Vadose Zone Soil | AGERQLRYFVSPQNFGVDEINALSKQVQANILEAFGLAADTKFLKGKAAGSA* |
| Ga0099827_113295321 | 3300009090 | Vadose Zone Soil | PQKFGVDEINALSRQVQADVLEAFGLAADTKFLKSKAVGSV* |
| Ga0075423_104101481 | 3300009162 | Populus Rhizosphere | PEGFGVDQINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV* |
| Ga0116135_14085522 | 3300009665 | Peatland | RYRIGGASFGVDEINALSRKVQASLLEAFGIAADTKFLKGNAVGSV* |
| Ga0099796_103823922 | 3300010159 | Vadose Zone Soil | LVSPRNYGVDEMNALAKQVQGKVLERFDLTADTKFVKGKAVGAA* |
| Ga0126344_14545681 | 3300010866 | Boreal Forest Soil | NFGVDEINALSRQVQASVLEAFRIAADTKFVKGKAVGSA* |
| Ga0150983_121308921 | 3300011120 | Forest Soil | SPQKFGVDEINALSKQVQAKLLDAFGLAADTKFLKGKAVGSV* |
| Ga0137392_103129132 | 3300011269 | Vadose Zone Soil | NEINALAKKVQTGVLEAFGLAADTKFLKGRAVGSV* |
| Ga0137392_104340401 | 3300011269 | Vadose Zone Soil | TPAGEKKLRYFVSPQDFGVDEINALSKRVQANVLEAFGLAADTKFLKGKAVGSV* |
| Ga0137392_105246061 | 3300011269 | Vadose Zone Soil | QLRYFVSPQNFGVDEINALSKQVQAKVLEAFGLAADTKFRKGKAVGSV* |
| Ga0137391_102934642 | 3300011270 | Vadose Zone Soil | GERQLRYFVSPQNFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAVGSV* |
| Ga0137391_105081311 | 3300011270 | Vadose Zone Soil | QLRYFVSPQNFGVDEINALSKQVQANILAAFGLAADTKFLKGKAVGTV* |
| Ga0137393_101049563 | 3300011271 | Vadose Zone Soil | EKQLRYFVSPQNFGVDEINALSKQVQAKVLEAFGLAADTKFRKGKAVGSV* |
| Ga0137393_102499253 | 3300011271 | Vadose Zone Soil | QLRYFVSPQDFGLNEINALCKRVQTGALEAFGLTEDTKFRKGKAVGSV* |
| Ga0137389_103857531 | 3300012096 | Vadose Zone Soil | LRYFVSPQDFGVDEINALTKRVQANVLEAFGLAADTKFLKGKAVGSV* |
| Ga0137389_111668051 | 3300012096 | Vadose Zone Soil | GEKQLRYFVSPQDFGVDEINALTKQVQANVLAAFGLAADTKFVKGKAAGTV* |
| Ga0137389_117862412 | 3300012096 | Vadose Zone Soil | QLRYFVSPQNFGVDEINALSKQVQASVLEAFGLAADTKFRKGKAVGSA* |
| Ga0137389_118020271 | 3300012096 | Vadose Zone Soil | VDEINALSKQVQANILEAFGLAADTKFLKGKAVGSV* |
| Ga0137388_101366573 | 3300012189 | Vadose Zone Soil | GIDEINALSKQVQAKLLEAFDLAADTKFLKGKAVGTV* |
| Ga0137388_109651282 | 3300012189 | Vadose Zone Soil | MVSPEGFGVDQINALSRQVQAKLLEAFGLAADTKFFKDKPVASA* |
| Ga0137388_118705412 | 3300012189 | Vadose Zone Soil | EINALSKQVQSKVLEAFGLAADTKFLKGKAVGSV* |
| Ga0137364_111975632 | 3300012198 | Vadose Zone Soil | VDEINALSKQVQAKVLEAFGLAADTTFRKGKAVGSV* |
| Ga0137364_113847291 | 3300012198 | Vadose Zone Soil | DFGLNEINALSKQVQTSVLEAFGLAADTKFLESNTVGFV* |
| Ga0137363_102648361 | 3300012202 | Vadose Zone Soil | KQLRYLVSPQSLGVDRLNALSKQVQANLLEAFGLAADTRFLKGKAVGSV* |
| Ga0137363_105447932 | 3300012202 | Vadose Zone Soil | VGPQDFGLNEINALSKRVQTSMLEAFGLAADTKFLKGKAAGTA* |
| Ga0137363_117362312 | 3300012202 | Vadose Zone Soil | GEKQLRYFVSPQNFGVDEINALTKQVQANVLEAFGLAADTKFFKAKPVASA* |
| Ga0137399_100536051 | 3300012203 | Vadose Zone Soil | VDEINALSKQVQANVLEAFGLAADTKFLKGKAVGTV* |
| Ga0137399_105541072 | 3300012203 | Vadose Zone Soil | FGVDEINALTKRVQAKLLEAFGLAAATGFLKGKAVGSV* |
| Ga0137399_106809452 | 3300012203 | Vadose Zone Soil | VSPQNFGVDEINALSKQVQANILAAFGLAADTKFLKGKAVGTF* |
| Ga0137399_115782491 | 3300012203 | Vadose Zone Soil | RVSLGVDQINALSRQVQANLLEGFGIAADTRFLKGKAASSV* |
| Ga0137399_118063301 | 3300012203 | Vadose Zone Soil | FGVDEINALSKQVQANVLEAFGLAADTKFLKGKAVGTV* |
| Ga0137362_100372762 | 3300012205 | Vadose Zone Soil | GVDEINALSKQVQANILEAFGLAADTKFLKGKAVGSV* |
| Ga0137362_101999093 | 3300012205 | Vadose Zone Soil | LRYFVSPQNFGVDEINALSKQVQTNVLEAFGLAADTKFRKGKAAGSV* |
| Ga0137362_109749751 | 3300012205 | Vadose Zone Soil | EKQLRYFVSPQDFGLNEINALSKRLQTKALEAFGLAADTKFLKGKAVGSA* |
| Ga0137360_102571561 | 3300012361 | Vadose Zone Soil | PQGYGVDQIDALSKQVQGKLLEAFGLAADTKFLKGKAVASV* |
| Ga0137360_106351494 | 3300012361 | Vadose Zone Soil | AGEKQLRYLVSRSGFGVDQINALSKQVQAKLLEAFGLAADTKFLKGKAVGSA* |
| Ga0137360_114266271 | 3300012361 | Vadose Zone Soil | KQMRYLVSRVSLGVGQINDISRQVQANLLEGFGIAADTRFLKGKAASSV* |
| Ga0137360_114283241 | 3300012361 | Vadose Zone Soil | QDFGVGEINALSKRLQTKALEAFGLAADTKFLKGKAVGSA* |
| Ga0137361_116271342 | 3300012362 | Vadose Zone Soil | EINALSKRVQANMLEAFGLAADTKFFKRKAVGSV* |
| Ga0137358_103495091 | 3300012582 | Vadose Zone Soil | AGEKQLRYFVGPQDFGLNEINALSKRVQTSMLEAFGLAADTKFLKGKAAGTA* |
| Ga0137358_104831333 | 3300012582 | Vadose Zone Soil | DEINALSKQVQANILAAFGLAADTKFLKGKAVGTV* |
| Ga0137358_106964571 | 3300012582 | Vadose Zone Soil | NEINALAKRVQTSVLEAFGLAADTKFLKGKAVGSA* |
| Ga0137358_109837971 | 3300012582 | Vadose Zone Soil | QDFGLNEINALSKRVQTSMLEAFGLAADTKFLKGKAVGAV* |
| Ga0137358_110903021 | 3300012582 | Vadose Zone Soil | IETPAGEKQMRYLVSRVSLGVDQINALSRQVQANLLEGFGIAADTRFLKGKAASSV* |
| Ga0137397_101289643 | 3300012685 | Vadose Zone Soil | SPQNFGVEEINALTKQVQANVLEAFGLSADIKFLKGKAAGSA* |
| Ga0137397_110825241 | 3300012685 | Vadose Zone Soil | KQMRYLVSRVSLGVDQINALSRQVQANLLEGFGIAADTRFLKGKAASSV* |
| Ga0137395_100824034 | 3300012917 | Vadose Zone Soil | RYFVSPQNFGVEEINALAKQVQAKVIERFGLAADTKFLKWKAVGTA* |
| Ga0137396_107151911 | 3300012918 | Vadose Zone Soil | RYFVSPQNFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAVGTV* |
| Ga0137396_111061931 | 3300012918 | Vadose Zone Soil | FGVDEINALSKQVQANVLEAFGLAADTEFLKGKAVGTV* |
| Ga0137394_114251512 | 3300012922 | Vadose Zone Soil | PQDFGLNEINALSKRVQTSMLEAFGLAADTKFLKGKAVGAV* |
| Ga0137359_114177981 | 3300012923 | Vadose Zone Soil | KQLRYLVSPEGFGVDQINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV* |
| Ga0137359_115797722 | 3300012923 | Vadose Zone Soil | KQLRYLVSPESFGVDQINALSEQVQARVLEAFGLAADTRFLKGKAVASV* |
| Ga0137419_114560662 | 3300012925 | Vadose Zone Soil | PESFGVDQINALSKQVQANLLEAFGLAVDTKFLKGQAVGSV* |
| Ga0137419_115251642 | 3300012925 | Vadose Zone Soil | NFGVEEINALSKQVQTSVLEAFGLAADIKFLKGKAAGSV* |
| Ga0137416_102761421 | 3300012927 | Vadose Zone Soil | KQLRYLVSPRDLGIDEINALSKQVQGKLLEAFGLAADTKFRKGKAVASV* |
| Ga0137416_109915902 | 3300012927 | Vadose Zone Soil | KQLRYLVSPRDLGIDEINALSKQVQGKLLEAFGLAADTKFLKGKAVASV* |
| Ga0137416_111127252 | 3300012927 | Vadose Zone Soil | FVSPQNFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAVGTV* |
| Ga0137416_115965901 | 3300012927 | Vadose Zone Soil | RYLVSRVSLGVDQINALSRQVQANLLEGFGIAADTRFLKGKAASSV* |
| Ga0137416_121021302 | 3300012927 | Vadose Zone Soil | GERQLRYFVSPQNFGVDEINALSKQVQANVLEGFGLAADTKFLKGKAVGSV* |
| Ga0137404_113675202 | 3300012929 | Vadose Zone Soil | VGPQDFGVDEINALSKRVQTSVLEAFGLAADTKFRKGKAVGSV* |
| Ga0137410_1000050224 | 3300012944 | Vadose Zone Soil | MYFVSPQGYGIDQINALSKQVQGKLLEAFGLAADTKFLKGKAVASV* |
| Ga0181531_106365112 | 3300014169 | Bog | YRISAASFGVDEINTLSRQVQASLLDAFGIAADTKFLKGKVVGSV* |
| Ga0182018_104526511 | 3300014489 | Palsa | KLLRYRISAASFGVDEINALSRQVQASLLEAFGIAADTKFIKNKSVGSF* |
| Ga0137420_12883492 | 3300015054 | Vadose Zone Soil | QLRYFVSPQKFGVDEINALSRQVQANVLEAFGLAADTKFLKGKAVGSV* |
| Ga0137420_13123728 | 3300015054 | Vadose Zone Soil | NFGVDEINALSQQVQANVLEGFGLAADTKFLKGKAVGSV* |
| Ga0137420_13849702 | 3300015054 | Vadose Zone Soil | GEKQLRYFVGPQNFGVEEINALSKQVQTSVLEAFGLAADTKFLKGKAVGSA* |
| Ga0137403_100345841 | 3300015264 | Vadose Zone Soil | KQLRYLVSPRNYGVDEMNALAKQVQSKVLEGFDLTADTKFVKGKAVGAT* |
| Ga0182041_112854252 | 3300016294 | Soil | PPNFGVDEIYALSKQVQTNVLEAFGLTTDIEFLKGKAVGSV |
| Ga0182039_110819242 | 3300016422 | Soil | NFGVDEINALSKQVQTNVLEAFGLTTDIEFLKGKAVGSV |
| Ga0187781_110154842 | 3300017972 | Tropical Peatland | VGEKQLRYRISAASFGVDEINTLSRQVQASLLEAFGIAADTKFLKGKAVGSV |
| Ga0066662_123212821 | 3300018468 | Grasslands Soil | YFVSPQEFGVEEINALSKQVQASVIEAFGLAVDTKFRKGKAAGTV |
| Ga0066669_100013011 | 3300018482 | Grasslands Soil | LRYLVSPETFGVDEINALSKQVQAKVLEAFGLAADTTFLKGKAVGSI |
| Ga0193735_10297132 | 3300020006 | Soil | LRYFVSPRNLGIDEINALAKQVQAKLLEAFGLAADTKFLKGKAVASV |
| Ga0179594_103731051 | 3300020170 | Vadose Zone Soil | RYFVSPQDFGLNEINALAKRVQTSVLEAFGLAADTKFLKGKAVGSA |
| Ga0179592_105066601 | 3300020199 | Vadose Zone Soil | LRYFVSPQNFGVEEINALAKQVQTNLLEGFGLAADTKFLKGKAVGSV |
| Ga0210407_109163471 | 3300020579 | Soil | LRYFVSPQDFGVDQINALSKQVQTNVLEVLGLGADTKFLKGKAVGSV |
| Ga0210399_110327282 | 3300020581 | Soil | KQLRYFIGPQDFGLNQINALSKQVQTSVLEAMGLADDTKFRKGKAVGAV |
| Ga0210401_104304372 | 3300020583 | Soil | NFGVEEINALAKQVQAKVLEAFGLTADTKFRKGKAVGSV |
| Ga0210401_105849081 | 3300020583 | Soil | QLRYLVSPEGFGVDQINALSKQVQAKLLEAFGLDAVTKFFKDKPVASA |
| Ga0215015_100713263 | 3300021046 | Soil | LRYLVSPRNLGIDEINALSKQVQAKLLEGFGLAADTKFLKGKAVGSV |
| Ga0210404_101713432 | 3300021088 | Soil | QLRYFVSPRKFGVDEINALSKQVQANVLEAFGLAADTKFLKGRAVGSV |
| Ga0210404_103984991 | 3300021088 | Soil | SFGVDEINALTKQVQANVLEAFGLVADTKFLKGKAVGSV |
| Ga0210404_104959252 | 3300021088 | Soil | NEINALTKQVQAKVLEGFGLAADTKFVKGKAVGAA |
| Ga0210404_105497032 | 3300021088 | Soil | LVSPQSFGVDEINALSKRMQAKLLEAFDLAADTKFVKGKAVASV |
| Ga0210406_103487322 | 3300021168 | Soil | NFGVEEINALAKQVQAKVLEAFGLAADTKFRKGKAVGSV |
| Ga0210406_104749582 | 3300021168 | Soil | YIVSPQKFGVDEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV |
| Ga0210406_107139172 | 3300021168 | Soil | QINTLTNQVQANLLEAFGLADDTKFLKGKAVGSAWALLCC |
| Ga0210400_107863331 | 3300021170 | Soil | RYLVSPQSFGVDQINALSKQVQGKLLEAFGLAAATKFLKGKAVASV |
| Ga0210400_112126712 | 3300021170 | Soil | HVSPQNFGVDEINALSKQVQAKVLEAFDLAADTQFRKGKAVGSV |
| Ga0210405_106535581 | 3300021171 | Soil | DEINVLSHRVQTKLLEAFGLTADTKFLQGKAVGSV |
| Ga0210405_114184061 | 3300021171 | Soil | PAGEKQLRYFVSPRKFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAAGNV |
| Ga0210396_100198951 | 3300021180 | Soil | VEEINALSKQVQDSILEAFGLTADTKFVKGKAAASV |
| Ga0210396_106688071 | 3300021180 | Soil | SPETFGVDQINALSKQVQTNLLEAFGVAAYIKFLKGKAVGSV |
| Ga0210396_116223301 | 3300021180 | Soil | ASLGVDQINTLTNQVQANLLEAFGLADDTKFLKGKAVGSAWALLCC |
| Ga0210388_103043943 | 3300021181 | Soil | KLLRYRVSAASFGVDEINALSRQVQASLLEAFGIAADTKFLKGKAVGSV |
| Ga0210387_100631191 | 3300021405 | Soil | ASFGVDEINALSRQVQASLLEAFGIAADTKFLKGEAVGSV |
| Ga0210387_105422552 | 3300021405 | Soil | LVSPETFGVDQINTLSRQVQANLLEGLGLAADIKFLKGKAVASV |
| Ga0210386_100764264 | 3300021406 | Soil | GEKQPRYRISAASFGVDEINALSRQVQASLLEAFGIAADTKFIKGKAVGSV |
| Ga0210394_108805771 | 3300021420 | Soil | YFVSPQDFGLNEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV |
| Ga0210384_114095861 | 3300021432 | Soil | LVSPESFGVDQINALAEQVQARVLEAFGLAADIGFLKGKAVGSI |
| Ga0210410_112567141 | 3300021479 | Soil | QDFGVDEINAYLQRVQTSVLEAFGLAAATKFVKGKAAGAD |
| Ga0210409_110511922 | 3300021559 | Soil | IETPAGEKQLRYIVSPQKFGVDEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV |
| Ga0210409_113545722 | 3300021559 | Soil | RYFVSARNLGIDEINALSKQVQAKLLEAFGLAANTKFLKGKAVGSV |
| Ga0242642_10214091 | 3300022504 | Soil | VSPQSFGVDQINALSKQVQGKLIEGFGLAADTKFLKGKAVGSV |
| Ga0242666_11508892 | 3300022721 | Soil | AASFGVDEINALSRQVQASLLEAFGIAADTKFLKGKAVGSV |
| Ga0242654_103158451 | 3300022726 | Soil | IVSPQKFGVDEINALSKQVQAKLLEAFGLAADTKFLKGKAAGSV |
| Ga0224551_10973681 | 3300023259 | Soil | FGVDEINALSRQVQASLLEAFGIAADAKFLKGEAVGSI |
| Ga0224565_10369282 | 3300024176 | Plant Litter | GEKQLRYRIGGASFGVDEINALSGKVQASLLEAFGIAADTKFLRGEAVASV |
| Ga0137417_11418361 | 3300024330 | Vadose Zone Soil | FVSPQNFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAVGTV |
| Ga0137417_13247282 | 3300024330 | Vadose Zone Soil | RYLVSRVSLGVDQINALSRQVQANLLEGFGIAADTRFLKGKAASSV |
| Ga0137417_14660204 | 3300024330 | Vadose Zone Soil | PAGEKQLRYLVSSTSFGVEQINALSKQVQGKLLEAFGLAADTKFLKGKAVGSV |
| Ga0209438_10880642 | 3300026285 | Grasslands Soil | RYLVSPESFGVDQINALSKQVQANLLEAFGLAADTKFLKAKQ |
| Ga0209236_10732131 | 3300026298 | Grasslands Soil | PQNFGVDEINALSRQVQANVLEAFGLAADTKFLKGKAVGSV |
| Ga0209238_10505452 | 3300026301 | Grasslands Soil | GERQLRYFVSPQNFGIDEINALSKQVQANILAAFGLAADTKFLKGKAVGTV |
| Ga0209240_10480023 | 3300026304 | Grasslands Soil | RQLRYFVSPQNFGVDEINALSKQVQANVLEGFGLAADTKFLKGKAVGSV |
| Ga0209471_11099182 | 3300026318 | Soil | RSAGERQLRYFVSPQNFGVEEINALSKQVQASVIEAFGLAVDTKFRKGKAAGTV |
| Ga0257163_10255392 | 3300026359 | Soil | FGVVEINALAKQVQTKVLEGFGLTADTQFRKGKAVGSV |
| Ga0257171_10420232 | 3300026377 | Soil | LGIDEINALSKQVQAKLLEAFGLAADTKFLKGKAVGAV |
| Ga0257169_10898591 | 3300026469 | Soil | FVSPRNLGIDEINALSKQVQAKMLEAFGLAADTKFLKGKAVGAV |
| Ga0257159_10253282 | 3300026494 | Soil | DFGLNQINALSKQVQTSMLEAFGLAADTRFLKGKAVGSV |
| Ga0257157_10516351 | 3300026496 | Soil | GVEQINALSKQVQSKLLEAFGLAADTKFLKGKAVGSV |
| Ga0209690_10370423 | 3300026524 | Soil | TPAGERQLRYFVSPQKFGVDEINALSRQVQANVLEAFGLAADTKFLKSKAVGSV |
| Ga0209160_12581281 | 3300026532 | Soil | QKFGVDEINALSRQVQANVLEAFGLAADTKFLKGKAVGSV |
| Ga0209648_108159831 | 3300026551 | Grasslands Soil | GVDEINALSKQVQTSVLEAFGLAADTKFLKGKAVGSV |
| Ga0179587_108510191 | 3300026557 | Vadose Zone Soil | LYFFGPQDFGVNEINALSKRVQTSVLEAFGLADDTKFRKGKAVAGAV |
| Ga0207948_10168292 | 3300027174 | Forest Soil | SPRNYGVDEINAVTKQVQANVLEAFGLAAETKFLKGKAVGSV |
| Ga0208241_10723782 | 3300027297 | Forest Soil | GVEEINALTKQVQGSVLEAFGLAADTKFLKGKAVGSV |
| Ga0209529_10470942 | 3300027334 | Forest Soil | VGEKQLRYRISAASFGVDEINALSRQVQASLLEAFGIAAGTKFLKGEGVGSV |
| Ga0208984_10765742 | 3300027546 | Forest Soil | VSPQEFGVDQINALSKQVQGNVLEALGLATDTRFLKDRAVGSV |
| Ga0209422_10092464 | 3300027629 | Forest Soil | ETPAGEKQLRYFVSTQNFGVNEINAVAKQVQASVLEAFGLAANTKFVKGKAVGSV |
| Ga0209422_10683443 | 3300027629 | Forest Soil | LVSPEGFGVDQINALSKQVQAKLLEAFGLAADTKFFKDKPVASA |
| Ga0209422_11580092 | 3300027629 | Forest Soil | VSPTNFGVDEINALTKQIQAKALDAFGLTADTKFLKGKAAAV |
| Ga0208988_10278091 | 3300027633 | Forest Soil | PAGEKQLRYFVSPRNYGVDEINALSKQVQANVLEAFGLAADTKFSKGKAVGSV |
| Ga0208989_101528841 | 3300027738 | Forest Soil | SPEGYGIDQINALSKQVQGKLLEAFGLAADTKFLKGKAVGSV |
| Ga0209180_103325002 | 3300027846 | Vadose Zone Soil | KQLRYFVSPQDFGLNEINALAKRVQTSVLEAFGLAADTKFLKGKAVGSI |
| Ga0209701_100137911 | 3300027862 | Vadose Zone Soil | FVSPWNLGIDEINTLSKQVQAKLLEAFGLAADTKFLKGKAVGAV |
| Ga0209590_100257605 | 3300027882 | Vadose Zone Soil | EKQLRYFVSPQNFGVEEINALAKQVQAKVIERFGLAADTKFLKWKAVGTA |
| Ga0209275_101610454 | 3300027884 | Soil | EKLLRYRISAASFGVDEINALSRQVQASLLEAFGIAADTKFLKGEAVGSV |
| Ga0209275_103538691 | 3300027884 | Soil | YLVSPVTFGVDQINALSAEVQINLLEALGLAADTRFLKGKAVGSV |
| Ga0209380_108335052 | 3300027889 | Soil | LVSPESFGVDQINALSKQVQANLLEAFGVAADIKFLKGKAVASV |
| Ga0209488_100257925 | 3300027903 | Vadose Zone Soil | NLGIDEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV |
| Ga0209006_101615073 | 3300027908 | Forest Soil | YRISAASFGVDEINALSRQVQASLLEAFGIAADTKFPRGKAVGSV |
| Ga0209526_101347231 | 3300028047 | Forest Soil | KQLRYIVSPQDFGLNEINALSKRVQTSVLEAFGLADDTKFRKGKAVGSV |
| Ga0209526_104566071 | 3300028047 | Forest Soil | PAGEKQLRYLVSPESFGVDQINALSKQVQANLLEAFGVAAEIRFLKGKAVASV |
| Ga0137415_112145962 | 3300028536 | Vadose Zone Soil | TPAGEKQLRYFVSPQDFGLNEINALSKRLQTKALEAFGLAADTKFLKGKAVGSA |
| Ga0308309_107855501 | 3300028906 | Soil | RYLVSPESFGVDQINALSKQVQAKLLEAFGLAADTKFFKDRPVASA |
| Ga0308309_115265072 | 3300028906 | Soil | PAGEKQLRYLVSPESFGVDQINALSKQVQANVLEGFGVAADIKFLKGKAVASV |
| Ga0222749_101438111 | 3300029636 | Soil | KQLRYFVSPQDWGVGEINALSKRVQANMLEGFGLTADTKFLKGKAVGSV |
| Ga0222749_103880191 | 3300029636 | Soil | TPAGEKQLRYLVSPETFGVDQINALSKQVQTNLLEAFGVAADIKFLKGKAVGSF |
| Ga0222749_107520651 | 3300029636 | Soil | KQLRYFVSPRKFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAVGSV |
| Ga0170824_1089011552 | 3300031231 | Forest Soil | LISPESFGVDQINALAKQLQANLLDAFGVTADVKFLKNKAVASV |
| Ga0307483_10105552 | 3300031590 | Hardwood Forest Soil | RYFVSPQDFGLNEINALSKRVQSSVLEAFGLAADTKFLKGKAVGSV |
| Ga0310686_1171302581 | 3300031708 | Soil | LRYRISAASFGVDEINALSRKVQASLLEAFGIAADTKFLKGKAVGSV |
| Ga0310686_1191388664 | 3300031708 | Soil | AGEKQLRYRISAASFGVDEINALSRKVQASLLEAFGITADTKFLKGKAVGSV |
| Ga0307476_100544653 | 3300031715 | Hardwood Forest Soil | SAASFGVDEINALSRQVQASLLEAFGIAADTKFLTGKAGGSG |
| Ga0307469_101815441 | 3300031720 | Hardwood Forest Soil | RKFGVDEINALSKQVQATVLEAFGLTADTKFLKGKAVGSV |
| Ga0307477_110971522 | 3300031753 | Hardwood Forest Soil | GEKQLRYFVSPRKFGVDEINALSKQVQANVLEAFGLAADTKFLKGKAAGSV |
| Ga0307475_102578023 | 3300031754 | Hardwood Forest Soil | LRYFVGPQDFGVNEINAVSKRVQTSVLEAFGLAADTKFLKGKAVGSV |
| Ga0307478_104005811 | 3300031823 | Hardwood Forest Soil | SAASFGVDEINALSRQVQASLLEAFGIAADTKFLTGKAGGSV |
| Ga0307479_103478513 | 3300031962 | Hardwood Forest Soil | GLNEINALSKRVQTSVLEAFGLAADTKFRKGKAVGSV |
| Ga0307479_115770582 | 3300031962 | Hardwood Forest Soil | LRYFVSPQSYGVEEINALAKQVQAKVLEAFGLTADTKFRKGKAVGSV |
| Ga0307479_120468381 | 3300031962 | Hardwood Forest Soil | QLRYLVSPESFGVDQINTLSKQVQTNLLEALGLAADTRFLKGKAAGSV |
| Ga0307479_121021121 | 3300031962 | Hardwood Forest Soil | FGLNEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSV |
| Ga0307470_115007521 | 3300032174 | Hardwood Forest Soil | RYFIGPQDFGLNQINALAKQVQTSVLEAFGLAADTKFLKGKAVGSV |
| Ga0307471_1035533571 | 3300032180 | Hardwood Forest Soil | FVSPQNYGVEEINALAKQVQGNVLEAFGLAADTQFLKGKAAGSV |
| Ga0307471_1041235091 | 3300032180 | Hardwood Forest Soil | NFGVEEINALTKQVQAKVLEAFGLTADTTFLKGKAAGSA |
| Ga0348332_131832192 | 3300032515 | Plant Litter | EKQLRYRIGGASFGVDEINALSRKVQASLLEAFGIAADTKFLRGEAVASV |
| ⦗Top⦘ |