


| Basic Information | |
|---|---|
| Family ID | F026639 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 42 residues |
| Representative Sequence | EGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Number of Associated Samples | 177 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.02 % |
| % of genes near scaffold ends (potentially truncated) | 98.98 % |
| % of genes from short scaffolds (< 2000 bps) | 88.83 % |
| Associated GOLD sequencing projects | 168 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.173 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.198 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.812 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.284 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 30.46 |
| PF02769 | AIRS_C | 8.63 |
| PF13714 | PEP_mutase | 3.55 |
| PF01523 | PmbA_TldD | 3.05 |
| PF01042 | Ribonuc_L-PSP | 2.54 |
| PF01965 | DJ-1_PfpI | 2.03 |
| PF13472 | Lipase_GDSL_2 | 1.52 |
| PF09907 | HigB_toxin | 1.52 |
| PF12867 | DinB_2 | 1.52 |
| PF13432 | TPR_16 | 1.02 |
| PF08281 | Sigma70_r4_2 | 1.02 |
| PF04542 | Sigma70_r2 | 1.02 |
| PF13414 | TPR_11 | 1.02 |
| PF00550 | PP-binding | 0.51 |
| PF13458 | Peripla_BP_6 | 0.51 |
| PF01979 | Amidohydro_1 | 0.51 |
| PF00127 | Copper-bind | 0.51 |
| PF00155 | Aminotran_1_2 | 0.51 |
| PF02163 | Peptidase_M50 | 0.51 |
| PF00586 | AIRS | 0.51 |
| PF13565 | HTH_32 | 0.51 |
| PF01609 | DDE_Tnp_1 | 0.51 |
| PF06068 | TIP49 | 0.51 |
| PF13517 | FG-GAP_3 | 0.51 |
| PF01288 | HPPK | 0.51 |
| PF00313 | CSD | 0.51 |
| PF06762 | LMF1 | 0.51 |
| PF03352 | Adenine_glyco | 0.51 |
| PF07676 | PD40 | 0.51 |
| PF12704 | MacB_PCD | 0.51 |
| PF13374 | TPR_10 | 0.51 |
| PF04473 | DUF553 | 0.51 |
| PF04384 | Fe-S_assembly | 0.51 |
| PF02882 | THF_DHG_CYH_C | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 3.05 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.54 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.02 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.02 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.02 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.02 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.51 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.51 |
| COG1224 | DNA helicase TIP49, TBP-interacting protein | Transcription [K] | 0.51 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.51 |
| COG2975 | Fe-S-cluster formation regulator IscX/YfhJ | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.51 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.51 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.51 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.17 % |
| Unclassified | root | N/A | 21.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_11984126 | Not Available | 657 | Open in IMG/M |
| 3300001593|JGI12635J15846_10733139 | Not Available | 568 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100922143 | Not Available | 756 | Open in IMG/M |
| 3300004081|Ga0063454_100176658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1175 | Open in IMG/M |
| 3300004082|Ga0062384_100363883 | Not Available | 920 | Open in IMG/M |
| 3300004633|Ga0066395_10946871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 523 | Open in IMG/M |
| 3300004635|Ga0062388_100204886 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005167|Ga0066672_10998456 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005174|Ga0066680_10348097 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005178|Ga0066688_10493436 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005331|Ga0070670_100841137 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005332|Ga0066388_102704951 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005340|Ga0070689_100438630 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300005435|Ga0070714_102367207 | Not Available | 516 | Open in IMG/M |
| 3300005526|Ga0073909_10448324 | Not Available | 616 | Open in IMG/M |
| 3300005536|Ga0070697_101526847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300005538|Ga0070731_10600127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300005538|Ga0070731_11005480 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005557|Ga0066704_10408946 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300005576|Ga0066708_10275099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300005586|Ga0066691_10403876 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005764|Ga0066903_101609079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1232 | Open in IMG/M |
| 3300005834|Ga0068851_10454767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300005841|Ga0068863_100078322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3130 | Open in IMG/M |
| 3300005891|Ga0075283_1066906 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006032|Ga0066696_10496986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300006175|Ga0070712_100874179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300006176|Ga0070765_100831586 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006176|Ga0070765_101803046 | Not Available | 574 | Open in IMG/M |
| 3300006354|Ga0075021_11121569 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006796|Ga0066665_10133207 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300006904|Ga0075424_102146657 | Not Available | 588 | Open in IMG/M |
| 3300006954|Ga0079219_10860046 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300007982|Ga0102924_1183595 | Not Available | 925 | Open in IMG/M |
| 3300009090|Ga0099827_10218158 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300009090|Ga0099827_11169277 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009098|Ga0105245_10712229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300009500|Ga0116229_10070381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3294 | Open in IMG/M |
| 3300009523|Ga0116221_1098236 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300009525|Ga0116220_10021807 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300009549|Ga0116137_1006577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5349 | Open in IMG/M |
| 3300009551|Ga0105238_11328010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300009552|Ga0116138_1044083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1295 | Open in IMG/M |
| 3300009672|Ga0116215_1321299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300009683|Ga0116224_10372411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300010043|Ga0126380_11949259 | Not Available | 536 | Open in IMG/M |
| 3300010048|Ga0126373_10091915 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300010320|Ga0134109_10358969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300010339|Ga0074046_10405950 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010361|Ga0126378_10197426 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300010371|Ga0134125_10951046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300010376|Ga0126381_101935598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter → unclassified Luteibacter → Luteibacter sp. Sphag1AF | 850 | Open in IMG/M |
| 3300010376|Ga0126381_102587136 | Not Available | 726 | Open in IMG/M |
| 3300010376|Ga0126381_102691825 | Not Available | 711 | Open in IMG/M |
| 3300010376|Ga0126381_103141937 | Not Available | 654 | Open in IMG/M |
| 3300010379|Ga0136449_103943616 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010396|Ga0134126_11803539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010397|Ga0134124_11667211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300010401|Ga0134121_12689882 | Not Available | 542 | Open in IMG/M |
| 3300011120|Ga0150983_12806721 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300011269|Ga0137392_10078747 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300011271|Ga0137393_11460902 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012189|Ga0137388_11950145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012200|Ga0137382_11292843 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012203|Ga0137399_11259338 | Not Available | 623 | Open in IMG/M |
| 3300012208|Ga0137376_10300176 | Not Available | 1394 | Open in IMG/M |
| 3300012210|Ga0137378_11267238 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012211|Ga0137377_10382582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1345 | Open in IMG/M |
| 3300012285|Ga0137370_10094124 | Not Available | 1679 | Open in IMG/M |
| 3300012285|Ga0137370_10164583 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300012351|Ga0137386_11159177 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012374|Ga0134039_1134833 | Not Available | 554 | Open in IMG/M |
| 3300012582|Ga0137358_10077113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 2241 | Open in IMG/M |
| 3300012955|Ga0164298_10098753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1541 | Open in IMG/M |
| 3300012957|Ga0164303_10766559 | Not Available | 659 | Open in IMG/M |
| 3300012976|Ga0134076_10489367 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300013100|Ga0157373_10218687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
| 3300013307|Ga0157372_11798394 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300014157|Ga0134078_10168138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300014487|Ga0182000_10339116 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300014489|Ga0182018_10619591 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300014501|Ga0182024_11578341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300014654|Ga0181525_10290412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300014969|Ga0157376_11196048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300014969|Ga0157376_12434739 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300015262|Ga0182007_10176777 | Not Available | 736 | Open in IMG/M |
| 3300016341|Ga0182035_11100066 | Not Available | 707 | Open in IMG/M |
| 3300016387|Ga0182040_10315082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1201 | Open in IMG/M |
| 3300016445|Ga0182038_10925879 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300017930|Ga0187825_10233322 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300017933|Ga0187801_10140877 | Not Available | 935 | Open in IMG/M |
| 3300017934|Ga0187803_10051609 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300017934|Ga0187803_10378600 | Not Available | 571 | Open in IMG/M |
| 3300017955|Ga0187817_10192335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1300 | Open in IMG/M |
| 3300017975|Ga0187782_10007119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8297 | Open in IMG/M |
| 3300017975|Ga0187782_10016313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5412 | Open in IMG/M |
| 3300017975|Ga0187782_10577253 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300017994|Ga0187822_10384940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300017995|Ga0187816_10133273 | Not Available | 1072 | Open in IMG/M |
| 3300018042|Ga0187871_10487104 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018057|Ga0187858_10014870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6292 | Open in IMG/M |
| 3300018057|Ga0187858_10410061 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018064|Ga0187773_10294776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300018088|Ga0187771_10398984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1160 | Open in IMG/M |
| 3300019268|Ga0181514_1592263 | Not Available | 518 | Open in IMG/M |
| 3300020080|Ga0206350_11660834 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300020170|Ga0179594_10356296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300020579|Ga0210407_10882819 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300020580|Ga0210403_11394816 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300020582|Ga0210395_11181077 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020583|Ga0210401_11071553 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300021088|Ga0210404_10656452 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300021168|Ga0210406_10261325 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300021170|Ga0210400_10025171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4624 | Open in IMG/M |
| 3300021171|Ga0210405_10764288 | Not Available | 743 | Open in IMG/M |
| 3300021181|Ga0210388_11529564 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021401|Ga0210393_10464793 | Not Available | 1033 | Open in IMG/M |
| 3300021403|Ga0210397_10818017 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021404|Ga0210389_10695024 | Not Available | 797 | Open in IMG/M |
| 3300021404|Ga0210389_10985119 | Not Available | 654 | Open in IMG/M |
| 3300021405|Ga0210387_10318508 | Not Available | 1370 | Open in IMG/M |
| 3300021420|Ga0210394_10036615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4363 | Open in IMG/M |
| 3300021432|Ga0210384_10941280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300021432|Ga0210384_11563794 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021433|Ga0210391_11370770 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300021477|Ga0210398_11527343 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300021478|Ga0210402_10477213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300021560|Ga0126371_11994535 | Not Available | 698 | Open in IMG/M |
| 3300022722|Ga0242657_1254024 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300022726|Ga0242654_10158340 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300022756|Ga0222622_10650263 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300024295|Ga0224556_1046464 | Not Available | 1076 | Open in IMG/M |
| 3300025463|Ga0208193_1053227 | Not Available | 881 | Open in IMG/M |
| 3300025500|Ga0208686_1100338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300025903|Ga0207680_11048329 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300025918|Ga0207662_10251927 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300025942|Ga0207689_11475835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 568 | Open in IMG/M |
| 3300025945|Ga0207679_10625229 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300026088|Ga0207641_12261775 | Not Available | 543 | Open in IMG/M |
| 3300026312|Ga0209153_1302290 | Not Available | 512 | Open in IMG/M |
| 3300026322|Ga0209687_1006570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3900 | Open in IMG/M |
| 3300026326|Ga0209801_1206325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300026331|Ga0209267_1335164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300026538|Ga0209056_10554601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300027080|Ga0208237_1039124 | Not Available | 713 | Open in IMG/M |
| 3300027432|Ga0209421_1100110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300027497|Ga0208199_1119503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300027648|Ga0209420_1080599 | Not Available | 940 | Open in IMG/M |
| 3300027701|Ga0209447_10191371 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027703|Ga0207862_1124757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300027737|Ga0209038_10184043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sandaracinaceae → Sandaracinus → Sandaracinus amylolyticus | 632 | Open in IMG/M |
| 3300027842|Ga0209580_10109579 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300027846|Ga0209180_10390227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300027882|Ga0209590_10618434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300027894|Ga0209068_10870453 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300028381|Ga0268264_10414341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300028906|Ga0308309_11819329 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300029922|Ga0311363_10165473 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300029943|Ga0311340_10252791 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300029951|Ga0311371_12682574 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300029956|Ga0302150_10389367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 515 | Open in IMG/M |
| 3300029982|Ga0302277_1104593 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300029999|Ga0311339_10783279 | Not Available | 920 | Open in IMG/M |
| 3300030003|Ga0302172_10098033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300030013|Ga0302178_10507095 | Not Available | 525 | Open in IMG/M |
| 3300030020|Ga0311344_10566350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300030053|Ga0302177_10164289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
| 3300030294|Ga0311349_11233761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300030506|Ga0302194_10329166 | Not Available | 603 | Open in IMG/M |
| 3300030507|Ga0302192_10445509 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300030688|Ga0311345_10823123 | Not Available | 724 | Open in IMG/M |
| 3300030737|Ga0302310_10305257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300030945|Ga0075373_10588434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300031047|Ga0073995_10051564 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031261|Ga0302140_10030860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6192 | Open in IMG/M |
| 3300031525|Ga0302326_13246292 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031708|Ga0310686_100713707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
| 3300031708|Ga0310686_109829540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031708|Ga0310686_112324298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2150 | Open in IMG/M |
| 3300031708|Ga0310686_112730513 | Not Available | 717 | Open in IMG/M |
| 3300031708|Ga0310686_117242160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300031716|Ga0310813_11028811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300031718|Ga0307474_10534153 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300031720|Ga0307469_11015932 | Not Available | 775 | Open in IMG/M |
| 3300031754|Ga0307475_10777017 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031768|Ga0318509_10787770 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031912|Ga0306921_10838102 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300032064|Ga0318510_10361121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300032174|Ga0307470_11108715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300032783|Ga0335079_10131474 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300032783|Ga0335079_10335095 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300032892|Ga0335081_10195593 | All Organisms → cellular organisms → Bacteria | 2807 | Open in IMG/M |
| 3300032893|Ga0335069_11393130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300032955|Ga0335076_10177289 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300033158|Ga0335077_10188186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2332 | Open in IMG/M |
| 3300033158|Ga0335077_11913087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300033755|Ga0371489_0393880 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.55% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.51% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.51% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.51% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.51% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.51% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.51% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_119841261 | 3300000789 | Soil | DGKELPPIKMPSKDDGVQQVLKPEPGRPGIAKGGESPARA* |
| JGI12635J15846_107331391 | 3300001593 | Forest Soil | PPMKSPAKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| JGIcombinedJ26739_1009221431 | 3300002245 | Forest Soil | LPPVKAPAKPDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0063454_1001766581 | 3300004081 | Soil | AGKELPKLTPPSKSDDGGVQQVLKPEPGRPGIAKGGDYPAPA* |
| Ga0062384_1003638831 | 3300004082 | Bog Forest Soil | ASEIGLLVEGKELPPFKTPPKPDDGVQQVLKPEPGRPGIVKGGESPARA* |
| Ga0066395_109468711 | 3300004633 | Tropical Forest Soil | IRMLVEGKELPPIKMPSKDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0062388_1002048861 | 3300004635 | Bog Forest Soil | ASEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0066672_109984561 | 3300005167 | Soil | KELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0066680_103480972 | 3300005174 | Soil | IIEGKALPKLTPPPKSDDGVQQVLKPEPGRPGMAKGGERPAPA* |
| Ga0066688_104934362 | 3300005178 | Soil | DGQELPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA* |
| Ga0070670_1008411372 | 3300005331 | Switchgrass Rhizosphere | LMEGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0066388_1027049511 | 3300005332 | Tropical Forest Soil | KELPKMTPPSKGDDGMQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0070689_1004386301 | 3300005340 | Switchgrass Rhizosphere | ELPKITPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0070714_1023672072 | 3300005435 | Agricultural Soil | IRMLVEGKELPPVKLPSKDDGGVQQVLKPEPGRQPVKGGERPATA* |
| Ga0073909_104483241 | 3300005526 | Surface Soil | KQLPKIVPPPKSDDSGVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0070697_1015268472 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ELPVKPPTPGKSDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0070731_106001271 | 3300005538 | Surface Soil | KELPKITPPPKPDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0070731_110054801 | 3300005538 | Surface Soil | KELPKLTPPPKSDDGVQQVLKPEPGRPGLKGGESPARA* |
| Ga0066704_104089464 | 3300005557 | Soil | GKGLPPIKAAPPKSDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0066708_102750991 | 3300005576 | Soil | ELPKITPPPKPDDGMQQVLKPEPGRPGIAKGGESPARA* |
| Ga0066691_104038761 | 3300005586 | Soil | LPKIVPPPKADDGGVQQVLKPEPGRAGLKGGEHPAPA* |
| Ga0066903_1016090791 | 3300005764 | Tropical Forest Soil | EGKELPPIKMPSKDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0068851_104547671 | 3300005834 | Corn Rhizosphere | EIKMIIDGKELPKITPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0068863_1000783223 | 3300005841 | Switchgrass Rhizosphere | KIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0075283_10669061 | 3300005891 | Rice Paddy Soil | PKVIPPPKGDDGVQHVLKPEPGRPGIAKGGESPARA* |
| Ga0066696_104969861 | 3300006032 | Soil | ELPKLTPPSKPDDGGVQQVLKPEPGRPGIAKGGDYPAPA* |
| Ga0070712_1008741792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VDGKELPKIIPPSKPDDGGVQQVLKPEPGRPGLKGGEHPAPA* |
| Ga0070765_1008315861 | 3300006176 | Soil | GKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0070765_1018030461 | 3300006176 | Soil | LLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0075021_111215691 | 3300006354 | Watersheds | GKELPAKVLPPKSDDGGVQHVLRPETGRKPNVAPGGESPARA* |
| Ga0066665_101332071 | 3300006796 | Soil | IKLLMDGQELPPVKFSSSKGDDGVQQVLKPEPGRPGLAKGGERPAPA* |
| Ga0075424_1021466571 | 3300006904 | Populus Rhizosphere | PTRPTPSKPDDGVQQVLKPEPGRPGLAKGGESPARA* |
| Ga0079219_108600462 | 3300006954 | Agricultural Soil | PSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0102924_11835951 | 3300007982 | Iron-Sulfur Acid Spring | KELPPMKAPSKADDGGVQQVLKPEPGRGIAKGGESPARA* |
| Ga0099827_102181583 | 3300009090 | Vadose Zone Soil | PPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA* |
| Ga0099827_111692772 | 3300009090 | Vadose Zone Soil | LPKIVPPPKSDDGGVQQVLKPEPGRSGLKGGESPAPA* |
| Ga0105245_107122293 | 3300009098 | Miscanthus Rhizosphere | KLIIEGKELPKIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0116229_100703811 | 3300009500 | Host-Associated | LIEGRELPKVVPPPKADDGVQQVLKPEPGRTSVAKGGDYPAPA* |
| Ga0116221_10982362 | 3300009523 | Peatlands Soil | PKIVPPPKSDDGVQQVLKPEPGRPGIAKGERPAPA* |
| Ga0116220_100218071 | 3300009525 | Peatlands Soil | ELPKMTPPPKSDDGGQQVLKPKPGRPGISKGGESPARA* |
| Ga0116137_10065778 | 3300009549 | Peatland | KELPPMKSPSKPDEGVQQVLKPEPGRGIAKGGESPARA* |
| Ga0105238_113280101 | 3300009551 | Corn Rhizosphere | DGKDLPKIVPPPRSDDSGVQQVLKPEPGRPGLKGGEHPAPA* |
| Ga0116138_10440831 | 3300009552 | Peatland | LLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIAKGGESPARA* |
| Ga0116215_13212991 | 3300009672 | Peatlands Soil | SEIQLLIEGKELPPVKSLPTKADDGVQQVLKPEPGRSGIAKGGESPARA* |
| Ga0116224_103724112 | 3300009683 | Peatlands Soil | SEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0126380_119492592 | 3300010043 | Tropical Forest Soil | MIIEGKELPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA* |
| Ga0126373_100919155 | 3300010048 | Tropical Forest Soil | LLIEGKELPKMQSPSRPDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0134109_103589692 | 3300010320 | Grasslands Soil | DANEIRILIEGKELPKIVPPPKSDDGGVQQVLKPEPRSGIAKGGEHPAPA* |
| Ga0074046_104059501 | 3300010339 | Bog Forest Soil | ASEVMMLVEGKELPPMKSPSKPDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0126378_101974261 | 3300010361 | Tropical Forest Soil | EIKLLIEGKELPKMQSPSRPDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0134125_109510461 | 3300010371 | Terrestrial Soil | KLIIEGKELPKVVPPPRGDDNGLQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0126381_1019355981 | 3300010376 | Tropical Forest Soil | TEIKMIIEGKELPPTKPVPKDSDVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0126381_1025871361 | 3300010376 | Tropical Forest Soil | PKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA* |
| Ga0126381_1026918252 | 3300010376 | Tropical Forest Soil | IEGKELPKMVPPPKSDDGGVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0126381_1031419372 | 3300010376 | Tropical Forest Soil | MTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA* |
| Ga0136449_1039436161 | 3300010379 | Peatlands Soil | EGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0134126_118035392 | 3300010396 | Terrestrial Soil | PKITPPPRSDDGVQQVLKPEPGRPGLAKGGESHAPA* |
| Ga0134124_116672112 | 3300010397 | Terrestrial Soil | EGKELPTITPPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA* |
| Ga0134121_126898821 | 3300010401 | Terrestrial Soil | IKMIIDGKELPKITPPSKGDDNGMQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0150983_128067211 | 3300011120 | Forest Soil | LMEGKELPKMTPPPRSDDGVQQVLKPEPGRPGLAKGGESPARA* |
| Ga0137392_100787474 | 3300011269 | Vadose Zone Soil | PVKAPSRPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0137393_114609021 | 3300011271 | Vadose Zone Soil | LIMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0137388_119501452 | 3300012189 | Vadose Zone Soil | ALIEGKDLPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGERPAPA* |
| Ga0137382_112928431 | 3300012200 | Vadose Zone Soil | ELPKMTPPPKSEDGVQQVIKPEPGRPGIAKGGESPARA* |
| Ga0137399_112593382 | 3300012203 | Vadose Zone Soil | LLVDGKELPPVKAPSKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0137376_103001761 | 3300012208 | Vadose Zone Soil | GKELPPIKLPSKDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0137378_112672381 | 3300012210 | Vadose Zone Soil | LPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0137377_103825821 | 3300012211 | Vadose Zone Soil | PKIIPPSKPDDGVQQVLKPEPGRPGLAKGERPAPA* |
| Ga0137370_100941243 | 3300012285 | Vadose Zone Soil | LPKITPPSKPDDGMQQVLKPEPGRPGIAKGGESPARA* |
| Ga0137370_101645832 | 3300012285 | Vadose Zone Soil | MDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0137386_111591771 | 3300012351 | Vadose Zone Soil | ELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0134039_11348332 | 3300012374 | Grasslands Soil | IIEGKELPKLTPPPRPDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0137358_100771132 | 3300012582 | Vadose Zone Soil | ELPPIKLPTKDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0164298_100987533 | 3300012955 | Soil | KELPPVKLPSKDDGVQQVLKPEPGRPGLAKGGESPARA* |
| Ga0164303_107665591 | 3300012957 | Soil | QLPKIVPPPKSDDSGVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0134076_104893671 | 3300012976 | Grasslands Soil | NEIKLIMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0157373_102186871 | 3300013100 | Corn Rhizosphere | NEIKMIIDGKELPKITPPSKGDDNGMQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0157372_117983941 | 3300013307 | Corn Rhizosphere | KDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0134078_101681381 | 3300014157 | Grasslands Soil | PKLTPPSKPDDGGVQQVLKPEPGPPGIAKGGDYPAPA* |
| Ga0182000_103391161 | 3300014487 | Soil | KMIIEGKELPKITPPSKPDDGMQQVLKPEPGRPGIA* |
| Ga0182018_106195911 | 3300014489 | Palsa | NEIKMIIEGKELPKLTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0182024_115783411 | 3300014501 | Permafrost | KMIIEGKELPKLTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA* |
| Ga0181525_102904122 | 3300014654 | Bog | EVMMLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA* |
| Ga0157376_111960481 | 3300014969 | Miscanthus Rhizosphere | IKLLVEGKDLPKIVPPSKPDDGGVQQVLKPEPGRPGLKGGEHPAPA* |
| Ga0157376_124347392 | 3300014969 | Miscanthus Rhizosphere | TPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA* |
| Ga0182007_101767772 | 3300015262 | Rhizosphere | LIDGKELPKMTPPSKGDDGGMQQVLKPEPGRPGIAKGGEHPAPA* |
| Ga0182035_111000661 | 3300016341 | Soil | IEGKELPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA |
| Ga0182040_103150821 | 3300016387 | Soil | MIVDGKELPPIKMPSKDEAVQQVLKPEPGRPGIAKGGESPARA |
| Ga0182038_109258792 | 3300016445 | Soil | NEIKMIIEGKELPKITAPPKPDEAVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187825_102333221 | 3300017930 | Freshwater Sediment | ELPPVKLPSKEDGVQQVLKPEPGRPGLAKGGESPARA |
| Ga0187801_101408771 | 3300017933 | Freshwater Sediment | IIEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187803_100516094 | 3300017934 | Freshwater Sediment | SEIKLLVDGKELPAKPPSPGKSDDGVQQVLKPEPGRPGIVKGGESPARA |
| Ga0187803_103786002 | 3300017934 | Freshwater Sediment | MLLVEGKELPAMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0187817_101923353 | 3300017955 | Freshwater Sediment | LDASEVMLLVEGKELPPNKSPAKPDDSVQQVLKPEPGRGIAKGGESPALA |
| Ga0187782_100071191 | 3300017975 | Tropical Peatland | KMLVDGKDLPPFKPVSSKPDDGVQQVLKPEPGRVPAKGERPATA |
| Ga0187782_100163131 | 3300017975 | Tropical Peatland | EIRMIIEGKELPKITVPPKSDEAVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187782_105772531 | 3300017975 | Tropical Peatland | IIEGKELPSITPPPKAEEGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187822_103849402 | 3300017994 | Freshwater Sediment | EGKELPPIKLPSKDEGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187816_101332731 | 3300017995 | Freshwater Sediment | EGKELPKMTPPPKSDDGVQQVLKPEPGRPGLAKGGESPARA |
| Ga0187871_104871041 | 3300018042 | Peatland | KMIIEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187858_100148708 | 3300018057 | Peatland | LLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0187858_104100611 | 3300018057 | Peatland | MIIEGKELPKLTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187773_102947762 | 3300018064 | Tropical Peatland | EIKMIMEGKELPKMQPPSKPDDGGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0187771_103989841 | 3300018088 | Tropical Peatland | PALTPPPKPEEGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0181514_15922632 | 3300019268 | Peatland | LIEGRELPKVVPPPKADDGVQQVLKPEPGRTSVAKGGDYPAPA |
| Ga0206350_116608342 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIDGKELPKITPPSKGDDNGMQQVLKPEPGRPGLAKGGEHPAPA |
| Ga0179594_103562961 | 3300020170 | Vadose Zone Soil | GKELPPVKLPSKDDGVQQVLKPEPGRPGLAKGGESPARA |
| Ga0210407_108828191 | 3300020579 | Soil | EVMLLVEGKELPPMKSPAKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210403_113948162 | 3300020580 | Soil | ANEIKLLVDGKELPPVKLPSKDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210395_111810772 | 3300020582 | Soil | VLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0210401_110715531 | 3300020583 | Soil | VEGKELPPIKLPSKDDGVQQVLKPEPGRPGLAKGGESPARA |
| Ga0210404_106564521 | 3300021088 | Soil | IIEGKELPPIKLPSKDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210406_102613251 | 3300021168 | Soil | KELPPMKAPSKPDDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0210400_100251716 | 3300021170 | Soil | VEGKELPPVKAPSKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210405_107642882 | 3300021171 | Soil | EVMLLVEGKELPPMKAPSKADDGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0210388_115295641 | 3300021181 | Soil | PKLTPPPKSDDGVQQVLKPEPGRPGLAKGGESPARA |
| Ga0210393_104647932 | 3300021401 | Soil | VMLLVEGKELPPMKSPAKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210397_108180173 | 3300021403 | Soil | KLTPPPKSDDGVQQVLKPEPGRPGMAKGGESPARA |
| Ga0210389_106950241 | 3300021404 | Soil | PMKAPSKADDGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0210389_109851192 | 3300021404 | Soil | LPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0210387_103185081 | 3300021405 | Soil | GKELPPFKSPPKPDDGVQQVLKPEPGRPGIVKGGESPARA |
| Ga0210394_100366151 | 3300021420 | Soil | PKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210384_109412802 | 3300021432 | Soil | LPKITPPPRQDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0210384_115637942 | 3300021432 | Soil | ASEVMMLVEGKELPPMKSPSKADEGVQQVLKPEPGRGIAKGGESPARA |
| Ga0210391_113707702 | 3300021433 | Soil | LDASEVMLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0210398_115273431 | 3300021477 | Soil | DGKELPPMKSPAKPDDGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0210402_104772131 | 3300021478 | Soil | KELPPFKSPPKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0126371_119945353 | 3300021560 | Tropical Forest Soil | IIEGKELPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA |
| Ga0242657_12540241 | 3300022722 | Soil | MLLVEGKELPPVKAPSKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0242654_101583401 | 3300022726 | Soil | NEIKMIIEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0222622_106502632 | 3300022756 | Groundwater Sediment | DAKEIKMIMEGKELPPTKLPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0224556_10464642 | 3300024295 | Soil | SEVIMLVEGKELPPMKSPAKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0208193_10532271 | 3300025463 | Peatland | PPMKLPSKPDDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0208686_11003382 | 3300025500 | Peatland | LVDGKELPPMKSPSKPDEGVQQVLKPEPGRGIAKGGESPARA |
| Ga0207680_110483291 | 3300025903 | Switchgrass Rhizosphere | NEIKLLMDGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0207662_102519271 | 3300025918 | Switchgrass Rhizosphere | KITPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA |
| Ga0207689_114758352 | 3300025942 | Miscanthus Rhizosphere | IKLLMEGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0207679_106252292 | 3300025945 | Corn Rhizosphere | GKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0207641_122617751 | 3300026088 | Switchgrass Rhizosphere | KIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA |
| Ga0209153_13022901 | 3300026312 | Soil | LKMIIEGKELPKIVPPPRGDDNGLQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0209687_10065701 | 3300026322 | Soil | MDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0209801_12063252 | 3300026326 | Soil | IKMIIDGKELPKITPPPKPDDGMQQVLKPEPGRPGIAKGGESPARA |
| Ga0209267_13351641 | 3300026331 | Soil | IKLIMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0209056_105546011 | 3300026538 | Soil | SDLPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA |
| Ga0208237_10391241 | 3300027080 | Forest Soil | EVMLLVDGKELPPMKSPTKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0209421_11001102 | 3300027432 | Forest Soil | ELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0208199_11195032 | 3300027497 | Peatlands Soil | DGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0209420_10805992 | 3300027648 | Forest Soil | VLLLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0209447_101913712 | 3300027701 | Bog Forest Soil | SEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0207862_11247571 | 3300027703 | Tropical Forest Soil | TEIHMLVDGKELPPAKAPAKDDGVQQVLKPEPGRQPVKGGERPATA |
| Ga0209038_101840431 | 3300027737 | Bog Forest Soil | GKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0209580_101095791 | 3300027842 | Surface Soil | LPKMVPPPRSDDGGVQQVLKPEPGRPGIAKGGERPAPA |
| Ga0209180_103902272 | 3300027846 | Vadose Zone Soil | ELPKIIPPSKPDDGVQQVLKPEPGRPGLAKGERPAPA |
| Ga0209590_106184342 | 3300027882 | Vadose Zone Soil | PPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA |
| Ga0209068_108704532 | 3300027894 | Watersheds | GKELPAKVLPPKSDDGGVQHVLRPETGRKPNVAPGGESPARA |
| Ga0268264_104143411 | 3300028381 | Switchgrass Rhizosphere | PKIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA |
| Ga0308309_118193291 | 3300028906 | Soil | KELPPIKSPSKPDDGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0311363_101654736 | 3300029922 | Fen | KELPPMKLPSKEDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0311340_102527911 | 3300029943 | Palsa | RLLIDNKELPAKPPAVGKNDDVQQVLKPEPGRPGIAKGGESPARA |
| Ga0311371_126825741 | 3300029951 | Palsa | PPMKSPAKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0302150_103893672 | 3300029956 | Bog | ASEVLLLVDGKELPPMKLPSKEDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0302277_11045931 | 3300029982 | Bog | VDGKELPPMKLPSKEDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0311339_107832791 | 3300029999 | Palsa | IDNKELPAKPPAVGKNDDVQQVLKPEPGRPGIAKGGESPARA |
| Ga0302172_100980331 | 3300030003 | Fen | KLLMEGKELPKIIPPPRGDNDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0302178_105070951 | 3300030013 | Palsa | IGLLVEGKELPPFKSPPKPEDGVQQVLKPEPGRPGIVKGGESPARA |
| Ga0311344_105663501 | 3300030020 | Bog | VDGKELPPMKSPAKPDDGGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0302177_101642891 | 3300030053 | Palsa | DKALPPVKASPTKADDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0311349_112337612 | 3300030294 | Fen | EGKELPKIIPPPRGDNDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0302194_103291661 | 3300030506 | Bog | VDGKELPPIKAPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0302192_104455092 | 3300030507 | Bog | MKSPAKPDDGGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0311345_108231231 | 3300030688 | Bog | GRELPKVVPPPKADDGVQQVLKPEPGRTSVAKGGDYPAPA |
| Ga0302310_103052571 | 3300030737 | Palsa | LLVDGKELPPMKSPAKPDDGGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0075373_105884342 | 3300030945 | Soil | KLLIDGKELPKIVPPPRSDDNGVQQVLKPEPGRPGLKGGEHPAPA |
| Ga0073995_100515642 | 3300031047 | Soil | VKPPTPGKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0302140_100308609 | 3300031261 | Bog | VDGKELPPIKDPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0302326_132462921 | 3300031525 | Palsa | PKIVPPPKSDDGVQQVLKPEPGRPGIAKGGERPAPA |
| Ga0310686_1007137072 | 3300031708 | Soil | VEGKELPPMKLPSKPDDGGVQQVLKPEPGRGIAKGGESPARA |
| Ga0310686_1098295401 | 3300031708 | Soil | DASEVLLLVDGKELPPMKSPAKPDDGVQQVLKPEPGRGIAKGGESPARA |
| Ga0310686_1123242981 | 3300031708 | Soil | LPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0310686_1127305131 | 3300031708 | Soil | LVDGKELPPMKSPSKPDDGVQQVLKPEPGRAGIAKGGESPARA |
| Ga0310686_1172421603 | 3300031708 | Soil | EVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA |
| Ga0310813_110288112 | 3300031716 | Soil | MIMEGKELPPSKPVPKDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0307474_105341531 | 3300031718 | Hardwood Forest Soil | GKELPPMKSPSKPDDGVQQVLKPEPGRGMVKGGESPARA |
| Ga0307469_110159322 | 3300031720 | Hardwood Forest Soil | QLPKVVPPPRSDDSGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0307475_107770172 | 3300031754 | Hardwood Forest Soil | EVMLLVEGKELPPMKAPAKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0318509_107877701 | 3300031768 | Soil | PPVKAPSKDEGIQQVLKPEPGRPGIAKGGESPARA |
| Ga0306921_108381022 | 3300031912 | Soil | GKELPPAKTVSSKPDDGVQQVLKPEPGRTPGLAKGGESPARA |
| Ga0318510_103611211 | 3300032064 | Soil | PAKTVSSKPDDGVQQVLKPEPGRTPGLAKGGESPARA |
| Ga0307470_111087151 | 3300032174 | Hardwood Forest Soil | IIEGKELPKLTPPPRQDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0335079_101314741 | 3300032783 | Soil | ELPKLEPPSKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0335079_103350951 | 3300032783 | Soil | KMLIEGRELPKLTPPPKSDDGGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0335081_101955931 | 3300032892 | Soil | EIKMIIEGKELPKITAPPKPDEAVQQVLKPEPGRPGIAKGGESPARA |
| Ga0335069_113931301 | 3300032893 | Soil | GRELPKLQPPSKPDDGVQQVLKPEPGRPGIAKGGESPARA |
| Ga0335076_101772893 | 3300032955 | Soil | KIVPPSKGDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0335077_101881861 | 3300033158 | Soil | EGKELPKIVPPSKGDDGVQQVLKPEPGRPGIAKGGEHPAPA |
| Ga0335077_119130872 | 3300033158 | Soil | DASEIQMLIDGKTLPPMKSPSKPDDGVQQVLKPEPGRSGIAKGGESPARA |
| Ga0371489_0393880_517_636 | 3300033755 | Peat Soil | GKELPPMKSPSKPDEGVQQVLKPEPGRGIVKGGESPARA |
| ⦗Top⦘ |