


| Basic Information | |
|---|---|
| Family ID | F026604 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRVQQRRKQPLPVVREEQGQGLFLLAHGEPHDPCPVAGCRGTLLFLHR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.14 % |
| % of genes near scaffold ends (potentially truncated) | 16.24 % |
| % of genes from short scaffolds (< 2000 bps) | 68.53 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.452 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (31.980 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.442 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.452 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.74% Coil/Unstructured: 80.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF00210 | Ferritin | 43.15 |
| PF00571 | CBS | 15.74 |
| PF03631 | Virul_fac_BrkB | 2.03 |
| PF05239 | PRC | 1.52 |
| PF01042 | Ribonuc_L-PSP | 1.52 |
| PF03364 | Polyketide_cyc | 1.02 |
| PF00030 | Crystall | 1.02 |
| PF07690 | MFS_1 | 1.02 |
| PF13610 | DDE_Tnp_IS240 | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF03459 | TOBE | 0.51 |
| PF13620 | CarboxypepD_reg | 0.51 |
| PF13565 | HTH_32 | 0.51 |
| PF02371 | Transposase_20 | 0.51 |
| PF02586 | SRAP | 0.51 |
| PF03992 | ABM | 0.51 |
| PF02452 | PemK_toxin | 0.51 |
| PF13358 | DDE_3 | 0.51 |
| PF12681 | Glyoxalase_2 | 0.51 |
| PF12088 | DUF3565 | 0.51 |
| PF02518 | HATPase_c | 0.51 |
| PF01266 | DAO | 0.51 |
| PF03400 | DDE_Tnp_IS1 | 0.51 |
| PF00723 | Glyco_hydro_15 | 0.51 |
| PF01814 | Hemerythrin | 0.51 |
| PF13495 | Phage_int_SAM_4 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.03 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.52 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.51 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.51 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.51 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.51 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.45 % |
| Unclassified | root | N/A | 36.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_12176082 | Not Available | 543 | Open in IMG/M |
| 3300000858|JGI10213J12805_11832924 | Not Available | 580 | Open in IMG/M |
| 3300005176|Ga0066679_10627647 | Not Available | 701 | Open in IMG/M |
| 3300005181|Ga0066678_10220732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1217 | Open in IMG/M |
| 3300005289|Ga0065704_10089741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2835 | Open in IMG/M |
| 3300005340|Ga0070689_100250734 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300005466|Ga0070685_10380270 | Not Available | 973 | Open in IMG/M |
| 3300005549|Ga0070704_101803277 | Not Available | 566 | Open in IMG/M |
| 3300005558|Ga0066698_10515854 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005562|Ga0058697_10020732 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300005719|Ga0068861_101896953 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005719|Ga0068861_102356413 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005764|Ga0066903_100464773 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300005937|Ga0081455_10009531 | All Organisms → cellular organisms → Bacteria | 9975 | Open in IMG/M |
| 3300005937|Ga0081455_10011508 | All Organisms → cellular organisms → Bacteria | 8885 | Open in IMG/M |
| 3300005937|Ga0081455_10037072 | All Organisms → cellular organisms → Bacteria | 4334 | Open in IMG/M |
| 3300005937|Ga0081455_10099101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2345 | Open in IMG/M |
| 3300005981|Ga0081538_10004090 | All Organisms → cellular organisms → Bacteria | 13562 | Open in IMG/M |
| 3300005981|Ga0081538_10091437 | Not Available | 1571 | Open in IMG/M |
| 3300005981|Ga0081538_10257728 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005983|Ga0081540_1021375 | All Organisms → cellular organisms → Bacteria | 3856 | Open in IMG/M |
| 3300005985|Ga0081539_10017584 | All Organisms → cellular organisms → Bacteria | 5010 | Open in IMG/M |
| 3300005985|Ga0081539_10033605 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300005985|Ga0081539_10069600 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300005985|Ga0081539_10181205 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006049|Ga0075417_10003696 | All Organisms → cellular organisms → Bacteria | 4906 | Open in IMG/M |
| 3300006049|Ga0075417_10029728 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300006049|Ga0075417_10164652 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300006049|Ga0075417_10517341 | Not Available | 601 | Open in IMG/M |
| 3300006049|Ga0075417_10559984 | Not Available | 579 | Open in IMG/M |
| 3300006194|Ga0075427_10077899 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006844|Ga0075428_100044173 | All Organisms → cellular organisms → Bacteria | 4898 | Open in IMG/M |
| 3300006844|Ga0075428_100253856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1894 | Open in IMG/M |
| 3300006844|Ga0075428_100357383 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300006844|Ga0075428_101225884 | Not Available | 790 | Open in IMG/M |
| 3300006844|Ga0075428_102376635 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006844|Ga0075428_102406849 | Not Available | 540 | Open in IMG/M |
| 3300006845|Ga0075421_100092118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3816 | Open in IMG/M |
| 3300006845|Ga0075421_100096379 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3726 | Open in IMG/M |
| 3300006845|Ga0075421_100237879 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300006845|Ga0075421_101137393 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300006846|Ga0075430_100662492 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006847|Ga0075431_100092360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3124 | Open in IMG/M |
| 3300006847|Ga0075431_100567167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300006853|Ga0075420_100143487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis → Chroococcidiopsis cubana → Chroococcidiopsis cubana SAG 39.79 | 2097 | Open in IMG/M |
| 3300006853|Ga0075420_101107816 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006880|Ga0075429_100133521 | Not Available | 2171 | Open in IMG/M |
| 3300006880|Ga0075429_100483756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1085 | Open in IMG/M |
| 3300006880|Ga0075429_101032395 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300006880|Ga0075429_101568130 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006935|Ga0081246_1350837 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300006969|Ga0075419_10134963 | Not Available | 1606 | Open in IMG/M |
| 3300006969|Ga0075419_10938199 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300007004|Ga0079218_13740275 | Not Available | 517 | Open in IMG/M |
| 3300007076|Ga0075435_100821179 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009012|Ga0066710_101863841 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300009090|Ga0099827_10843340 | Not Available | 793 | Open in IMG/M |
| 3300009094|Ga0111539_11435972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300009098|Ga0105245_12149112 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300009100|Ga0075418_10859336 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300009100|Ga0075418_11617082 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009100|Ga0075418_12513057 | Not Available | 562 | Open in IMG/M |
| 3300009100|Ga0075418_12845101 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009137|Ga0066709_101717227 | Not Available | 889 | Open in IMG/M |
| 3300009137|Ga0066709_103875326 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009147|Ga0114129_10077002 | All Organisms → cellular organisms → Bacteria | 4641 | Open in IMG/M |
| 3300009147|Ga0114129_10256450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2346 | Open in IMG/M |
| 3300009147|Ga0114129_11019417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300009147|Ga0114129_12419893 | Not Available | 629 | Open in IMG/M |
| 3300009156|Ga0111538_10127582 | All Organisms → cellular organisms → Bacteria | 3231 | Open in IMG/M |
| 3300009156|Ga0111538_10402252 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300009156|Ga0111538_12056172 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300009156|Ga0111538_13102745 | Not Available | 579 | Open in IMG/M |
| 3300009156|Ga0111538_13809621 | Not Available | 522 | Open in IMG/M |
| 3300009162|Ga0075423_10180906 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300009162|Ga0075423_12018749 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009553|Ga0105249_10293017 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300009553|Ga0105249_10883196 | Not Available | 960 | Open in IMG/M |
| 3300009840|Ga0126313_10935239 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010041|Ga0126312_10154227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1595 | Open in IMG/M |
| 3300010042|Ga0126314_10276509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1195 | Open in IMG/M |
| 3300010145|Ga0126321_1028581 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
| 3300010145|Ga0126321_1033079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2566 | Open in IMG/M |
| 3300010145|Ga0126321_1052725 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300010145|Ga0126321_1099798 | Not Available | 1107 | Open in IMG/M |
| 3300010145|Ga0126321_1184125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. SIO2G3 | 718 | Open in IMG/M |
| 3300010145|Ga0126321_1247316 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300010145|Ga0126321_1257870 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300010145|Ga0126321_1305362 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300010145|Ga0126321_1349774 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300010145|Ga0126321_1416793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1446 | Open in IMG/M |
| 3300010145|Ga0126321_1436749 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300010362|Ga0126377_12091337 | Not Available | 642 | Open in IMG/M |
| 3300010366|Ga0126379_11489978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MMS16-BH015 | 782 | Open in IMG/M |
| 3300011332|Ga0126317_10618471 | Not Available | 1150 | Open in IMG/M |
| 3300012204|Ga0137374_10188033 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300012206|Ga0137380_10793002 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012207|Ga0137381_10338730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300012209|Ga0137379_10272634 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300012212|Ga0150985_108753035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1636 | Open in IMG/M |
| 3300012212|Ga0150985_114188999 | Not Available | 1058 | Open in IMG/M |
| 3300012349|Ga0137387_10100680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2014 | Open in IMG/M |
| 3300012349|Ga0137387_10125493 | Not Available | 1812 | Open in IMG/M |
| 3300012349|Ga0137387_10425655 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 963 | Open in IMG/M |
| 3300012350|Ga0137372_10774776 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012376|Ga0134032_1116296 | Not Available | 648 | Open in IMG/M |
| 3300012380|Ga0134047_1263948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300012396|Ga0134057_1028879 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012469|Ga0150984_105065185 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012685|Ga0137397_10911955 | Not Available | 651 | Open in IMG/M |
| 3300012948|Ga0126375_12101129 | Not Available | 502 | Open in IMG/M |
| 3300012971|Ga0126369_11489368 | Not Available | 766 | Open in IMG/M |
| 3300013306|Ga0163162_10174011 | Not Available | 2278 | Open in IMG/M |
| 3300013306|Ga0163162_13339512 | Not Available | 513 | Open in IMG/M |
| 3300014326|Ga0157380_12407936 | Not Available | 592 | Open in IMG/M |
| 3300014488|Ga0182001_10085799 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300015371|Ga0132258_10041587 | All Organisms → cellular organisms → Bacteria | 10441 | Open in IMG/M |
| 3300015372|Ga0132256_101802644 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300015374|Ga0132255_100850237 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300017792|Ga0163161_10982935 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018431|Ga0066655_10803998 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018432|Ga0190275_10583716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1163 | Open in IMG/M |
| 3300018466|Ga0190268_12391480 | Not Available | 501 | Open in IMG/M |
| 3300019254|Ga0184641_1251303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 752 | Open in IMG/M |
| 3300019259|Ga0184646_1359215 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300019279|Ga0184642_1406418 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300025918|Ga0207662_10490006 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300025961|Ga0207712_10094844 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300025961|Ga0207712_10755750 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300025961|Ga0207712_11942891 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026035|Ga0207703_10032790 | All Organisms → cellular organisms → Bacteria | 4113 | Open in IMG/M |
| 3300026118|Ga0207675_100044725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4138 | Open in IMG/M |
| 3300026118|Ga0207675_100375695 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1397 | Open in IMG/M |
| 3300026118|Ga0207675_101186457 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300027873|Ga0209814_10011474 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
| 3300027873|Ga0209814_10120917 | Not Available | 1117 | Open in IMG/M |
| 3300027873|Ga0209814_10146255 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300027873|Ga0209814_10407628 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027880|Ga0209481_10122310 | Not Available | 1270 | Open in IMG/M |
| 3300027907|Ga0207428_10066087 | All Organisms → cellular organisms → Bacteria | 2850 | Open in IMG/M |
| 3300027907|Ga0207428_10082176 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300027907|Ga0207428_10468733 | Not Available | 917 | Open in IMG/M |
| 3300027907|Ga0207428_11120186 | Not Available | 550 | Open in IMG/M |
| 3300027909|Ga0209382_10027938 | Not Available | 6801 | Open in IMG/M |
| 3300027909|Ga0209382_10084431 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3737 | Open in IMG/M |
| 3300027909|Ga0209382_10449013 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300027909|Ga0209382_11627653 | Not Available | 637 | Open in IMG/M |
| 3300027909|Ga0209382_12160748 | Not Available | 528 | Open in IMG/M |
| 3300027909|Ga0209382_12170027 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300028380|Ga0268265_11756189 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300030829|Ga0308203_1011329 | Not Available | 1038 | Open in IMG/M |
| 3300030830|Ga0308205_1003566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1327 | Open in IMG/M |
| 3300030830|Ga0308205_1024955 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300030903|Ga0308206_1001839 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
| 3300030903|Ga0308206_1018357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1151 | Open in IMG/M |
| 3300030903|Ga0308206_1121831 | Not Available | 604 | Open in IMG/M |
| 3300030903|Ga0308206_1131449 | Not Available | 588 | Open in IMG/M |
| 3300031039|Ga0102760_11002511 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300031054|Ga0102746_10989614 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300031092|Ga0308204_10019253 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300031092|Ga0308204_10048592 | Not Available | 1022 | Open in IMG/M |
| 3300031092|Ga0308204_10176134 | Not Available | 652 | Open in IMG/M |
| 3300031092|Ga0308204_10190983 | Not Available | 633 | Open in IMG/M |
| 3300031094|Ga0308199_1014091 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300031562|Ga0310886_10748094 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031903|Ga0307407_11227646 | Not Available | 586 | Open in IMG/M |
| 3300031995|Ga0307409_100153321 | Not Available | 2004 | Open in IMG/M |
| 3300031995|Ga0307409_101995914 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300032002|Ga0307416_100851287 | Not Available | 1010 | Open in IMG/M |
| 3300032159|Ga0268251_10276796 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300032174|Ga0307470_11616536 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300033551|Ga0247830_10087497 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2159 | Open in IMG/M |
| 3300034664|Ga0314786_167151 | Not Available | 526 | Open in IMG/M |
| 3300034668|Ga0314793_022073 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300034669|Ga0314794_118408 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 31.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.14% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 6.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.08% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 5.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.03% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.03% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.02% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031054 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_121760821 | 3300000550 | Soil | VRLEHRRKNPPPTILEEQEEGVVRIADGEPHDPCPVAGCRGTLLF |
| JGI10213J12805_118329242 | 3300000858 | Soil | MRHVQQRRKNPPPVVWEEQDNEIVLLAYGEPQDPCPVPGCRGTLRF |
| Ga0066679_106276471 | 3300005176 | Soil | MLQQRRKNPLPAVREDQGNGIFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0066678_100279553 | 3300005181 | Soil | VRPEHRRKNPPPTVLEEQGEGVVLLADGEPHDPCPVAGCHGTLRFLHQ* |
| Ga0066678_102207321 | 3300005181 | Soil | MRQQHRKNPLPVVREDQGNGIVLIAHGEPHDPCPVPGCTGTLLFLHR* |
| Ga0065704_100897413 | 3300005289 | Switchgrass Rhizosphere | MGMQQHRKHPLPVVRAVHGHGIFLLEHGEPQDPCPVPGCRGTLRFLHR* |
| Ga0065707_101665292 | 3300005295 | Switchgrass Rhizosphere | MRAPAVGAGGQRVGQSRRKNPLPAVREAQGNGICLLAHGEPHDPCPVAGCGGTLRFLHR* |
| Ga0070689_1002507341 | 3300005340 | Switchgrass Rhizosphere | VRSQHRRNNPLPTIREEQGEGVVLLADGAPHDPCPVPGCRGTLRFLHR* |
| Ga0070685_103802701 | 3300005466 | Switchgrass Rhizosphere | TQPLPTVRAEQGQGIVLLAHGEPHDPCPVAGCRGTLLFLRR* |
| Ga0070704_1018032771 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KNPLPVVREAQGNGIFLLAHGEPHDPCPVAGCGGTLLFLHR* |
| Ga0066698_105158542 | 3300005558 | Soil | MWQQRRKTPLPAVREDQGNGIFLLQHGEPHDPCPVAGCRGTLLFLHC* |
| Ga0058697_100207324 | 3300005562 | Agave | MQQHRKNPLPVVRAAYGNGIFLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0068855_1024574822 | 3300005563 | Corn Rhizosphere | MREPAVGTGGQRVEQPRRKNPLPVVREAQGNGLYLLAHGEPHDPCPVAGCGGTLRFLHR* |
| Ga0068861_1018969531 | 3300005719 | Switchgrass Rhizosphere | MMHQRRTHPLPVVREDQGQGIFLLIYGEPHDPCPVVGC |
| Ga0068861_1023564131 | 3300005719 | Switchgrass Rhizosphere | MGVQQRRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0066903_1004647734 | 3300005764 | Tropical Forest Soil | MRHVQQRRKNPPPVVWEEQGHGIFLLAHGEPQDPCPVPGCRGTLSFLHR* |
| Ga0081455_1000953116 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSVQQRRTHPLPMVQEAQGHGLFLLAHGEPHDPCPVAGCRGTLRFLHR* |
| Ga0081455_100115087 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRMQQHRNNPLPVVRAADGNGIVLLAHGEPHDPCPVEGCAGALRFVHR* |
| Ga0081455_100370722 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRVQQRRKHPLPTVQEAQGHGLFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0081455_100496882 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MREPAAGAGGQRVEQQRRKNPLPVVREAQGNGIYLLAHGEPHDPCPVAGCGGTLLFLHR* |
| Ga0081455_100991014 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRMQQHRKNPLPVVRAVHGHGIVLLEHGEPHDPCPVPGCRGTLLFLHR* |
| Ga0081538_100040901 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRHEQQRRKNPPPVVRTDQGNGIFLLAHGEPQDPCPVAGCQGTLLFLHR* |
| Ga0081538_100312093 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRGPAAGDGGQRAWQQRRKNPPPAVREVQGNGRSLLVHGEPHDPCPVAECGGTLLFLHR* |
| Ga0081538_100914372 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRHEQQRRKNPPSVVRTDQGNGIFLLEHGEPHDPCPVTGCRGTLRFLHR* |
| Ga0081538_102577282 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRMQQHRKNPLPVVRAADGNGIVLLAHGEPHDPCPVESCAGELRFVHR* |
| Ga0081540_10213752 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VRALAACQGGQTMGQQRRTNPPPAVREALGHGLYLLADGEPHDPCPVTGCGGTLLFLHR* |
| Ga0081539_100175842 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MRVQQRRTHPLPTVRADQGHGVFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0081539_100336053 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MRMQQHGKNPRPVVRAADGNGIVLLAHGEPHDPCPVESCAGELRFVHR* |
| Ga0081539_100696003 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MSVQQRRTHPLPTVRAAQGQGLFLLADGEPHDPCPVAGCRGTLRFLHR* |
| Ga0081539_101812052 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MRMQQRRKQPLPVVQQEQGQGLFLLAHGEPHDPCPVDGCRGTLLFLHR* |
| Ga0075417_100036962 | 3300006049 | Populus Rhizosphere | MGGKGMLQQCRKNLPPGVREAQGNGIYLLAHGEPHDPCPVAGCSGTLLFLHR* |
| Ga0075417_100297283 | 3300006049 | Populus Rhizosphere | MGVQQRRKNPLPVVRAVHGHGLFLLEHGEPHDPCPVEGCAGALRFAHR* |
| Ga0075417_101646521 | 3300006049 | Populus Rhizosphere | MSVQQHRKQPLPVVREAQGQGLFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075417_105173412 | 3300006049 | Populus Rhizosphere | VREPTACHGGEGMRQPHRKKPPPAVREAQGNGIYLLAHGEPHDPCPVVGCGGTLRFLHR* |
| Ga0075417_105599842 | 3300006049 | Populus Rhizosphere | MGMQQHRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVPGCRGTLRFLHR* |
| Ga0075432_100659633 | 3300006058 | Populus Rhizosphere | MREPAVGAGGQRVEQQRRKNPLPVVQEAQGNGIYLLAHGEPHDPCPVAGCGGTLLFLHR* |
| Ga0075427_100778992 | 3300006194 | Populus Rhizosphere | MGVQQRRKNPLPVVRAVHGHGLFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0075428_1000441732 | 3300006844 | Populus Rhizosphere | MRVQQRRKHPLPVVREDQGQGVFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075428_1001210167 | 3300006844 | Populus Rhizosphere | VRPQHRRNNPLPTIRAEQGEGVVLLADGAPHDPCPVPGCRGTLRFLHR* |
| Ga0075428_1002538561 | 3300006844 | Populus Rhizosphere | MRVQQRRTHPLPTVRAEQDHGIVLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075428_1003573832 | 3300006844 | Populus Rhizosphere | MRVQQRRTHPLPLVQEEQGQGLFLLAHGAPHDPCPVAGCRGTLRFLHR* |
| Ga0075428_1012258842 | 3300006844 | Populus Rhizosphere | MSVQQRRKQPLPVVREEQGQGLFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075428_1023766351 | 3300006844 | Populus Rhizosphere | MSVQQRRKHPLPTVRAAQGQGLFLLADGEPHDPCPVAGC |
| Ga0075428_1024068492 | 3300006844 | Populus Rhizosphere | MGIQQHRKHPLPVVRAADGHGIFLLEHGEPHDPCPVEGCAGTLRFAHR* |
| Ga0075421_1000921182 | 3300006845 | Populus Rhizosphere | MRQPHRKKPPPAVREAQGNGIYLLAHGEPHDPCPVVGCGGTLRFLHR* |
| Ga0075421_1000963793 | 3300006845 | Populus Rhizosphere | MGGNRVIQQRRTHPLPVVREDQGHGVFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075421_1002378791 | 3300006845 | Populus Rhizosphere | MSVQQRRTHPLPTVRAEQDHGIVLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075421_1011373931 | 3300006845 | Populus Rhizosphere | MRMQQHRKTPLPVVRAAYGNGIVLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0075430_1006624922 | 3300006846 | Populus Rhizosphere | MSVQQRRTHPLPTVRAEQDHGIILLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0075431_1000923606 | 3300006847 | Populus Rhizosphere | MMHQRRTHPLPVVREDQGQGIFLLVYGEPHDPCPVVGSRGTLRFLHR* |
| Ga0075431_1005671671 | 3300006847 | Populus Rhizosphere | MSVQQHRKQPLPVVREEQGQGLFLLAHGEPHDPCPVAGCR |
| Ga0075420_1001434874 | 3300006853 | Populus Rhizosphere | MTRQQQRKNPLPAVRAYRANGSFLLDHGEPHDPCPVEGCRGILFFLHR* |
| Ga0075420_1011078162 | 3300006853 | Populus Rhizosphere | MGGKDMVQQRRKNPLPEVREAQDNDIYLLAHGEPHDPCPVAACHGTLLFLHR* |
| Ga0075429_1001335212 | 3300006880 | Populus Rhizosphere | VRPDHRRKNSPPTIVEAQDEDIVLLADGEPHDACPVIGCRGILLFLHR* |
| Ga0075429_1004837563 | 3300006880 | Populus Rhizosphere | TMGIQQHRKHPLPVVRAADGHGIFLLEHGEPHDPCPVEGCAGTLRFAHR* |
| Ga0075429_1010323951 | 3300006880 | Populus Rhizosphere | VIQQRRTHPLPVVREDQGHGVFLLAHGEPHDPCPVAGCWGTLLFLHR |
| Ga0075429_1015681301 | 3300006880 | Populus Rhizosphere | MSVQQRRTHPLPTVRAEQDHGIILLAHGEPHDPCPVAGCRGTL |
| Ga0081246_13508371 | 3300006935 | Tropical Rainforest Soil | MSVQQRRKQPLPTVRAAQGQGLFLLADGEPHDLCPVAGCRGTLLFLHR* |
| Ga0075419_101349634 | 3300006969 | Populus Rhizosphere | MKHIWQRRKNPPPVVHEAQGKGCFLLAHGEPQDPCPVPGCSGTLRFLHR* |
| Ga0075419_109381992 | 3300006969 | Populus Rhizosphere | MRVQQRRKHPLPTVRAEQGHGIVLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0079218_137402751 | 3300007004 | Agricultural Soil | MLQQVRKNPHPAVREDQGNGIFLIAHGEPHDPCPVEGCRGTLLFLHR* |
| Ga0075435_1008211792 | 3300007076 | Populus Rhizosphere | MRVQQRRKNPLPVVRAAQGNGICILEHGEPQDPCPVPRCRGILLFLHR* |
| Ga0066710_1018638411 | 3300009012 | Grasslands Soil | MGGKGMVQQCRKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCHGTLLFLHR |
| Ga0099827_108433402 | 3300009090 | Vadose Zone Soil | MLQQRRKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCSGTLLFLHR* |
| Ga0111539_114359722 | 3300009094 | Populus Rhizosphere | MGVQQRRENPLPVVRAADGNGIFLLEHGEPHDPCPVEGCAGELRFVHR* |
| Ga0105245_121491122 | 3300009098 | Miscanthus Rhizosphere | MEGQQRRKHPLPMVREAQGQGLFLLAHGEPHDPCPVAGCGGTLLFLHR* |
| Ga0075418_108593361 | 3300009100 | Populus Rhizosphere | MSVQQRRKHPLPTVRAAQGQGLFLLADGEPHDPCPVAGCRGTLRFLHR* |
| Ga0075418_116170822 | 3300009100 | Populus Rhizosphere | MQQHRKNPLPVVRAAYGNGIVLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0075418_125130571 | 3300009100 | Populus Rhizosphere | NPPPEVREAQGNDIYLLAHGEPHDPCPVAGCHGTLRFLHR* |
| Ga0075418_128451012 | 3300009100 | Populus Rhizosphere | MGVQQRRENPLPVVRAADGNGIFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0066709_1017172271 | 3300009137 | Grasslands Soil | MWQQRRKTPLPAVREDQGNGIFLLQHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0066709_1038753261 | 3300009137 | Grasslands Soil | VQKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCHGTLLFL |
| Ga0114129_100770022 | 3300009147 | Populus Rhizosphere | MGGNRVIQQRRTHPLPVVREDQGHGGFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0114129_102564501 | 3300009147 | Populus Rhizosphere | MKHIRQRRKNSPPLVHEAQGDGCFLLAHGEPQDPCPVPGCSGTLRFLH |
| Ga0114129_105862061 | 3300009147 | Populus Rhizosphere | MREPAVGTGGQRVEQQRRKNPLPVVREAQGNGLSLLAHGEPHDPCPVAGCGGTLRFLHR* |
| Ga0114129_110194172 | 3300009147 | Populus Rhizosphere | MSVQQRRTQPLPTVRAEQGQGLVLLAHGEPHDPCPVAGCGGALLFLHR* |
| Ga0114129_124198931 | 3300009147 | Populus Rhizosphere | MGIQQHRKHPLPVVRAADGHGIFLLEHGEPHDPCPVEGCAGALRFAHR* |
| Ga0111538_101275822 | 3300009156 | Populus Rhizosphere | MKHIWQRRKNPPPVVHEAQGKGCFLLAHGEPQDPCPVPGCSGTLCFLHR* |
| Ga0111538_104022522 | 3300009156 | Populus Rhizosphere | MSVQQRRKHPLPTVRAAQGQGLFLLADGEPHDPCPVAGCRGTLLFLHR* |
| Ga0111538_120561722 | 3300009156 | Populus Rhizosphere | MSVQQRRTHPLPTVRAEQGHGIVLLAHGEPHDPCPVAGCRG |
| Ga0111538_131027453 | 3300009156 | Populus Rhizosphere | GIQQHRKHPLPVVRAADGHGIFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0111538_138096212 | 3300009156 | Populus Rhizosphere | MVQQRKKNPLPEVCEAQGNDIYLLAHGEPHDPCPVAACHGTLLFLHR* |
| Ga0075423_101809064 | 3300009162 | Populus Rhizosphere | MGVQRRRKNPLPVVRAVHGHGLFLLEHGEPHDPCPVEGCAGALRFAHR* |
| Ga0075423_120187492 | 3300009162 | Populus Rhizosphere | MQQHRKNPLPVVRAAYGNGIVLLVHGEPHDPCPVEGCAGELRFVHR* |
| Ga0105249_102930172 | 3300009553 | Switchgrass Rhizosphere | MEGQQHRKNPLPVVRAVQGHGSFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0105249_108831962 | 3300009553 | Switchgrass Rhizosphere | MMHQRRTHLLPAVREDQGQGIFLLIYGEPHDPCPVVGCRGTLRFLHR* |
| Ga0126313_109352392 | 3300009840 | Serpentine Soil | MRMQQHRKNPLPVVRAAYGNGIFLLAHGEPHDPCPVEGCAGELRFAHR* |
| Ga0126312_101542272 | 3300010041 | Serpentine Soil | MRMQQHRKNPLPVVRAAYGNGIFLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0126314_102765092 | 3300010042 | Serpentine Soil | MGMQQHRKNPLPVVRAAYGTGIFLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0126321_10285814 | 3300010145 | Soil | MGGNRVTQQRRTHPLPVVREDQGHGVFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0126321_10330793 | 3300010145 | Soil | MSVQQRRTHPLPTVRAEQGQGIVLLAYGEPHDPCPVAGCRGTLLFLHR* |
| Ga0126321_10527251 | 3300010145 | Soil | MRVQQRRKQPLPVVREEQGQGLFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0126321_10997982 | 3300010145 | Soil | MRRLQQRRKNPPPVVWEAQGNGIFLLAHGEPQDLCPVLGCRGTLRFLHR* |
| Ga0126321_11841252 | 3300010145 | Soil | MGGQQRRKNPLLVVRAAHGHGIFLLEHGEPHDPCPVEGCAGELRFVHR* |
| Ga0126321_12473162 | 3300010145 | Soil | MGQQHRKNPLPAVREAQGNGIYLLAHGEPHDPCPVAGCGGTLLFLHR* |
| Ga0126321_12578702 | 3300010145 | Soil | MSVQQRRTQPLPTVRAEQGHRIVLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0126321_13053622 | 3300010145 | Soil | MRVQQRRKNPLPVVRAADGNGIFLLEHGEPHDPCPVEGCAGELRFVHR* |
| Ga0126321_13497741 | 3300010145 | Soil | MRMQQHRKNPLPVVRAAYGHGIFLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0126321_14167932 | 3300010145 | Soil | MGGQQRRKNPLPVVRAAQGHGIFLLDHGEPHDPCPVEGCAGELRFAHR* |
| Ga0126321_14367493 | 3300010145 | Soil | MGMQQHRKNPLPVVRAAYGNGIFLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0126377_106488552 | 3300010362 | Tropical Forest Soil | MKGPAAGDGGQGVGQPRRKNPPPAVREVQGNGRSLLVHGDPHDPCPVAGCGGTLLFLHR* |
| Ga0126377_120913372 | 3300010362 | Tropical Forest Soil | MSVQQRRTHPLPTVRADQGHGVFLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0126379_114899781 | 3300010366 | Tropical Forest Soil | MRRQQHRKHPLPVVRAAYGNGIVLLAHGEPHDPCPVESCAGELRFVHR* |
| Ga0126317_106184711 | 3300011332 | Soil | MRYVQQRRKNPLPVVWEEQGHDIFLLAHGEPQDPCPGPGCRGTLRFL |
| Ga0137374_101880332 | 3300012204 | Vadose Zone Soil | MVQQCRKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCHGTLLFLHR* |
| Ga0137380_107930022 | 3300012206 | Vadose Zone Soil | MGVQQRRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVEDCAGELRFAHR* |
| Ga0137381_103387301 | 3300012207 | Vadose Zone Soil | LVREAQGNDIYLLAHGAPHDPCPVAGCHGTLRFLHR* |
| Ga0137379_102726342 | 3300012209 | Vadose Zone Soil | MVQQCRKNSPPAVREAQGNGLYLLAHGEPHDPCPVAGCHGTLLFLHR* |
| Ga0150985_1087530353 | 3300012212 | Avena Fatua Rhizosphere | MVQQRRKNPPPEVREAQGNDIYLLAHGEPHDPCPVAACSGTLLFLHR* |
| Ga0150985_1141889991 | 3300012212 | Avena Fatua Rhizosphere | TLMGQQRRKNPPPVVREAQGNDIYLLAHGEPHDPCPVEGCGGILLFLHR* |
| Ga0137387_101006803 | 3300012349 | Vadose Zone Soil | MLQQCRKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCHGTLLFLHR* |
| Ga0137387_101254933 | 3300012349 | Vadose Zone Soil | MAQRRRKNPPPMVREAQGNGIYLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0137387_104256551 | 3300012349 | Vadose Zone Soil | MIQQSRNNPSPLVREAQGNDIYLLAHGAPHDPCPVAGCHGTLRF |
| Ga0137372_107747762 | 3300012350 | Vadose Zone Soil | MGGQQRRKNPLPVVRAVHGHGLFLLDHGEPHDPCPAPGCRGTLRFLHR* |
| Ga0134032_11162961 | 3300012376 | Grasslands Soil | MGQQHRKNPPPVVREAQGNGLYLLAYGEPHDPCPVAGCSGTLLFLHR* |
| Ga0134047_12639481 | 3300012380 | Grasslands Soil | MGGQQRRKNPLPVVRAAHGHGIFLLEHGEPQDPCPVPGCRGTLRFLHR* |
| Ga0134057_10288791 | 3300012396 | Grasslands Soil | MRVQQRRTHPLPVVREEQGQGLFLLAHGAPHDPCPVAGCRGTLLFLHR* |
| Ga0150984_1004537152 | 3300012469 | Avena Fatua Rhizosphere | MREPAESNGGQGGGQQRRKNPLPAVHEAQGHGLYLLADGEPHDPCPVTGCGGTLLFLHR* |
| Ga0150984_1050651852 | 3300012469 | Avena Fatua Rhizosphere | MRVQQRRTQPLPTVRAEQGQGIVLLAHGEPHDPCPVAGCRGTLLFLRR* |
| Ga0150984_1185443282 | 3300012469 | Avena Fatua Rhizosphere | MREPAVGAGGQRVEQRRKNPLPVVREAQGNGISLLPHGEPHDPCPVAGCGGTLLFLHR* |
| Ga0137397_109119552 | 3300012685 | Vadose Zone Soil | MGGQQRRKNPLPVVRAAHGHGIFLLEHGEPHDPCPVEGCAGELRFAHR* |
| Ga0126375_121011292 | 3300012948 | Tropical Forest Soil | MRMQQHRKNPLPVVRAADGNGIVLLAHGEPHDPCAVGSCAGELRFVHR* |
| Ga0126369_114893681 | 3300012971 | Tropical Forest Soil | MQHIRQRRKNPLPVVHEAQGQGYFLLAHGEPQDPCPVPGCSGTLRFLH |
| Ga0163162_101740113 | 3300013306 | Switchgrass Rhizosphere | VQQRRTQPLPTVRAEQGQGIVLLAHGEPYDPCPVAGCRGTLLFLRR* |
| Ga0163162_133395121 | 3300013306 | Switchgrass Rhizosphere | PLPTVRAAHSNGTVLLAHGEPHDPCPVAGCRGTLLFLHR* |
| Ga0157380_124079361 | 3300014326 | Switchgrass Rhizosphere | EGVRAQPQEATISVQQRRTQPLPTVRAEQGQGIVLLAHGEPHDPCPVAGCRGTLLFLRR* |
| Ga0182001_100857992 | 3300014488 | Soil | MRMQQHRKNPLPVVRAADGHGIVLLAHGEPHDPCPVEGCAGELRFVHR* |
| Ga0132258_100415872 | 3300015371 | Arabidopsis Rhizosphere | MGGQQRRKNPLPVVRTVHGHGIFLLAHGEPHAPCPVAGCAGARRVAHRCGQS* |
| Ga0132258_132026412 | 3300015371 | Arabidopsis Rhizosphere | MREPAVGAGGQRVEQQRRKNPLPLVREAQGNGLYLLAHGEPHDPCPVAGCGGTLRFLHR* |
| Ga0132256_1018026441 | 3300015372 | Arabidopsis Rhizosphere | MSMQQRRKHPLPTVQEAQGQGLFLLADGEPHDPCPVAGCRGTLRFLHR* |
| Ga0132256_1020672872 | 3300015372 | Arabidopsis Rhizosphere | MREPAVGAGGQRVEQQRRKNPLPMVREAQGNGLYLLAHGEPHDPCPVAGCGGTLRFLHR* |
| Ga0132255_1008502372 | 3300015374 | Arabidopsis Rhizosphere | MGGQQRRKNPLPVVRTVHGHGIFLLAHGEPHAPCPVAGCAGARRFAHRCGQS* |
| Ga0163161_109829352 | 3300017792 | Switchgrass Rhizosphere | MMHQRRTHPLPVVREDQGQGIFLLIYGEPHDPCPVVGCRGTLRFLHR |
| Ga0066655_108039981 | 3300018431 | Grasslands Soil | MGMQQRRKNPLPVVRAEHGNGICLLEHGEPHDPCPVPDCRGTLLFLHR |
| Ga0190275_105837162 | 3300018432 | Soil | MVQQPRKNPLPMVREEQGNGLFLLADGEPHDPCPVAGCRGT |
| Ga0190268_123914802 | 3300018466 | Soil | MGGKGMVQQCRKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCNGTLLFLHR |
| Ga0184641_12513032 | 3300019254 | Groundwater Sediment | MMEQQRRHNPLPVIDEAQGNGIFLLAHGEPQDPCPVPGCLGTLLFLHR |
| Ga0184646_13592152 | 3300019259 | Groundwater Sediment | MLQQRRKNLMPAVCEEQGNGIVLLAHGEPHDPCPVPGCTGTLRFLHR |
| Ga0184642_14064182 | 3300019279 | Groundwater Sediment | MGGKVMLQQCRKNPPPGVREAQGNGIYLLAHGEPHDPCPVAGCSGTLLFLHR |
| Ga0207662_104900062 | 3300025918 | Switchgrass Rhizosphere | MRVQQRRKQPLPVVRAEQGQGLFLLAHGEPHDPCPVAGCGGTLLFLHR |
| Ga0207712_100948443 | 3300025961 | Switchgrass Rhizosphere | MEGQQHRKNPLPVVRAVQGHGSFLLEHGEPHDPCPVEGCAGELRFAHR |
| Ga0207712_107557502 | 3300025961 | Switchgrass Rhizosphere | MMHQRRTHLLPAVREDQGQGIFLLIYGEPHDPCPVVGCRGTLRFLHR |
| Ga0207712_115049841 | 3300025961 | Switchgrass Rhizosphere | MRAPAVGAGGQRVGQSRRKNPLPAVREAQGNGICLLAHGEPHDPCPVAGCGGTLRFLHR |
| Ga0207712_119428912 | 3300025961 | Switchgrass Rhizosphere | MRVQQRQKHPLPVVQEEQGQGLFLLAHGEPHDPCPVEGCAGELRFAHR |
| Ga0207703_100327902 | 3300026035 | Switchgrass Rhizosphere | MRVQQRRKHPLPMVREAQGQGLFLLAHGEPHDPCPVAGCRGTLLFLRR |
| Ga0207675_1000447255 | 3300026118 | Switchgrass Rhizosphere | MRVQQRRKHPLPMVRAAQGNGICLLEHGEPQDPCPVPGCRGILLFLHR |
| Ga0207675_1003756951 | 3300026118 | Switchgrass Rhizosphere | MGIQQRRKHPLPVVRAAHGHGIFLLAHGKPQDPCPVPGCRGTLLFLHQ |
| Ga0207675_1006616582 | 3300026118 | Switchgrass Rhizosphere | MRAPAVGTGGQRVEQPRRKNPLPVVREAQGNGLYLLAHGEPHDPCPVAGCGGTLRFLHR |
| Ga0207675_1011864571 | 3300026118 | Switchgrass Rhizosphere | MGVQQRRKNPLPVVRAVHGHGLFLLEHGEPHDPCPVEGCAGELRFAHR |
| Ga0209814_100114744 | 3300027873 | Populus Rhizosphere | MGGKGMLQQCRKNLPPGVREAQGNGIYLLAHGEPHDPCPVAGCSGTLLFLHR |
| Ga0209814_101209172 | 3300027873 | Populus Rhizosphere | MKHIRQRSNNPPPVVYEAQGDGCFLLAHGEPQDPCPVPGYSGTLRFLHR |
| Ga0209814_101462552 | 3300027873 | Populus Rhizosphere | MGVQQRRKNPLPVVRAVHGHGLFLLEHGEPHDPCPVEGCAGALRFAHR |
| Ga0209814_104076281 | 3300027873 | Populus Rhizosphere | MSVQQHRKQPLPVVREAQGQGLFLLAHGEPHDPCPVAGCRGTLLFLHR |
| Ga0209481_101223102 | 3300027880 | Populus Rhizosphere | MRVQQRRKHPLPTVRAEQGHGIVLLAHGEPHDPCPVAGCRGTLLFLHR |
| Ga0207428_100660875 | 3300027907 | Populus Rhizosphere | MGVQQRRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVEGCAGELRFAHR |
| Ga0207428_100689523 | 3300027907 | Populus Rhizosphere | MREPAVGAGGQRVEQQRRKNPLPVVQEAQGNGIYLLAHGEPHDPCPVAGCGGTLLFLHR |
| Ga0207428_100821763 | 3300027907 | Populus Rhizosphere | MGMQQHRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVPGCRGTLRFLHR |
| Ga0207428_104687332 | 3300027907 | Populus Rhizosphere | MRVQQRRKHPLPVVREDQGQGVFLLAHGEPHDPCPVAGCRGTLLFLHR |
| Ga0207428_111201861 | 3300027907 | Populus Rhizosphere | VRPQHRRNNPLPTIRAEQGEGVVLLADGAPHDPCPVPGCRGTL |
| Ga0209382_1002793811 | 3300027909 | Populus Rhizosphere | MRVQQRRTHPLPLVQEEQGQGLFLLAHGAPHDPCPVAGCRGTLRFLHR |
| Ga0209382_100844312 | 3300027909 | Populus Rhizosphere | MGGNRVIQQRRTHPLPVVREDQGHGVFLLAHGEPHDPCPVAGCRGTLLFLHR |
| Ga0209382_104490132 | 3300027909 | Populus Rhizosphere | MRVQQRRTHPLPTVRAEQDHGIVLLAHGEPHDPCPVAGCRGTLLFLHR |
| Ga0209382_116276531 | 3300027909 | Populus Rhizosphere | MKHIWQRRKNPPPVVHEAQGKGCFLLAHGEPQDPCPVPGCS |
| Ga0209382_121607482 | 3300027909 | Populus Rhizosphere | MRRLQQRRKNPPPAVCEAQGNGIVLLAHGEPHDACPVPGCRGTLRFVHR |
| Ga0209382_121700272 | 3300027909 | Populus Rhizosphere | MRMQQHRKTPLPVVRAAYGNGIVLLAHGEPHDPCPVEGCAGELRFVHR |
| Ga0268265_117561891 | 3300028380 | Switchgrass Rhizosphere | MGIQQHRKHPLPVVRAAHGHGIVLLAHGKPQDPCPVPGCRGTLLFLHQ |
| Ga0308203_10113292 | 3300030829 | Soil | MGGKGMLQQCRKNPPPGVREAQGNGIYLLAHGEPHDPCPVAGCSGTLLFLHR |
| Ga0308203_10395092 | 3300030829 | Soil | MREPAAGAGGQRVEQQRRKNPLPVVREAQGNGLYLLAHGEPHDPCPVAGCGGTLRFLHR |
| Ga0308205_10035661 | 3300030830 | Soil | GTGGTMGGQQRRKNPLPVVRAAQGHGIFLLEHGELHDPCPVEGCAGELRFAHR |
| Ga0308205_10249552 | 3300030830 | Soil | MGGKGMVQQQRKNPPPAVREAQGNGLYLLAHGEPHDPCPVAGCSGTLLFLHR |
| Ga0308202_10294121 | 3300030902 | Soil | MREPAVGTGGQRVEQQRRKNPLPVVREAQGNGIYLLAHGEPHDPCPVAGCEGTLLFLHR |
| Ga0308206_10018393 | 3300030903 | Soil | MGGQQRRKNPLPVVRAAQGHGIFLLEHGELHDPCPVEGCAGELRFAHR |
| Ga0308206_10183572 | 3300030903 | Soil | VLQQRRKNPLPAVREDQGNGIFLLDHGEPHDPCPVEGCAGELRFAHR |
| Ga0308206_10557361 | 3300030903 | Soil | MREPAAGAGGQRVEQQRRKNPLPVVREAQGNGIYLLAHGEPHDPCPVAGCEGTLLFLHR |
| Ga0308206_11218312 | 3300030903 | Soil | MGQQSRNTPLPLVREAQGNDIYLLAHGAPHDPCPVAGCHGTLRFLHR |
| Ga0308206_11314491 | 3300030903 | Soil | MMHQRTTPPLPVVREDQGQGIFLLVYGEPHDPCPVVGCRGTLLFLHR |
| Ga0102760_109897553 | 3300031039 | Soil | VRVSEHNHGGNIVIQQRRKHPLSVVREDQGHGVFLLAHGEPHDPCPVAGCRGTLLFL |
| Ga0102760_110025112 | 3300031039 | Soil | MGVQQRRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVEDCAGELRFAHR |
| Ga0102746_109896143 | 3300031054 | Soil | MMQQRRKNPLPAVGADQGKGVFLLVHGEPQDPCPVPGCMGTLRFLHR |
| Ga0308204_100132472 | 3300031092 | Soil | MMEPAAGAGGQRVEQQRRKNPLPVVREAQGNGIYLLAHGEPHDPCPVAGCEGTLLFLHR |
| Ga0308204_100192533 | 3300031092 | Soil | MVQQRRKNPPPGVCEAQGNDIYLLAHGEPHDPCPVAECSGILLFLHR |
| Ga0308204_100485922 | 3300031092 | Soil | MGQQRRKNSPPVVREAQGNDIYLLAHGEPHDPCPVEGCGGILLFLHR |
| Ga0308204_101761342 | 3300031092 | Soil | MRVQQRRKHPLPTVREEQGQGLFLLAHGEPHDPCPVAGCRGTLLFLHR |
| Ga0308204_101909831 | 3300031092 | Soil | VAAAQKNPPPAVREAQGNGIYLLAHGEPHDPCPVAGCHGTLLFLHR |
| Ga0308199_10140911 | 3300031094 | Soil | MGGKVMLQQCRKNPPPGVREAQGNGIYLLAHGEPHDPCPVAGCHGTLLFLHR |
| Ga0310887_102496763 | 3300031547 | Soil | MREPAVGAGGQRVEQQRRKNPLPVVQEAQGNGIYLLAHGEPHDPCPVA |
| Ga0310886_107480941 | 3300031562 | Soil | MGVQQRRKNPLPVVRAVHGHGIFLLEHGEPHDPCPVEGCAGELRF |
| Ga0307407_112276462 | 3300031903 | Rhizosphere | MRCLQQHRKNPPPAVCEAQGNGIVLLAHGEPQDPCPVPGCRGTLRFLHR |
| Ga0307409_1001533212 | 3300031995 | Rhizosphere | MRRLQQRRKNPPPAVCEEQDNGIVLLAHGEPQDPCPVPGCRGTLRFLHR |
| Ga0307409_1019959141 | 3300031995 | Rhizosphere | MGMQQRRKHPLPVVRAAYGNGIFLLAHGEPHDPCPVEGCAGELRFVHR |
| Ga0307416_1008512871 | 3300032002 | Rhizosphere | MGMRQRRKNPLPVVRAAHGNGICVLAHGEPQDPCPVPGCRGTLLFLHR |
| Ga0268251_102767962 | 3300032159 | Agave | MRMQQHRKNPLPVVRAAYGNGIFLLAHGEPHDPCPVEGCAGELRFVHR |
| Ga0307470_116165362 | 3300032174 | Hardwood Forest Soil | MRQQHRKNPPPAVREAQGNGIYLLAHGEPHDPCPVVGCGGTLRFLHR |
| Ga0247830_100874974 | 3300033551 | Soil | KNPLPEVCEAQGNDIYLLAHGEPHDPCPVAACHGTLLFLHR |
| Ga0314786_167151_183_326 | 3300034664 | Soil | VEQQRRKNPLPVVQEAQGNGIYLLAHGEPHDPCPVAGCGGTLLFLHR |
| Ga0314793_022073_371_517 | 3300034668 | Soil | MGVQQRRKNPLPVVRAVHGHGIFFLEHGEPNDPCPVKGCAGELRFAHR |
| Ga0314794_118408_418_564 | 3300034669 | Soil | MGVQQRRKNPLPVVRALHGHGIFFLEHGEPNDPCPVKGCAGELRFAHR |
| ⦗Top⦘ |