


| Basic Information | |
|---|---|
| Family ID | F026640 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKTVLLGAVVAITATLAHAEDMAEMISRYRHAHGLSTVKTDP |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.86 % |
| % of genes near scaffold ends (potentially truncated) | 98.48 % |
| % of genes from short scaffolds (< 2000 bps) | 90.86 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.756 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.721 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.350 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.284 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF10129 | OpgC_C | 7.61 |
| PF01565 | FAD_binding_4 | 6.60 |
| PF08327 | AHSA1 | 3.55 |
| PF02945 | Endonuclease_7 | 2.54 |
| PF05872 | HerA_C | 2.54 |
| PF01370 | Epimerase | 2.54 |
| PF11578 | DUF3237 | 2.03 |
| PF03411 | Peptidase_M74 | 1.52 |
| PF14588 | YjgF_endoribonc | 1.52 |
| PF03401 | TctC | 1.02 |
| PF04392 | ABC_sub_bind | 1.02 |
| PF00775 | Dioxygenase_C | 1.02 |
| PF00107 | ADH_zinc_N | 1.02 |
| PF13602 | ADH_zinc_N_2 | 1.02 |
| PF01738 | DLH | 1.02 |
| PF03572 | Peptidase_S41 | 1.02 |
| PF09084 | NMT1 | 1.02 |
| PF03924 | CHASE | 1.02 |
| PF12974 | Phosphonate-bd | 1.02 |
| PF00497 | SBP_bac_3 | 0.51 |
| PF06725 | 3D | 0.51 |
| PF00583 | Acetyltransf_1 | 0.51 |
| PF01042 | Ribonuc_L-PSP | 0.51 |
| PF00155 | Aminotran_1_2 | 0.51 |
| PF06983 | 3-dmu-9_3-mt | 0.51 |
| PF00805 | Pentapeptide | 0.51 |
| PF06296 | RelE | 0.51 |
| PF07075 | DUF1343 | 0.51 |
| PF01740 | STAS | 0.51 |
| PF08450 | SGL | 0.51 |
| PF02668 | TauD | 0.51 |
| PF02630 | SCO1-SenC | 0.51 |
| PF08031 | BBE | 0.51 |
| PF00528 | BPD_transp_1 | 0.51 |
| PF07746 | LigA | 0.51 |
| PF02738 | MoCoBD_1 | 0.51 |
| PF13417 | GST_N_3 | 0.51 |
| PF01977 | UbiD | 0.51 |
| PF12697 | Abhydrolase_6 | 0.51 |
| PF00920 | ILVD_EDD | 0.51 |
| PF13924 | Lipocalin_5 | 0.51 |
| PF03466 | LysR_substrate | 0.51 |
| PF00561 | Abhydrolase_1 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 2.54 |
| COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 1.52 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.02 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.02 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 1.02 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.02 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.02 |
| COG3452 | Extracellular (periplasmic) sensor domain CHASE (specificity unknown) | Signal transduction mechanisms [T] | 1.02 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.02 |
| COG3614 | Extracytoplasmic sensor domain CHASE1 (specificity unknown) | Signal transduction mechanisms [T] | 1.02 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.02 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.51 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.51 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.51 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.51 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.51 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.51 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.51 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.51 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.76 % |
| Unclassified | root | N/A | 16.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1030873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. ANT_WB101 | 775 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1070863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1067548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300000890|JGI11643J12802_11296852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300001081|JGI12662J13196_1009872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300001431|F14TB_100240793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. ANT_WB101 | 677 | Open in IMG/M |
| 3300001545|JGI12630J15595_10012422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1841 | Open in IMG/M |
| 3300001661|JGI12053J15887_10277324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300002076|JGI24749J21850_1010993 | Not Available | 1270 | Open in IMG/M |
| 3300002568|C688J35102_118062941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300002568|C688J35102_119467304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300004635|Ga0062388_100909101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300005180|Ga0066685_10466714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 876 | Open in IMG/M |
| 3300005181|Ga0066678_10358184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Salinarimonadaceae → Salinarimonas → Salinarimonas rosea | 963 | Open in IMG/M |
| 3300005330|Ga0070690_101021995 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005332|Ga0066388_100016793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6155 | Open in IMG/M |
| 3300005332|Ga0066388_100437026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1951 | Open in IMG/M |
| 3300005332|Ga0066388_102320185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 971 | Open in IMG/M |
| 3300005332|Ga0066388_105893277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300005332|Ga0066388_106855542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300005356|Ga0070674_100214062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1495 | Open in IMG/M |
| 3300005457|Ga0070662_100698684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 858 | Open in IMG/M |
| 3300005535|Ga0070684_102318687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 506 | Open in IMG/M |
| 3300005558|Ga0066698_10823365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300005562|Ga0058697_10340331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300005569|Ga0066705_10681980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
| 3300005618|Ga0068864_100185202 | Not Available | 1905 | Open in IMG/M |
| 3300005618|Ga0068864_102426746 | Not Available | 531 | Open in IMG/M |
| 3300005719|Ga0068861_100812394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 878 | Open in IMG/M |
| 3300005764|Ga0066903_101033698 | Not Available | 1506 | Open in IMG/M |
| 3300005764|Ga0066903_101559984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300005764|Ga0066903_101679141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1208 | Open in IMG/M |
| 3300005764|Ga0066903_105867420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300005764|Ga0066903_106567597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300005764|Ga0066903_106924963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300005764|Ga0066903_108258345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300005764|Ga0066903_108525889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005764|Ga0066903_108589739 | Not Available | 520 | Open in IMG/M |
| 3300005840|Ga0068870_10009981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4341 | Open in IMG/M |
| 3300006038|Ga0075365_10600371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 778 | Open in IMG/M |
| 3300006041|Ga0075023_100279975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300006046|Ga0066652_100549332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1081 | Open in IMG/M |
| 3300006050|Ga0075028_100997436 | Not Available | 521 | Open in IMG/M |
| 3300006175|Ga0070712_100704917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 861 | Open in IMG/M |
| 3300006175|Ga0070712_100808880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 804 | Open in IMG/M |
| 3300006175|Ga0070712_100862090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300006572|Ga0074051_10000901 | Not Available | 1429 | Open in IMG/M |
| 3300006574|Ga0074056_10003711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1599 | Open in IMG/M |
| 3300006576|Ga0074047_12003768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300006577|Ga0074050_11174626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300006847|Ga0075431_100847516 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300006904|Ga0075424_101439211 | Not Available | 732 | Open in IMG/M |
| 3300006953|Ga0074063_12740055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300009038|Ga0099829_10896133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300009143|Ga0099792_11218700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300009147|Ga0114129_10397524 | Not Available | 1817 | Open in IMG/M |
| 3300009147|Ga0114129_11597613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300009148|Ga0105243_10025243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4538 | Open in IMG/M |
| 3300009148|Ga0105243_10073409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2772 | Open in IMG/M |
| 3300009156|Ga0111538_11314364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 913 | Open in IMG/M |
| 3300009174|Ga0105241_12236841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300009176|Ga0105242_10182697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1851 | Open in IMG/M |
| 3300009545|Ga0105237_10745223 | Not Available | 986 | Open in IMG/M |
| 3300010047|Ga0126382_12116574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300010048|Ga0126373_13333848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300010358|Ga0126370_10752655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300010358|Ga0126370_12283767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010359|Ga0126376_10177544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1739 | Open in IMG/M |
| 3300010359|Ga0126376_11445083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300010360|Ga0126372_11508087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300010360|Ga0126372_12340014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300010361|Ga0126378_10957854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 961 | Open in IMG/M |
| 3300010362|Ga0126377_11257335 | Not Available | 811 | Open in IMG/M |
| 3300010362|Ga0126377_12764114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300010366|Ga0126379_10357873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1493 | Open in IMG/M |
| 3300010366|Ga0126379_10530652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. ANT_WB101 | 1253 | Open in IMG/M |
| 3300010375|Ga0105239_11781877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300010376|Ga0126381_103691049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300010396|Ga0134126_12305297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300010398|Ga0126383_10803098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300010398|Ga0126383_12203730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300010401|Ga0134121_10327345 | Not Available | 1365 | Open in IMG/M |
| 3300012211|Ga0137377_10065855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3383 | Open in IMG/M |
| 3300012685|Ga0137397_11158783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300012897|Ga0157285_10240810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300012911|Ga0157301_10288877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300012948|Ga0126375_10274114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
| 3300012951|Ga0164300_10915632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300012958|Ga0164299_10298082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300012958|Ga0164299_11026628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300012961|Ga0164302_10054556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2004 | Open in IMG/M |
| 3300012961|Ga0164302_10288734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300012971|Ga0126369_11260788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300012971|Ga0126369_11319644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300012988|Ga0164306_11478311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300012989|Ga0164305_10011483 | All Organisms → cellular organisms → Bacteria | 4290 | Open in IMG/M |
| 3300012989|Ga0164305_10685965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 835 | Open in IMG/M |
| 3300013297|Ga0157378_10632054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 1085 | Open in IMG/M |
| 3300013306|Ga0163162_11114963 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300014325|Ga0163163_12220550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300014326|Ga0157380_10319214 | Not Available | 1439 | Open in IMG/M |
| 3300014969|Ga0157376_11436921 | Not Available | 722 | Open in IMG/M |
| 3300015372|Ga0132256_100447625 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300015373|Ga0132257_100126624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2972 | Open in IMG/M |
| 3300016270|Ga0182036_11252894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas | 618 | Open in IMG/M |
| 3300016357|Ga0182032_11038974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300016422|Ga0182039_10539657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1012 | Open in IMG/M |
| 3300016445|Ga0182038_10903922 | Not Available | 778 | Open in IMG/M |
| 3300016445|Ga0182038_11341083 | Not Available | 640 | Open in IMG/M |
| 3300016445|Ga0182038_11773526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 557 | Open in IMG/M |
| 3300016445|Ga0182038_11814260 | Not Available | 551 | Open in IMG/M |
| 3300017955|Ga0187817_10530425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300017975|Ga0187782_10944730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300018429|Ga0190272_12784565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300018465|Ga0190269_10203307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300018465|Ga0190269_10436948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300018469|Ga0190270_11532597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300018481|Ga0190271_11406845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300018481|Ga0190271_12429163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300020579|Ga0210407_10807242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300021432|Ga0210384_11665282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300021479|Ga0210410_11417089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300021560|Ga0126371_12613212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300022530|Ga0242658_1011512 | Not Available | 1441 | Open in IMG/M |
| 3300022557|Ga0212123_10269553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
| 3300022756|Ga0222622_10072970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2026 | Open in IMG/M |
| 3300025901|Ga0207688_10003242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8884 | Open in IMG/M |
| 3300025901|Ga0207688_10116232 | Not Available | 1557 | Open in IMG/M |
| 3300025928|Ga0207700_10013316 | All Organisms → cellular organisms → Bacteria | 5345 | Open in IMG/M |
| 3300025931|Ga0207644_10189515 | Not Available | 1616 | Open in IMG/M |
| 3300025931|Ga0207644_10429413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300025932|Ga0207690_11485798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300025933|Ga0207706_11487362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300025936|Ga0207670_10033420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3314 | Open in IMG/M |
| 3300025937|Ga0207669_10122654 | Not Available | 1768 | Open in IMG/M |
| 3300025937|Ga0207669_10508072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 965 | Open in IMG/M |
| 3300026118|Ga0207675_100310244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1538 | Open in IMG/M |
| 3300027669|Ga0208981_1008069 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2655 | Open in IMG/M |
| 3300027729|Ga0209248_10120075 | Not Available | 789 | Open in IMG/M |
| 3300027846|Ga0209180_10389023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300027894|Ga0209068_10668102 | Not Available | 608 | Open in IMG/M |
| 3300027895|Ga0209624_10849018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300028713|Ga0307303_10056464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300028718|Ga0307307_10009476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2573 | Open in IMG/M |
| 3300028754|Ga0307297_10304864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300028778|Ga0307288_10409167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300028787|Ga0307323_10219479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300028811|Ga0307292_10414453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300028814|Ga0307302_10013075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3716 | Open in IMG/M |
| 3300028814|Ga0307302_10191440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 997 | Open in IMG/M |
| 3300028814|Ga0307302_10653523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300028819|Ga0307296_10080779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1732 | Open in IMG/M |
| 3300028828|Ga0307312_10297053 | Not Available | 1051 | Open in IMG/M |
| 3300029636|Ga0222749_10079481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1504 | Open in IMG/M |
| 3300031184|Ga0307499_10066847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300031226|Ga0307497_10117316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
| 3300031354|Ga0307446_1153161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 629 | Open in IMG/M |
| 3300031545|Ga0318541_10252336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 980 | Open in IMG/M |
| 3300031549|Ga0318571_10394488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031561|Ga0318528_10403139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300031680|Ga0318574_10470887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300031681|Ga0318572_10190969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300031723|Ga0318493_10242159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 962 | Open in IMG/M |
| 3300031768|Ga0318509_10374175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300031777|Ga0318543_10202072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300031793|Ga0318548_10308727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300031797|Ga0318550_10073749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1574 | Open in IMG/M |
| 3300031833|Ga0310917_10377370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300031860|Ga0318495_10385737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031879|Ga0306919_10127121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1832 | Open in IMG/M |
| 3300031879|Ga0306919_10869879 | Not Available | 691 | Open in IMG/M |
| 3300031879|Ga0306919_11039872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031890|Ga0306925_10216417 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300031890|Ga0306925_11424743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300031897|Ga0318520_11003085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031912|Ga0306921_10744266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
| 3300031912|Ga0306921_11364522 | Not Available | 781 | Open in IMG/M |
| 3300031942|Ga0310916_10353014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300031942|Ga0310916_10360451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1235 | Open in IMG/M |
| 3300031942|Ga0310916_10838835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300031946|Ga0310910_10285727 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300031954|Ga0306926_11251617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300031981|Ga0318531_10409428 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031997|Ga0315278_12166477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300032013|Ga0310906_10090655 | Not Available | 1648 | Open in IMG/M |
| 3300032013|Ga0310906_11079811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300032035|Ga0310911_10097976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1604 | Open in IMG/M |
| 3300032051|Ga0318532_10358553 | Not Available | 517 | Open in IMG/M |
| 3300032064|Ga0318510_10215958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300032076|Ga0306924_11342444 | Not Available | 766 | Open in IMG/M |
| 3300032205|Ga0307472_100072804 | Not Available | 2250 | Open in IMG/M |
| 3300033289|Ga0310914_10771877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300033290|Ga0318519_10728653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300033291|Ga0307417_10130890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1000 | Open in IMG/M |
| 3300033551|Ga0247830_11230046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300034820|Ga0373959_0215314 | Not Available | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.02% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.02% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031354 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10308731 | 3300000579 | Forest Soil | MRTVLLGAVVAITSTLAHAEDMAEMISRYRHAHGLSTVKTDP |
| AP72_2010_repI_A01DRAFT_10708631 | 3300000579 | Forest Soil | MKTVLLGAVVAITATLAHAEDMAEMISRYRHAHGLSTVKTDP |
| AF_2010_repII_A100DRAFT_10675481 | 3300000655 | Forest Soil | MRAVLLGAVVAITSTLVHAEDMAEMISRYRQANGLSAVK |
| JGI11643J12802_112968521 | 3300000890 | Soil | MRVVVGIAVVVAFMATLAHAEEDMAEMISQYRRQHGLSAVKTDPQLTA |
| JGI12662J13196_10098722 | 3300001081 | Forest Soil | MKVVWLAVAIAITATLAHAEDMAEMISRYRREHGL |
| F14TB_1002407931 | 3300001431 | Soil | MRTVLLGAVVAITSTLAHAEGMAEMISRYRHAHGLSTVKTDPQLTAIAERQAKAM |
| JGI12630J15595_100124221 | 3300001545 | Forest Soil | MKVVWLAVAIAITATLAHAEDMAEMISRYRREHGLSTVRTDPQLTAMAE |
| JGI12053J15887_102773241 | 3300001661 | Forest Soil | MKVVWLAVAIAITATLAHAEDMAEMISRYRREHGLSTVRTDPQLTAMAERQA |
| JGI24749J21850_10109931 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRRAHGLSAVKT |
| C688J35102_1180629412 | 3300002568 | Soil | MRVVVWLAVCMAFTATLAHAEDDMAAMISQYRREHSLSAVKTDPQLTAIAERQA |
| C688J35102_1194673043 | 3300002568 | Soil | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLSAVKTDPQLT |
| Ga0062388_1009091012 | 3300004635 | Bog Forest Soil | LKLVILAVAFVIAATLAHAEDMAQMISQYRHEHGLSAVKTDSQLTAIAER |
| Ga0066685_104667141 | 3300005180 | Soil | LRKKTPITKALWLAAVLAVASTLAHAENMAEMISRYRREHGLSSVKTDPQLTAIA |
| Ga0066678_103581841 | 3300005181 | Soil | MKAVSLGVILAITATLAHAEDMAEMISRYRREHGLSAVKTDPHLTAIAERQAKAM |
| Ga0070690_1010219951 | 3300005330 | Switchgrass Rhizosphere | MRVVVGIAVVVAFMATLAHAEEDMAEMISQYRRQHGLSAVKTDPQLTAI |
| Ga0066388_1000167939 | 3300005332 | Tropical Forest Soil | MKALSFWVAMAINVVMAIAVTVAQAEDMAAMISRYRRDHGLTSVRTDSQLTAIAERQAK |
| Ga0066388_1004370261 | 3300005332 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIAERQ |
| Ga0066388_1023201851 | 3300005332 | Tropical Forest Soil | MRAVLLGAVVAITSTLAHAEDMAEMISRYRQANGLSAVKTDPQLTAIAERQAKAMA |
| Ga0066388_1058932771 | 3300005332 | Tropical Forest Soil | MKTVLLGAVVVITATLAHAEDMAEMISQYRHAHGLSAVKTDPQLTAI |
| Ga0066388_1068555422 | 3300005332 | Tropical Forest Soil | MKVVGLAVVLLLASTLAYAEDMTEMVSRYRREHGLSTVKTDPELTA |
| Ga0070674_1002140624 | 3300005356 | Miscanthus Rhizosphere | MRVVVWLAVCMAFTATLAQAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQ |
| Ga0070662_1006986842 | 3300005457 | Corn Rhizosphere | MKRVLLGAVVAITSTLAHAQDMAEMISQYRHAHGLSTVKTDPQLTAIAERQAKAM |
| Ga0070684_1023186872 | 3300005535 | Corn Rhizosphere | MKVVWLAVCVTVLASLAHAEDGEDVVEMISRYRHQHGLSTVKVEPKLTAIAERQAKAMAASGVM |
| Ga0066698_108233651 | 3300005558 | Soil | MKTVSLGVVMAITATLAHADDMAEMISRYRREHGLSAV |
| Ga0058697_103403311 | 3300005562 | Agave | MKAVSLAVVMAVTATLAHADDLAEVVSQYRREHGLSAVKTDP |
| Ga0066705_106819801 | 3300005569 | Soil | MRTVLLGAVIAITSTLAHAEDMAEMISRYRQAHGLSAVKTDPQLTAIAERQAKA |
| Ga0068864_1001852021 | 3300005618 | Switchgrass Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLSAVKTDPQLTA |
| Ga0068864_1024267461 | 3300005618 | Switchgrass Rhizosphere | MRVVVWLAVCMAFTATLAQAEDDMAAMISQYRREHG |
| Ga0068861_1008123942 | 3300005719 | Switchgrass Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREH |
| Ga0066903_1010336985 | 3300005764 | Tropical Forest Soil | MKTVLLGLVVAITSTLAHAEDMAEMISQYRQAHGLSTVKTDPQLTAIAER |
| Ga0066903_1015599841 | 3300005764 | Tropical Forest Soil | MKAVLRGAALLGAVLAITSTLAHAQDMAEMISRYRH |
| Ga0066903_1016791413 | 3300005764 | Tropical Forest Soil | MKLVWLAVLIVFASTLAHAEDVVEMISRYRREHGLS |
| Ga0066903_1058674201 | 3300005764 | Tropical Forest Soil | MKTVLLALVVAATSTLAHAEDMAEMISQYRQAHGLSTVKTD |
| Ga0066903_1065675971 | 3300005764 | Tropical Forest Soil | MKVVWLAVLLAFAAALAHAAEDMADTVSRYRREHGLSSVKTDPQLTA |
| Ga0066903_1069249632 | 3300005764 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAEMISQYRHAHGLSAVKTDPQLTAIAER |
| Ga0066903_1082583451 | 3300005764 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRLTHGLSAVK |
| Ga0066903_1085258891 | 3300005764 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRLTHGLSAVKT |
| Ga0066903_1085897392 | 3300005764 | Tropical Forest Soil | MKPVWLAVVMATLTTLAHAEEDVAAMISRYRREHG |
| Ga0068870_100099818 | 3300005840 | Miscanthus Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRRAHGLSAVKTDPQLTAIAE |
| Ga0075365_106003712 | 3300006038 | Populus Endosphere | MRVVVWLAVCMAFAATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQ |
| Ga0075023_1002799752 | 3300006041 | Watersheds | MKVVWLVVCVTILSTLARAEDAADVVDMISRYRREHGLSTVKTDPK |
| Ga0066652_1005493324 | 3300006046 | Soil | MKLVWTAVLVAIASTLAHAEDMAEMISRYRREHGLSAVKIDPQLTAIAE |
| Ga0075028_1009974361 | 3300006050 | Watersheds | MKVVWLVVCVTILSTLARAEDAADVVDMISRYRREHGLSTVKT |
| Ga0070712_1007049171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVVWLAVCMAFAATLAHAEDDMAAMISQYRREH |
| Ga0070712_1008088802 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVLLGAVVAITSTLAHAQDMAEMISQYRHAHGLSTVKT |
| Ga0070712_1008620901 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVLLAAVVAITSTLAHAQDMAEMISQYRHAHGLSTVKTD |
| Ga0074051_100009012 | 3300006572 | Soil | MRVVVWLAVCMAFTAALAYAEDDMAAMISQYRREHG |
| Ga0074056_100037112 | 3300006574 | Soil | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQAQAM |
| Ga0074047_120037681 | 3300006576 | Soil | MKVVWLVVVAVAVAITSTLARAEDMAEMISRYRREHGL |
| Ga0074050_111746262 | 3300006577 | Soil | MKVVWLVVCVTILSTLARAEDAADVVDMISRYRREHGLSTVKTD |
| Ga0075431_1008475161 | 3300006847 | Populus Rhizosphere | MKAVLLVVIIGMTSTLASAEDMAEMVSRYRRAQGLSTVKID |
| Ga0075424_1014392111 | 3300006904 | Populus Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLS |
| Ga0074063_127400552 | 3300006953 | Soil | MKVVWLIVCVTILSTLARAEDATDVVDMISRYRREHGLSTVKTDPKLTAIAD |
| Ga0099829_108961333 | 3300009038 | Vadose Zone Soil | MKVVWLAVVMTITSTLAHAENMAEMISRYRREHGLSTVKTDPQLTA |
| Ga0099792_112187001 | 3300009143 | Vadose Zone Soil | MKTVVLGAVVAITSTLAHAEDMAETISRYRQAHGLSTVKTD |
| Ga0114129_103975241 | 3300009147 | Populus Rhizosphere | MRAVSFGVILAITASLAHAEDMAETISRYRQEHGLSAVKTDPQLTAIAERQAKAMAE |
| Ga0114129_115976132 | 3300009147 | Populus Rhizosphere | MKAISLSVVMAITSTLAHAEDMAGMISQYRREHGLSTVRTDPQLTAIAERQA |
| Ga0105243_100252431 | 3300009148 | Miscanthus Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTA |
| Ga0105243_100734094 | 3300009148 | Miscanthus Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQAQAM |
| Ga0111538_113143641 | 3300009156 | Populus Rhizosphere | MKRVLLGAVVAITSTLAHAQDMAEMISQYRHAHGL |
| Ga0105241_122368412 | 3300009174 | Corn Rhizosphere | MKAVLLGAVVAITATLAQAGDMAGMISQYRQAHGLSAVKIDPQ |
| Ga0105242_101826972 | 3300009176 | Miscanthus Rhizosphere | MSIAGEDIGEGAMRVVVWLAVCMAFMATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTA |
| Ga0105237_107452231 | 3300009545 | Corn Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHG |
| Ga0126382_121165741 | 3300010047 | Tropical Forest Soil | MKTVWLSIIMAIMATLAHAEDMAEMISRYRREHGLSSVKTDPQLTAVAERQAKAMA |
| Ga0126373_133338481 | 3300010048 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMTEMISRYRHAHGLSTV |
| Ga0126370_107526552 | 3300010358 | Tropical Forest Soil | MKTVLLGAAVAITATLAHAEDTAETISRYRHAHGLSAVKTDP |
| Ga0126370_122837671 | 3300010358 | Tropical Forest Soil | LLGAVVAITATLAHAEDMTEMISRYRHAHGLSTVKTDPQLTAIA |
| Ga0126376_101775441 | 3300010359 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAEMISQYRHAHGLSTVKIDPQLTAIAE |
| Ga0126376_114450831 | 3300010359 | Tropical Forest Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLT |
| Ga0126372_115080871 | 3300010360 | Tropical Forest Soil | MKAVSLGASMAITMAVAVMVIATSWAHADDMAEMISRYRREHGLSTVKIDPQLTAIAERQAK |
| Ga0126372_123400142 | 3300010360 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIAERQA |
| Ga0126378_109578543 | 3300010361 | Tropical Forest Soil | MWGKRVMKAVLLGAVVAITATLAHAEDMAEMISQYR |
| Ga0126377_112573351 | 3300010362 | Tropical Forest Soil | MNFFFIAGTTGEWMKAVSLGVILAITATLAHAEDMAEMISQYRREHGLSAVKTDPQLTAIAERQAKAM |
| Ga0126377_127641141 | 3300010362 | Tropical Forest Soil | MKTVLLGAVVVITATLAHAQDMAEMISQYRHAHGLSAVKT |
| Ga0126379_103578732 | 3300010366 | Tropical Forest Soil | MKTVLLGAVVALTATLAHAEDMAEMISQYRHTHGLS |
| Ga0126379_105306523 | 3300010366 | Tropical Forest Soil | MRTVLLGAVVAITSTLAHAEGMAEMISRYRHAHGLSTVKTDPQLT |
| Ga0105239_117818771 | 3300010375 | Corn Rhizosphere | MRVVIWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKT |
| Ga0126381_1036910491 | 3300010376 | Tropical Forest Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIAER |
| Ga0134126_123052971 | 3300010396 | Terrestrial Soil | MKVVWVAIVMTIAYTWARAEDMAELVSRYRREHGLSTVKIDPELTAIAERQAKAMA |
| Ga0126383_108030981 | 3300010398 | Tropical Forest Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIAE |
| Ga0126383_122037301 | 3300010398 | Tropical Forest Soil | MVALAAVAAISASASAHAEDIAQMISQYRREHGLSAVKTDPQLTAVAERQAKAM |
| Ga0134121_103273451 | 3300010401 | Terrestrial Soil | MRVVVWLAVCMAVTATLAQAEDDMAAMISQYRREHGLSAVKTDPQL |
| Ga0137377_100658553 | 3300012211 | Vadose Zone Soil | MGGAMKVVWLAVFVTITSTLAHAEDMADMISRYRREHGL |
| Ga0137397_111587831 | 3300012685 | Vadose Zone Soil | MKAVSLSFIISVTATFAHADDRADMISRYRREHGLSVVKTDPQLTAIAERQAKAM |
| Ga0157285_102408102 | 3300012897 | Soil | MRVLVGIAVFVAFMATLAHAEEDMAEMISQYRRQHGLSAVKTDPQLTAIAER |
| Ga0157301_102888771 | 3300012911 | Soil | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQA* |
| Ga0126375_102741142 | 3300012948 | Tropical Forest Soil | MRTVLLGAVVAITSTLAHAEDMAEMISRYRHAHGLSTVKTDLQLTGWPAPTQRDW* |
| Ga0164300_109156321 | 3300012951 | Soil | MKVVWLAIVIAIASTLAHAEDMAEMISRYRREHGLST |
| Ga0164299_102980822 | 3300012958 | Soil | MKAVWLVVCVTILSTLARAEDAADVVDMISRYRREHGLSTVKTDPKL |
| Ga0164299_110266281 | 3300012958 | Soil | MRVVVGIAVFVAFMATLAHAEEDMAEMISQYRREHGLSAVKTDPQLTAIAGRQAKAMAAT |
| Ga0164302_100545564 | 3300012961 | Soil | MKVVCFVVGLAVTATLAHAEDMAAMISQYRREHGLSAVKTDPQLTEIAERQAKAMA |
| Ga0164302_102887343 | 3300012961 | Soil | MRVVVWLAVCMALTATLAHAEDDMAAMISQYRREHGLSAVKTD |
| Ga0126369_112607882 | 3300012971 | Tropical Forest Soil | MGGAMKVVWLAVFVTITSTLAHAEDMADMISRYRREHGLSTVKTDPQLTA |
| Ga0126369_113196441 | 3300012971 | Tropical Forest Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTD |
| Ga0164306_114783111 | 3300012988 | Soil | MNFAAGAKGEGAMRVVVWLAVCMAFTAALAYAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQA |
| Ga0164305_100114831 | 3300012989 | Soil | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRRQH |
| Ga0164305_106859652 | 3300012989 | Soil | MRVVVWLAACMAFTATLAHAEDDMAAMISQYRRQHGLSAVK |
| Ga0157378_106320542 | 3300013297 | Miscanthus Rhizosphere | MRVVVWLAVCMAVTGTLAHAGDDMAAMISQYRREHGLSAVKTDPQLTA |
| Ga0163162_111149632 | 3300013306 | Switchgrass Rhizosphere | MRVVVGIAVVVAFMATLAHAEEDMAEMISQYRRQHGLSAVKTDPQL |
| Ga0163163_122205502 | 3300014325 | Switchgrass Rhizosphere | MKAVLLGAVVAITATLAHAEDMAGMISQYRQADGLSTVKIDPQLTTIAERQAKAMA |
| Ga0157380_103192141 | 3300014326 | Switchgrass Rhizosphere | MRVVVWLAVCRAFAATPAHAEDDMAAMISQYRREHGLSAV |
| Ga0157376_114369212 | 3300014969 | Miscanthus Rhizosphere | MKAVLLGAVVAITATLAHAEDMAGMISQYRQADGLST |
| Ga0132256_1004476253 | 3300015372 | Arabidopsis Rhizosphere | MKVVWVAIVMTIACTWARAEDMAELVSRYRREHGLSTVKIDPELTAIAERQAKAMAS |
| Ga0132257_1001266241 | 3300015373 | Arabidopsis Rhizosphere | MKTVLLGLVVAITSTLAHAEDMAEMISQYRQAHGL |
| Ga0182036_112528941 | 3300016270 | Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGL |
| Ga0182032_110389742 | 3300016357 | Soil | MKVVWLAVLVTITSTLAHAEDMANMISRYRREHGLSTVKT |
| Ga0182039_105396571 | 3300016422 | Soil | MKLVWLAVLIVFASTLAHAEDVVEMISRYRREHGLSTVKTDPQLTA |
| Ga0182038_109039222 | 3300016445 | Soil | MDKWGEAMKTLWLAVALALTATLAYAEDMAEMISQYRRE |
| Ga0182038_113410832 | 3300016445 | Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAI |
| Ga0182038_117735261 | 3300016445 | Soil | MKAVLLGAVVAITATLAHAEDMAEMISQYRQAHGL |
| Ga0182038_118142602 | 3300016445 | Soil | MKMVMALAAALTLTASAAAYAEDMAQMISQYRREHGLPPVK |
| Ga0187817_105304251 | 3300017955 | Freshwater Sediment | MKVFYIVVGLIVTATLAHAEDMAQMISQYRREHGLS |
| Ga0187782_109447302 | 3300017975 | Tropical Peatland | MRFVGWRLRFAVSALGILLAAPIARAEDVAAMISQYRREHGLSAVKTDAQLTAVAERQAR |
| Ga0190272_127845651 | 3300018429 | Soil | MKAVLLGVAIAMTSTLAHAEDMADVISQYRRAHGLSTVKTDPQLTAI |
| Ga0190269_102033072 | 3300018465 | Soil | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKT |
| Ga0190269_104369482 | 3300018465 | Soil | MRVVVWLTVCVAFMATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTA |
| Ga0190270_115325972 | 3300018469 | Soil | MKAFLLSVVMAVTATLAHAEDMAEMISQYRRQHGLSTVKTDPQLTAIAERQA |
| Ga0190271_114068451 | 3300018481 | Soil | MKVLAIAVVLSLTCASAHAEDMAEVISRYRREHGLSTVKTDPQ |
| Ga0190271_124291631 | 3300018481 | Soil | MRGVVWLAVCMAFTATLAHAEDDMAAMISEYRREHGLSAVKTDP |
| Ga0210407_108072422 | 3300020579 | Soil | MKVVWLVVVAVAVAITSTLARAEDMAEMISRYRREHGLSTVR |
| Ga0210384_116652821 | 3300021432 | Soil | MKVVWLIVCVTILSTLARAEDATDVVDMISRYRREHGLSTVKTDPKLTAVAERQ |
| Ga0210410_114170891 | 3300021479 | Soil | MKAALLGAVVAITSTLAHAQDMAEMISQYRHAHGLSTVKTDPQLTAIA |
| Ga0126371_126132122 | 3300021560 | Tropical Forest Soil | MKALWLALLLAVTAAPAHAAEDMADTVSRYRREHGLSTVKTDPQLTAVAERQA |
| Ga0242658_10115122 | 3300022530 | Soil | MKTIWLAVAMAATVTLAHAEDMAEMISKYRHEHGLSSVKADPE |
| Ga0212123_102695531 | 3300022557 | Iron-Sulfur Acid Spring | MKVVWLIVCVTILSTLARAEDATDVVDMISRYRREHGLSTVKTDPKLT |
| Ga0222622_100729701 | 3300022756 | Groundwater Sediment | MRVVVWLAVIMAFTATLARAEDDMAEMISQYRRQHGLSAVKTDPQ |
| Ga0207688_100032421 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERHAQ |
| Ga0207688_101162321 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHG |
| Ga0207700_100133166 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVVWLAVCMAVMATLAHAEDDMAAMISQYRREHGL |
| Ga0207644_101895153 | 3300025931 | Switchgrass Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRRAHGLSAVKTDPQLTAI |
| Ga0207644_104294131 | 3300025931 | Switchgrass Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAE |
| Ga0207690_114857981 | 3300025932 | Corn Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRRAHGLSAVKTDPQLTAIAER |
| Ga0207706_114873622 | 3300025933 | Corn Rhizosphere | MKVVWLAVCVTVLASLAHAEDGEDVVEMISRYRHQHGLSAVKVEPK |
| Ga0207670_100334201 | 3300025936 | Switchgrass Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKTDP |
| Ga0207669_101226541 | 3300025937 | Miscanthus Rhizosphere | MRGVVWLAVCMAFTATLAHAEDDMAAMISQYRREHGLSAVKTD |
| Ga0207669_105080721 | 3300025937 | Miscanthus Rhizosphere | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRRAHGLSAVKTDPQLT |
| Ga0207675_1003102442 | 3300026118 | Switchgrass Rhizosphere | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRREHGLSAVK |
| Ga0208981_10080691 | 3300027669 | Forest Soil | MRVVVWLAVCMAITATLAHAEDDMAEMISQYRRQHGLS |
| Ga0209248_101200751 | 3300027729 | Bog Forest Soil | MKTIWLAAAMAITVTLAHAEDMAEMISRYRHEHGLSTVKTDPELTKAAERQA |
| Ga0209180_103890233 | 3300027846 | Vadose Zone Soil | MKVVWLAVVMTITSTLAHAENMAEMISRYRREHGLSTVKTDPQLTAI |
| Ga0209068_106681021 | 3300027894 | Watersheds | MKVVWLVVCVTILSTLARAEDAADVVDMISRYRREHG |
| Ga0209624_108490182 | 3300027895 | Forest Soil | MGWGAMKTIWLAAAMAITVTLAHAEDMAEMISQYRHEHGLSTVKTD |
| Ga0307303_100564641 | 3300028713 | Soil | MRGVVWLAVCMAFTATLAHAEDDMAAMISQYRREHGLSAVKTDPQ |
| Ga0307307_100094763 | 3300028718 | Soil | MRVVVWLAVIMAFTATLAHAEEDMAEMISQYRRQHGLSAVKTDPQLT |
| Ga0307297_103048642 | 3300028754 | Soil | MRVVVWLAVCMALTATLAHAEDDMAAMISQYRREHGLSAVKTDP |
| Ga0307288_104091672 | 3300028778 | Soil | MRGVVGLAVCMAFMATLAQAEDDMAAMISQYRREHGLSAVKTDPQLTAIAER |
| Ga0307323_102194792 | 3300028787 | Soil | MRGVVWLAVCMAFTATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAER |
| Ga0307292_104144531 | 3300028811 | Soil | MRGVVWLAVCMAFTATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQAQA |
| Ga0307302_100130754 | 3300028814 | Soil | MRVVVWLAVIMAFTATLAHAEEDMAEMISQYRRQHGLSAVKTDPQ |
| Ga0307302_101914403 | 3300028814 | Soil | MKAVSLGVIMAITATLAHAEDMAETISRYRHEHGLSTVK |
| Ga0307302_106535231 | 3300028814 | Soil | MRGVVWLAVCMAFTATLAHAEDDMAAMISQYRREHGLSAV |
| Ga0307296_100807793 | 3300028819 | Soil | MRVVVWLAVIMAFTATLAHAEDDMAEMISQYRRQHGLSAVKTDP |
| Ga0307312_102970532 | 3300028828 | Soil | MRVVVWLAVIMAFTATLAHAEEDMAEMISQYRRQHGLS |
| Ga0222749_100794811 | 3300029636 | Soil | MKVVWLIVCVTILSTLARAEDAADAVDMISRYRREHGLST |
| Ga0302180_102050732 | 3300031028 | Palsa | MQGNGGGEMMKSVCLAVVMALLAMTATLAYAEDMAEMISQYRREHGLSAVKIDPE |
| Ga0307499_100668471 | 3300031184 | Soil | MRGVVWLAVCMAFTATLAYAEDDMAAMISQYRREHGLSAVKTDPQLT |
| Ga0307497_101173161 | 3300031226 | Soil | MKVVWLIVCVTILSTLARAEDAADVVDMISRYRREHGLSTVKTDPKL |
| Ga0307446_11531612 | 3300031354 | Salt Marsh | MGGTMKAVKLAVVMAVLSAVPATLAHAEDMAAVLSKYRREHGLSVVKTDPQLTAIAQRQAKAMA |
| Ga0318541_102523361 | 3300031545 | Soil | MKVVWLAVLLAFAAALAHAAEDMADTVSRYRREHG |
| Ga0318571_103944882 | 3300031549 | Soil | MKVVWLAVFVTITSTLAHAEDMADMISRYRREHGLSTVKTDPQLTAIAER |
| Ga0318528_104031391 | 3300031561 | Soil | MKAVLLGAVVAITSTLAHAEDMAEVISRYRHANGLSTVKTDPQL |
| Ga0318574_104708871 | 3300031680 | Soil | MKAVLLGAVVAITSTLAHAEDMAEMISRYRHAHGLSTVKTDPQLTA |
| Ga0318572_101909692 | 3300031681 | Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQL |
| Ga0318493_102421593 | 3300031723 | Soil | MKVVWLAVLLAFAAALAHAAEDMADTVSRYRREHGLSSVKTD |
| Ga0318509_103741752 | 3300031768 | Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIAERQAK |
| Ga0318543_102020721 | 3300031777 | Soil | MKVVWLAVLVTITSTLAHAEDMANMISRYRREHGLSTVKTD |
| Ga0318548_103087271 | 3300031793 | Soil | MKVVWLAVFVTITSTLAHAEDMADMISRYRREHGLSTVKTDPQLTAIAE |
| Ga0318550_100737491 | 3300031797 | Soil | MKVVWLAVLVTITSTLAHAEDMANMISRYRREHGLSTVKTDPQLTAIAERWPPPASWIT |
| Ga0310917_103773701 | 3300031833 | Soil | MKTVLLGAVVVITATLAHAEDMAEMISQYRHAHGLSAVKTDPQLTAIAERQAK |
| Ga0318495_103857371 | 3300031860 | Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIA |
| Ga0306919_101271214 | 3300031879 | Soil | MKVVWLAVLLAFAAALAHAAEDMADTVSRYRREHGLSSVK |
| Ga0306919_108698791 | 3300031879 | Soil | MKTIWLAVAMAATVTLAHAEDMAEMISKYRHEHGL |
| Ga0306919_110398721 | 3300031879 | Soil | MKVVWLAVFVTITSTLAHAEDMANMISRYRREHGLSTVKTDPQLTAIAER |
| Ga0306925_102164174 | 3300031890 | Soil | MKAVLLGAVVAITSTLAHAEDMAEVISRYRHANGLSTVKTDP |
| Ga0306925_114247431 | 3300031890 | Soil | MKTLCLAVALAMTATLAHAEDMAEMISQYRREHGLST |
| Ga0318520_110030851 | 3300031897 | Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQLTAIAERQAKAM |
| Ga0306921_107442662 | 3300031912 | Soil | MKTVLLGAVVVITATLAHAEDMAEMISQYRHAHGLSAVK |
| Ga0306921_113645222 | 3300031912 | Soil | MKVVWLAVCVTILSSLAYAEDAEDVVEMVSRYRHEHGLSTVKVDP |
| Ga0310916_103530141 | 3300031942 | Soil | MKAVLLGAVVAITSTLAHAEDMAEVISRYRHANGLST |
| Ga0310916_103604512 | 3300031942 | Soil | MKAVLLGAVVAITSTLAHAEDMAETISRYRLAHGLS |
| Ga0310916_108388351 | 3300031942 | Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSA |
| Ga0310910_102857273 | 3300031946 | Soil | MKVVWLAVLVTITSTLAHAEDMANMISRYRREHGLSTVKTDPQLTAIAERQAKAM |
| Ga0306926_112516172 | 3300031954 | Soil | MKTLCLAVALAMTATLAHAEDMAEMISQYRREHGLSTVKTDPELT |
| Ga0318531_104094282 | 3300031981 | Soil | MKVVWLAVLLAFAAALAHAAEDMADTVSRYRREHGLSSVKTDPQLTAVAEHQAKA |
| Ga0315278_121664771 | 3300031997 | Sediment | MRAVLLGVVVAMTSSLVHAEDMADVISRYRREHGLSTVKIDP |
| Ga0310906_100906551 | 3300032013 | Soil | MRVVVWLAVCMAVTATLAHAEDDMAAMISQYRREHGLSAVKTDPQLTAIAERQAQA |
| Ga0310906_110798111 | 3300032013 | Soil | MRVVVWLAVCMAFTATLAHAEDDMAAMISQYRREHGLSAVKTDP |
| Ga0310911_100979763 | 3300032035 | Soil | MKVVWLAVLVTITSTLAHAEDMANMISRYRREHGLSTVKTDPQLTAIAERWPPPASWITV |
| Ga0318532_103585531 | 3300032051 | Soil | MKTVLLGAAVAITATLAHAEDMAETISRYRHAHGLSAVKTDPQL |
| Ga0318510_102159581 | 3300032064 | Soil | MKTVLLGAVVAITATLAHAEDMAETISRYRHAHGLSAVKTDP |
| Ga0306924_113424442 | 3300032076 | Soil | MKVVWLAVCVTILSSLAYAEDAEDVVEMVSRYRHEHGLSTVKVDPNLTAFAQ |
| Ga0307472_1000728043 | 3300032205 | Hardwood Forest Soil | MKRVLLGAVVAITSTLAHAQDMAEMISQYRHAHGLSTVKTDPQLTAIAE |
| Ga0310914_107718772 | 3300033289 | Soil | MKTLWLAVALALTATLAHAEDMAEMISQYRREHGLSTVKT |
| Ga0318519_107286531 | 3300033290 | Soil | MKAVLLGAVVAITSTLAHAEDMAETISRYRLAHGLSTVK |
| Ga0307417_101308901 | 3300033291 | Salt Marsh | MGGTMKAVKLAVVMAVLSAVPATLAHAEDMAAVLSKYRREHGLSVVKTDPQLTAIAQRQAKAMAA |
| Ga0247830_112300461 | 3300033551 | Soil | MRVVVWLAVCMAVTGTLAHAEDDMAAMISQYRRAHGLSAVKTDPQLTAIAER |
| Ga0373959_0215314_407_511 | 3300034820 | Rhizosphere Soil | MRVVVWLAACMAFTATLAHAEDDMAAMISQYRRQH |
| ⦗Top⦘ |