


| Basic Information | |
|---|---|
| Family ID | F026534 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRRRK |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.37 % |
| % of genes near scaffold ends (potentially truncated) | 25.38 % |
| % of genes from short scaffolds (< 2000 bps) | 79.19 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.741 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.599 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.426 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.548 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF04397 | LytTR | 2.03 |
| PF06080 | DUF938 | 1.52 |
| PF13676 | TIR_2 | 1.52 |
| PF03308 | MeaB | 1.02 |
| PF02515 | CoA_transf_3 | 1.02 |
| PF00072 | Response_reg | 0.51 |
| PF13191 | AAA_16 | 0.51 |
| PF00497 | SBP_bac_3 | 0.51 |
| PF01557 | FAA_hydrolase | 0.51 |
| PF05117 | DUF695 | 0.51 |
| PF00196 | GerE | 0.51 |
| PF01979 | Amidohydro_1 | 0.51 |
| PF12694 | cpYpsA | 0.51 |
| PF13276 | HTH_21 | 0.51 |
| PF01019 | G_glu_transpept | 0.51 |
| PF07859 | Abhydrolase_3 | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF03781 | FGE-sulfatase | 0.51 |
| PF13586 | DDE_Tnp_1_2 | 0.51 |
| PF00535 | Glycos_transf_2 | 0.51 |
| PF07647 | SAM_2 | 0.51 |
| PF02371 | Transposase_20 | 0.51 |
| PF03176 | MMPL | 0.51 |
| PF13517 | FG-GAP_3 | 0.51 |
| PF00144 | Beta-lactamase | 0.51 |
| PF01833 | TIG | 0.51 |
| PF02776 | TPP_enzyme_N | 0.51 |
| PF13546 | DDE_5 | 0.51 |
| PF01904 | DUF72 | 0.51 |
| PF01814 | Hemerythrin | 0.51 |
| PF12849 | PBP_like_2 | 0.51 |
| PF07589 | PEP-CTERM | 0.51 |
| PF10282 | Lactonase | 0.51 |
| PF02518 | HATPase_c | 0.51 |
| PF13417 | GST_N_3 | 0.51 |
| PF13531 | SBP_bac_11 | 0.51 |
| PF02012 | BNR | 0.51 |
| PF08240 | ADH_N | 0.51 |
| PF09828 | Chrome_Resist | 0.51 |
| PF06037 | DUF922 | 0.51 |
| PF05960 | DUF885 | 0.51 |
| PF13442 | Cytochrome_CBB3 | 0.51 |
| PF13378 | MR_MLE_C | 0.51 |
| PF09948 | DUF2182 | 0.51 |
| PF03466 | LysR_substrate | 0.51 |
| PF15902 | Sortilin-Vps10 | 0.51 |
| PF00561 | Abhydrolase_1 | 0.51 |
| PF08808 | RES | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.02 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.51 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.51 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.51 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.51 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.51 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.51 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.51 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.51 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.51 |
| COG5661 | Predicted secreted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG5664 | Predicted secreted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.74 % |
| Unclassified | root | N/A | 17.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090009|LWAnN_F624WLL02GYYKA | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 2228664021|ICCgaii200_c0939050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300000956|JGI10216J12902_119923126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 612 | Open in IMG/M |
| 3300001534|A15PFW1_10044331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6894 | Open in IMG/M |
| 3300001661|JGI12053J15887_10086608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1716 | Open in IMG/M |
| 3300002568|C688J35102_120497063 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300003324|soilH2_10360875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3032 | Open in IMG/M |
| 3300003994|Ga0055435_10012314 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300003995|Ga0055438_10294982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 508 | Open in IMG/M |
| 3300004114|Ga0062593_102042408 | Not Available | 638 | Open in IMG/M |
| 3300004463|Ga0063356_101040465 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300004479|Ga0062595_102493853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 515 | Open in IMG/M |
| 3300005093|Ga0062594_100485620 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005186|Ga0066676_10570770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005294|Ga0065705_10318702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1015 | Open in IMG/M |
| 3300005294|Ga0065705_10403452 | Not Available | 879 | Open in IMG/M |
| 3300005327|Ga0070658_10106474 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300005329|Ga0070683_102360544 | Not Available | 510 | Open in IMG/M |
| 3300005332|Ga0066388_100027072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5256 | Open in IMG/M |
| 3300005332|Ga0066388_100223080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium stellerae | 2515 | Open in IMG/M |
| 3300005334|Ga0068869_100009644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6269 | Open in IMG/M |
| 3300005354|Ga0070675_101624319 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005355|Ga0070671_100633299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum | 925 | Open in IMG/M |
| 3300005364|Ga0070673_101390702 | Not Available | 660 | Open in IMG/M |
| 3300005366|Ga0070659_102008175 | Not Available | 519 | Open in IMG/M |
| 3300005445|Ga0070708_100562799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1075 | Open in IMG/M |
| 3300005445|Ga0070708_100828927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300005455|Ga0070663_101873792 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005456|Ga0070678_100885083 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005529|Ga0070741_10168972 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300005533|Ga0070734_10805255 | Not Available | 533 | Open in IMG/M |
| 3300005543|Ga0070672_100004538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9092 | Open in IMG/M |
| 3300005548|Ga0070665_101437778 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005554|Ga0066661_10947782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 503 | Open in IMG/M |
| 3300005574|Ga0066694_10578352 | Not Available | 523 | Open in IMG/M |
| 3300005713|Ga0066905_102258989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 508 | Open in IMG/M |
| 3300005764|Ga0066903_103814186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 810 | Open in IMG/M |
| 3300005841|Ga0068863_100962722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300005985|Ga0081539_10040007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2758 | Open in IMG/M |
| 3300006031|Ga0066651_10302458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 855 | Open in IMG/M |
| 3300006049|Ga0075417_10487398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300006050|Ga0075028_100428368 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300006755|Ga0079222_12255679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 542 | Open in IMG/M |
| 3300006796|Ga0066665_10628715 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006854|Ga0075425_100044450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4964 | Open in IMG/M |
| 3300006854|Ga0075425_100282918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1909 | Open in IMG/M |
| 3300006865|Ga0073934_10008513 | All Organisms → cellular organisms → Bacteria | 13645 | Open in IMG/M |
| 3300006950|Ga0075524_10539669 | Not Available | 520 | Open in IMG/M |
| 3300006954|Ga0079219_10887723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300007788|Ga0099795_10142968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 974 | Open in IMG/M |
| 3300009038|Ga0099829_10560452 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009094|Ga0111539_10369146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1670 | Open in IMG/M |
| 3300009131|Ga0115027_11401980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 569 | Open in IMG/M |
| 3300009157|Ga0105092_10371406 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300009168|Ga0105104_10006970 | All Organisms → cellular organisms → Bacteria | 7514 | Open in IMG/M |
| 3300009176|Ga0105242_11579259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 689 | Open in IMG/M |
| 3300009551|Ga0105238_12446268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 558 | Open in IMG/M |
| 3300009597|Ga0105259_1100183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 685 | Open in IMG/M |
| 3300010036|Ga0126305_10714517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 678 | Open in IMG/M |
| 3300010359|Ga0126376_12056462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 614 | Open in IMG/M |
| 3300010360|Ga0126372_11211405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 780 | Open in IMG/M |
| 3300010360|Ga0126372_11297462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 756 | Open in IMG/M |
| 3300010361|Ga0126378_12245479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 623 | Open in IMG/M |
| 3300010366|Ga0126379_10467844 | Not Available | 1326 | Open in IMG/M |
| 3300010366|Ga0126379_10834938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 1022 | Open in IMG/M |
| 3300010371|Ga0134125_11350905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia terpenica | 777 | Open in IMG/M |
| 3300010397|Ga0134124_10007673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 8686 | Open in IMG/M |
| 3300012202|Ga0137363_10750447 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012208|Ga0137376_10037818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3878 | Open in IMG/M |
| 3300012212|Ga0150985_101634944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300012212|Ga0150985_103530819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300012212|Ga0150985_111630307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 596 | Open in IMG/M |
| 3300012212|Ga0150985_114756060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1160 | Open in IMG/M |
| 3300012212|Ga0150985_123198230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 639 | Open in IMG/M |
| 3300012357|Ga0137384_10930322 | Not Available | 700 | Open in IMG/M |
| 3300012469|Ga0150984_101768818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1134 | Open in IMG/M |
| 3300012469|Ga0150984_103113218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 521 | Open in IMG/M |
| 3300012469|Ga0150984_111341231 | Not Available | 521 | Open in IMG/M |
| 3300012917|Ga0137395_10685210 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012924|Ga0137413_10610570 | Not Available | 817 | Open in IMG/M |
| 3300012948|Ga0126375_10890775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 714 | Open in IMG/M |
| 3300012988|Ga0164306_11499148 | Not Available | 578 | Open in IMG/M |
| 3300013296|Ga0157374_10877710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 914 | Open in IMG/M |
| 3300013297|Ga0157378_13075487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 518 | Open in IMG/M |
| 3300013306|Ga0163162_10699274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1135 | Open in IMG/M |
| 3300014326|Ga0157380_10569564 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300014502|Ga0182021_11153906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2541 | 933 | Open in IMG/M |
| 3300014969|Ga0157376_12183635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 592 | Open in IMG/M |
| 3300015371|Ga0132258_10200549 | All Organisms → cellular organisms → Bacteria | 4839 | Open in IMG/M |
| 3300015371|Ga0132258_10509846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3010 | Open in IMG/M |
| 3300015371|Ga0132258_11166172 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300015371|Ga0132258_12334120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1341 | Open in IMG/M |
| 3300015371|Ga0132258_12764431 | Not Available | 1223 | Open in IMG/M |
| 3300015371|Ga0132258_12840590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1205 | Open in IMG/M |
| 3300015371|Ga0132258_13440086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1086 | Open in IMG/M |
| 3300015371|Ga0132258_13531516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1070 | Open in IMG/M |
| 3300015372|Ga0132256_100150599 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300015372|Ga0132256_100249840 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300015372|Ga0132256_103279081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300015374|Ga0132255_101369421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300016294|Ga0182041_11349347 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300016404|Ga0182037_10577504 | Not Available | 952 | Open in IMG/M |
| 3300016445|Ga0182038_11229502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 668 | Open in IMG/M |
| 3300017939|Ga0187775_10439204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 548 | Open in IMG/M |
| 3300018000|Ga0184604_10170192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 730 | Open in IMG/M |
| 3300018084|Ga0184629_10097224 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300018422|Ga0190265_11915216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 699 | Open in IMG/M |
| 3300018482|Ga0066669_10518471 | Not Available | 1034 | Open in IMG/M |
| 3300019249|Ga0184648_1002756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 632 | Open in IMG/M |
| 3300019888|Ga0193751_1001859 | All Organisms → cellular organisms → Bacteria | 13169 | Open in IMG/M |
| 3300019888|Ga0193751_1032602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2420 | Open in IMG/M |
| 3300021170|Ga0210400_10394680 | Not Available | 1141 | Open in IMG/M |
| 3300021413|Ga0193750_1019409 | Not Available | 1638 | Open in IMG/M |
| 3300022712|Ga0242653_1098503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 533 | Open in IMG/M |
| 3300022726|Ga0242654_10437338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 508 | Open in IMG/M |
| 3300022756|Ga0222622_10007691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4978 | Open in IMG/M |
| 3300024245|Ga0247677_1012768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1182 | Open in IMG/M |
| 3300024310|Ga0247681_1024061 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300025310|Ga0209172_10063615 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300025315|Ga0207697_10031776 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300025538|Ga0210132_1018546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 961 | Open in IMG/M |
| 3300025538|Ga0210132_1022831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Coraliihabitans → Coraliihabitans acroporae | 876 | Open in IMG/M |
| 3300025549|Ga0210094_1007938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1573 | Open in IMG/M |
| 3300025549|Ga0210094_1045720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 764 | Open in IMG/M |
| 3300025899|Ga0207642_10017441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2731 | Open in IMG/M |
| 3300025920|Ga0207649_10372569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1062 | Open in IMG/M |
| 3300025922|Ga0207646_11581534 | Not Available | 566 | Open in IMG/M |
| 3300025925|Ga0207650_11864778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C085B000 | 508 | Open in IMG/M |
| 3300025986|Ga0207658_11355582 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300026067|Ga0207678_10878664 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300026551|Ga0209648_10270640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1242 | Open in IMG/M |
| 3300027513|Ga0208685_1035579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1092 | Open in IMG/M |
| 3300027743|Ga0209593_10274181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 583 | Open in IMG/M |
| 3300027812|Ga0209656_10034769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2956 | Open in IMG/M |
| 3300027826|Ga0209060_10527187 | Not Available | 535 | Open in IMG/M |
| 3300027835|Ga0209515_10006902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 13917 | Open in IMG/M |
| 3300027843|Ga0209798_10088059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium vaccinii | 1588 | Open in IMG/M |
| 3300027846|Ga0209180_10739712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 531 | Open in IMG/M |
| 3300027866|Ga0209813_10170785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C085B000 | 790 | Open in IMG/M |
| 3300027871|Ga0209397_10386041 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027880|Ga0209481_10547758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 598 | Open in IMG/M |
| 3300027902|Ga0209048_10011150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8058 | Open in IMG/M |
| 3300027902|Ga0209048_10109970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2106 | Open in IMG/M |
| 3300027903|Ga0209488_10603887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 796 | Open in IMG/M |
| 3300028072|Ga0247675_1062545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas lacus | 559 | Open in IMG/M |
| 3300028379|Ga0268266_10080299 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
| 3300028889|Ga0247827_10926226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 587 | Open in IMG/M |
| 3300029984|Ga0311332_11568587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 534 | Open in IMG/M |
| 3300030002|Ga0311350_11123725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300030010|Ga0302299_10440148 | Not Available | 662 | Open in IMG/M |
| 3300030114|Ga0311333_10931588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2541 | 734 | Open in IMG/M |
| 3300030294|Ga0311349_12135225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 514 | Open in IMG/M |
| 3300030496|Ga0268240_10187084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 524 | Open in IMG/M |
| 3300031093|Ga0308197_10031500 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300031232|Ga0302323_102539801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300031521|Ga0311364_10962629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 853 | Open in IMG/M |
| 3300031544|Ga0318534_10207669 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300031548|Ga0307408_100787568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300031668|Ga0318542_10473276 | Not Available | 650 | Open in IMG/M |
| 3300031716|Ga0310813_10451675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
| 3300031726|Ga0302321_100367756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300031726|Ga0302321_100709653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1129 | Open in IMG/M |
| 3300031726|Ga0302321_102764141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 573 | Open in IMG/M |
| 3300031771|Ga0318546_10906259 | Not Available | 621 | Open in IMG/M |
| 3300031782|Ga0318552_10172236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1091 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1004567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14065 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1218459 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031938|Ga0308175_100118703 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300031938|Ga0308175_100243495 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300031938|Ga0308175_102737857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 551 | Open in IMG/M |
| 3300031942|Ga0310916_11540047 | Not Available | 541 | Open in IMG/M |
| 3300032001|Ga0306922_11278434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. HW608 | 743 | Open in IMG/M |
| 3300032076|Ga0306924_10827462 | Not Available | 1030 | Open in IMG/M |
| 3300032089|Ga0318525_10656683 | Not Available | 534 | Open in IMG/M |
| 3300032173|Ga0315268_10223968 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300032256|Ga0315271_10184614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1660 | Open in IMG/M |
| 3300032261|Ga0306920_101491878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 966 | Open in IMG/M |
| 3300032829|Ga0335070_10088508 | All Organisms → cellular organisms → Bacteria | 3273 | Open in IMG/M |
| 3300033004|Ga0335084_10027400 | All Organisms → cellular organisms → Bacteria | 5819 | Open in IMG/M |
| 3300033408|Ga0316605_12338469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 520 | Open in IMG/M |
| 3300033475|Ga0310811_10219297 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300033480|Ga0316620_10329155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300033480|Ga0316620_10778499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300033480|Ga0316620_12033395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 571 | Open in IMG/M |
| 3300033488|Ga0316621_11238650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 565 | Open in IMG/M |
| 3300033513|Ga0316628_103944776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 531 | Open in IMG/M |
| 3300033557|Ga0316617_100266975 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300034384|Ga0372946_0146588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 1126 | Open in IMG/M |
| 3300034817|Ga0373948_0081670 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.08% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.55% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.02% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.02% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.02% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.02% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.02% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.02% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.51% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.51% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.51% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.51% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.51% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.51% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021069 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-25m | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAnN_07397120 | 2088090009 | Freshwater Sediment | MDFIERLFGFAPDGGGGSLEFLLFALPIAGLCTLAWRRRQR |
| ICCgaii200_09390502 | 2228664021 | Soil | MDFIERIFGFSPDGGNGLFELMLFLIPLLGLLALARWRSAKRRNERHR |
| JGI10216J12902_1199231262 | 3300000956 | Soil | MDFIERLFGFAPDGGNGMFEFLLFAIPLAGIVIIAAWR |
| A15PFW1_100443312 | 3300001534 | Permafrost | MDFIERIFGFAPDGGSGSWEMLLFALPIAGLCYLAWRRRRHNRDPD* |
| JGI12053J15887_100866082 | 3300001661 | Forest Soil | MDFIEKIFGFAPDGGDGSFEFWLFAIPLAGVSYLALRRFRSRRSNR* |
| C688J35102_1204970631 | 3300002568 | Soil | MDFIEKIFGMAPDGGSGALEFLLIAIPIAGICYLAFRRSYRNKNKS* |
| soilH2_103608753 | 3300003324 | Sugarcane Root And Bulk Soil | MHFIERIFGLAPDGGNGMFELLLFAIPIAGIIALWRKSNSDRTKRR* |
| Ga0055435_100123142 | 3300003994 | Natural And Restored Wetlands | MDFIERIFGFSPDGGSGLFEVLLFALPLAGICYLVLKRRSRKPFR* |
| Ga0055438_102949822 | 3300003995 | Natural And Restored Wetlands | MDFIERIFGISPDGGSGMFEVLLFAVPIAGICYYMLRRRSKKPLQ* |
| Ga0062593_1020424082 | 3300004114 | Soil | MDFIERIFGIALDQGSGSLEFLLFAVPLAGIACLTFRTRQRRNL* |
| Ga0063356_1010404652 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDFIERIFGFSPDGGSGTFEMLLFLIPIAGIAYFIVKRRQRKP* |
| Ga0062595_1024938531 | 3300004479 | Soil | MDFIERIFGIAPDGGDGSLEFLLFVLPIAGLYWLVARRRGRDRDRR* |
| Ga0062594_1004856202 | 3300005093 | Soil | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRRRKDRDKD* |
| Ga0066676_105707701 | 3300005186 | Soil | MDFIERLFGFAPDGGNGMFELLLFAIPIAGLVILAAWRRKRDAKR* |
| Ga0065705_103187022 | 3300005294 | Switchgrass Rhizosphere | MDFIEKIFGVAPDGGSGALEFLLIAIPIAGICYLVLRRRFGNKA* |
| Ga0065705_104034522 | 3300005294 | Switchgrass Rhizosphere | MDFIERIFGIAPDGGSGSLEFLLFLIPLAGLALLIYRRASRKRERPDQ* |
| Ga0070658_101064741 | 3300005327 | Corn Rhizosphere | MDFIEHLFGIAPDNGSGALEFLLFALPLAGIAWLVLRKRKAVKNRDE* |
| Ga0070683_1023605441 | 3300005329 | Corn Rhizosphere | MDFIERLFGIAPDNGSGVLEFLLFALPLAAIAWLALRRRKAVKDRDE* |
| Ga0066388_1000270723 | 3300005332 | Tropical Forest Soil | MDFIEQIFGFSPDGGSGSFEFLLFAIPVVGLYLFHRLRRRGGRGTNN* |
| Ga0066388_1002230801 | 3300005332 | Tropical Forest Soil | MDFIERIFGIAPDGGSGLFELLLFIVPLAGIVAIYLQRKRKHDQ |
| Ga0068869_1000096448 | 3300005334 | Miscanthus Rhizosphere | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIAYLAFRRRRRKDRDKD* |
| Ga0070675_1016243191 | 3300005354 | Miscanthus Rhizosphere | RMDFIERIFGIALDKDSGSLEFLLFAVPLVGIACLTLRTRERRNR* |
| Ga0070671_1006332991 | 3300005355 | Switchgrass Rhizosphere | MDFIEQLFGFAPDGGNGLFELLLFVIPIAGLVALAARRKLRSAIKRRR* |
| Ga0070673_1013907021 | 3300005364 | Switchgrass Rhizosphere | ERIFGIAPDGGSGSLEVLLFLVPLAGIAWLALRARARSRRRD* |
| Ga0070659_1020081752 | 3300005366 | Corn Rhizosphere | MDFIEHLFGIAPDNGSGALEFLLFALPLAGIAWLVLRKRKAVKSRDE* |
| Ga0070708_1005627992 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFIERVFGISPDGGSGAFEFLLFLVPIAGIAWLYVKRHRDRNAKH* |
| Ga0070708_1008289272 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFIERLFGIAPDGGDGTLEFWLFAIPIAGICYLALRRRQSRQRKKRDE* |
| Ga0070663_1018737921 | 3300005455 | Corn Rhizosphere | MDFIERIFGFSPDGGNGTFEMLLFLIPIAGIAYFIVKRRQRKP* |
| Ga0070678_1008850831 | 3300005456 | Miscanthus Rhizosphere | MNFIETLFGFSPDGGSGAFEILLFLIPMAGVAFLAIRRALKRRR* |
| Ga0070699_1013851262 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFIEKIFGFSPDGGDGSFEFLLFLIPISLIVVIALMRRRRKAQRRDRKAD* |
| Ga0070741_101689722 | 3300005529 | Surface Soil | MDFIERIFGFAPDGGSGSLEFLLFAIPVIVLCVLQTMRVARRKRKS* |
| Ga0070734_108052552 | 3300005533 | Surface Soil | MDFIERIFGIAPDGGSGVLEACLILIPLGIAVLLYTRRKQTL* |
| Ga0070672_1000045381 | 3300005543 | Miscanthus Rhizosphere | ATRRGEVTMDFIERIFGIAPDGGSGSLEFLLFAIPIAGIAYLAFRRRRRKDRDKD* |
| Ga0070665_1014377781 | 3300005548 | Switchgrass Rhizosphere | IFGLSPDGGSGSFELLLFLIPIAGIAYLIVRRRRRR* |
| Ga0066661_109477822 | 3300005554 | Soil | MDFIERIFGISPDGGSGSFEAMLIALPVLAVVLYFLIRRRNRAIGD* |
| Ga0066694_105783522 | 3300005574 | Soil | MDFIVRLFGFAPDGGNGMFELLLFAIPITGLVILAAWRRKRNAKR* |
| Ga0066905_1022589892 | 3300005713 | Tropical Forest Soil | MDFIEKIFGVAPDGGSGALEFLLIALPIAGICYLVLRRRFGNKA* |
| Ga0066903_1038141862 | 3300005764 | Tropical Forest Soil | MDFIEKLFGIAPDGGSGAFELLLFVIPVAGLCYLTLRRRFRGKT* |
| Ga0068863_1009627222 | 3300005841 | Switchgrass Rhizosphere | MDFIERLFGFAPDGGNGMFELLLFAIPIAGLAIIAAWRRK |
| Ga0081539_100400073 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MDFIERLFGIAPDGGSGSLEFLLFALPIAGICYLVVKRRQSRRK* |
| Ga0066651_103024582 | 3300006031 | Soil | MDFIERIFGFSPDDGSGAFEVMLFAAPILILALLAARYRMRRQRNQVRKR* |
| Ga0075417_104873981 | 3300006049 | Populus Rhizosphere | MDFIEGIFGISPDGGSGSFEALLFLIPTAGVLFIALLRRLGSRRT* |
| Ga0075028_1000068577 | 3300006050 | Watersheds | MDFIERLFGFSPDGGDGSFEILLFAIPLAGLALLLYWRTISRRRQP* |
| Ga0075028_1004283682 | 3300006050 | Watersheds | VDFIETIFGVAPDVGSGMLEALLFAIPIAGSSYLLVRRWWRRR* |
| Ga0079222_122556791 | 3300006755 | Agricultural Soil | MDFIERLFGFSPDGGSGALEFLLFAIPIAGICYLILRRRIG |
| Ga0066665_106287152 | 3300006796 | Soil | MDFIERIFGIAPDGGSGSLELLLFVLPMAGIIYLVLRRRQRAKRKD* |
| Ga0075425_1000444503 | 3300006854 | Populus Rhizosphere | MNYVEQLFGFAPDGGSGSLEFLLLLVPLVGIGLLRLRDLARLRRTSRR* |
| Ga0075425_1002829184 | 3300006854 | Populus Rhizosphere | MDFIERLFGFAPDGGNGMFELLLFAIPIAGIVILAAWRRKRNAKR* |
| Ga0073934_100085134 | 3300006865 | Hot Spring Sediment | MDFIERIFGISPDGGSGSFEFLLLTIPIIVIAYRIARRQRRRKQIARGA* |
| Ga0075524_105396692 | 3300006950 | Arctic Peat Soil | MDFIERIFGIALDGGNGILELLLFAIPIAGTLALMARRRRRNVK |
| Ga0079219_108877232 | 3300006954 | Agricultural Soil | MDFIERIFGFAPDGGNGMFELLLFVIPIAGIIVLWRRKKRSTRD* |
| Ga0099795_101429682 | 3300007788 | Vadose Zone Soil | MDFIERLFGIAPDGGSGALEFLLIAIPIAGLCYLTLRRRVGGKRVGGKR* |
| Ga0099829_105604521 | 3300009038 | Vadose Zone Soil | TKMDFIEKIFGIAPDGGSGALEFLLFAIPIAGIAFLLTKKKPWHVCDERRL* |
| Ga0111539_103691462 | 3300009094 | Populus Rhizosphere | AATRRGEVTMDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRRRKDRDKD* |
| Ga0115027_114019802 | 3300009131 | Wetland | MDFIEKIFGISPDGGSGAFEVLLFALPIAGIAFLLARRKRWFVRDKRKP* |
| Ga0105092_103714063 | 3300009157 | Freshwater Sediment | MHFIKKLFGIAPDGGSGALEFLLFAIPIAGICYLALRRPWHRKP* |
| Ga0105104_100069707 | 3300009168 | Freshwater Sediment | MDFIEKLFGIAPDGGSGALEFLLFAIPIAGICYLALRRPWHRKP* |
| Ga0105242_115792591 | 3300009176 | Miscanthus Rhizosphere | MDFIERIFGFAPDGGNGTLEMLLFLIPIAGTASLVMKRRQRKP* |
| Ga0105238_124462681 | 3300009551 | Corn Rhizosphere | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRRRK |
| Ga0105259_11001832 | 3300009597 | Soil | MDFIERIFGVSPDGGSGSLEFLLFAVPVCGLIYLSVRRRSRKQRPL* |
| Ga0126305_107145171 | 3300010036 | Serpentine Soil | MDFIERLLSISPDGGSGALEFALFAIPVCGIAVLAAARWARGQTRV |
| Ga0126376_120564621 | 3300010359 | Tropical Forest Soil | MDFIERIFGITPDGGNGMFEFLLFLIPIAGLIVLWRRRKRPSDPR* |
| Ga0126372_112114052 | 3300010360 | Tropical Forest Soil | MDFIEKIFGISPDGGSGSFEFLLFAVPIVGIAVLALRNRRRNKDRD* |
| Ga0126372_112974621 | 3300010360 | Tropical Forest Soil | MDFIERLFGFAPDGGSGALEVLLFAAPITVLCYLALRRGQRQRHGR* |
| Ga0126378_122454791 | 3300010361 | Tropical Forest Soil | MDFIEKLFGVAPDGGSGVLEFLLFVIPIAGISYFALRRRTGRKN* |
| Ga0126379_104678441 | 3300010366 | Tropical Forest Soil | MDFIEKLFGISPDGGSGSFEFLLFAVPIVGIAFLALRNRRRNKDRD* |
| Ga0126379_108349382 | 3300010366 | Tropical Forest Soil | MDFIERIFGFVPDGGDGTLEFLLFALPIAGIAYFIVRRR |
| Ga0134125_113509052 | 3300010371 | Terrestrial Soil | MNFVERIFGLTPDGNSGSFELLLLALPLAGILYLAGRRRSGATRKR* |
| Ga0134124_100076732 | 3300010397 | Terrestrial Soil | MTQTWRNKAMDFIEKIFGISPDGGSGLFEFLLFAIPIAGIAYLLARNGRRRARHKRNP* |
| Ga0137363_107504471 | 3300012202 | Vadose Zone Soil | MDFIERLFGFAPDGGNGSLELLLFAIPIVGLAILYVARRQRRRKTV* |
| Ga0137376_100378185 | 3300012208 | Vadose Zone Soil | MDFIERIFGFSPYDGSGAFEVMLFSVPILILALLAARYRMRRQRNPVRKR* |
| Ga0150985_1016349441 | 3300012212 | Avena Fatua Rhizosphere | MDFIERLFGFAPDGGNGMFELLLFAIPIAGIVILAAWHRKRNTKRSGS* |
| Ga0150985_1035308192 | 3300012212 | Avena Fatua Rhizosphere | LPISEVRMDFIERIFGIALDNGSGSLEFLLFVVPLAGIACLTFASRRRRSL* |
| Ga0150985_1116303071 | 3300012212 | Avena Fatua Rhizosphere | MDFIEKLFGIAPDAGSGALEFLLIAIPVAGIGYLALRRRFHRKG* |
| Ga0150985_1147560602 | 3300012212 | Avena Fatua Rhizosphere | MDFIEKIFGISPDGGSGALEFLLIAIPIAGICYLAFRRSSQTKDKR* |
| Ga0150985_1231982301 | 3300012212 | Avena Fatua Rhizosphere | FIERIFGIAPDGGSGAFELLLFAIPVAGLCFLAWRRRTRRHDP* |
| Ga0137370_108216141 | 3300012285 | Vadose Zone Soil | TWSNNVDFIERIFGFAPDGGSGSLEFLLFVIPLAGIAYLAFRTRQRMQRKR* |
| Ga0137384_109303221 | 3300012357 | Vadose Zone Soil | MDFIERIFGISPDGGSGLLELLLLLIPLLGVIGLYYVRRHVRRRTKYHF* |
| Ga0150984_1017688181 | 3300012469 | Avena Fatua Rhizosphere | MDFIERIFGFAPDGGSGSLEALLFAIPIAGICYGVLRHYLRGQRKR* |
| Ga0150984_1031132181 | 3300012469 | Avena Fatua Rhizosphere | MDFIEKIFGVAPDGGSGALEFLLIAIPIAGICYLVLR |
| Ga0150984_1113412311 | 3300012469 | Avena Fatua Rhizosphere | MHFIEQIFAVAPDGGSGSLEFLLLAVPLVGIAYLALRGRQRRSR* |
| Ga0137395_106852101 | 3300012917 | Vadose Zone Soil | MDFVERIFGISPDGGSGSFEFMLLAIPIACLYLLYRMRSTARKER |
| Ga0137413_106105702 | 3300012924 | Vadose Zone Soil | MDFIERIFGFSPDGGSGAFELLLLAVPIIVLCYLALRRRQRQRERH* |
| Ga0126375_108907751 | 3300012948 | Tropical Forest Soil | MDFIEKIFGVAPDGGSGALEFLLIALPIAVICYWALRRRFGNKA* |
| Ga0164306_114991482 | 3300012988 | Soil | MDFIERIFGISLDNGSGSLEFLLFIVPLAGIACLTFASRRRRSL* |
| Ga0157374_108777101 | 3300013296 | Miscanthus Rhizosphere | RIFGIAPDGGSGSLEVLLFLGPLAGLAWLALRARARSRRRD* |
| Ga0157378_100667181 | 3300013297 | Miscanthus Rhizosphere | MDFIERIFGFAPDGGSGAFEFILFLVPLVGVCYLALVRMRRAARREVDRKA |
| Ga0157378_130754871 | 3300013297 | Miscanthus Rhizosphere | MDFIEKIFGIAPDGGDGSFELLLFLIPLTLIVLVAVVRRRRTQRARKKT* |
| Ga0163162_106992742 | 3300013306 | Switchgrass Rhizosphere | MDFIERIFGIAPDGGDGSLEFLLFVLPIAGLWWLATRRRRRNRDRR* |
| Ga0157380_105695641 | 3300014326 | Switchgrass Rhizosphere | MDFIERIFGFAPDGGSGAFEFILFLVPLVGVCYLALVRMRRAARR |
| Ga0182021_111539061 | 3300014502 | Fen | MDFIERIFGFAPDGGSGTWEMLLFALPIAGLCYLAWRRRGPDRDPD* |
| Ga0157376_121836352 | 3300014969 | Miscanthus Rhizosphere | IERIFGIAPDGGSGSLEVLLFLVPLAGIAWLALRARARSRRRD* |
| Ga0132258_102005494 | 3300015371 | Arabidopsis Rhizosphere | MDFIERLFGFAPDGGNGMFELLLFAIPIAGIVFLAAWRRKRNAKR* |
| Ga0132258_105098462 | 3300015371 | Arabidopsis Rhizosphere | MDFIERIFGISPDGGSGTFEFLLFALPMAGIIYLLLRRRQRAKRNDQTRGE* |
| Ga0132258_111661722 | 3300015371 | Arabidopsis Rhizosphere | ATRRGEVTMDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRRRKDRDKD* |
| Ga0132258_123341202 | 3300015371 | Arabidopsis Rhizosphere | MDFIERIFGFSPDGGSGAFEVLLFALPIVGLIYLAQRRRRQRTKSKD* |
| Ga0132258_127644311 | 3300015371 | Arabidopsis Rhizosphere | MDFIEKIFGFSPDGGSGAFEFLLFAIPIAGICYLVLRRRARRGRKP* |
| Ga0132258_128405902 | 3300015371 | Arabidopsis Rhizosphere | MDFIERVFGIAPDGGDGSPEFLLFALPLAGLCWLAVRRRRGRGDRERR* |
| Ga0132258_134400862 | 3300015371 | Arabidopsis Rhizosphere | MDFIEQIFGFAPDGGNGVFELLLFIVPVAGIITLALRRRKRAAERRKV* |
| Ga0132258_135315162 | 3300015371 | Arabidopsis Rhizosphere | MDFIEQIFGMAPDGGNGTLELLRFLIPIAGIAYLIMKRRQRKP* |
| Ga0132256_1001505992 | 3300015372 | Arabidopsis Rhizosphere | MDFIERIFGFSPDGGSGAFELLLFAIPVAGLLYLWAWKRSTRK* |
| Ga0132256_1002498401 | 3300015372 | Arabidopsis Rhizosphere | RIFGIAPDGGSGSLEFLLFAIPVCGIAVLALWRRARRQPDSGRT* |
| Ga0132256_1032790812 | 3300015372 | Arabidopsis Rhizosphere | GRQAMDFIERVFGIAPDGGDGSPEFLLFALPLAGLCWLAVRRRRGRGDRERR* |
| Ga0132255_1013694212 | 3300015374 | Arabidopsis Rhizosphere | MDFIERLFGFAPDGGNGMFELLLFAIPIAGIVLLAAWRRKRNAKR* |
| Ga0182041_113493471 | 3300016294 | Soil | MDFIERLFGFAPDGGSGALEMLLFAAPITVLCYLAVRRRQRQPNAR |
| Ga0182037_105775042 | 3300016404 | Soil | MDFIERIFGLSPDGGSGSLEFLILATALGGLYLVYRTWVRRPTK |
| Ga0182038_112295022 | 3300016445 | Soil | MRLTGWQLIKVGRVLMDFIEKLFGVAPDGGSGALEFLLFAIPIAGVCYLALRRRVGGKK |
| Ga0187775_104392042 | 3300017939 | Tropical Peatland | FLEKLFGFAPDGGSGSFELLLFAIPIAGICYLVLRRRLRRHRRD |
| Ga0184604_101701922 | 3300018000 | Groundwater Sediment | MDFIERIFGIAPDGGSGSLEVLLFTIPIAGVAYLLLRRRRRDK |
| Ga0184629_100972242 | 3300018084 | Groundwater Sediment | MDFIEKIFGIAPDGGSGALEVLLFLIPVVGILILVQRRRRNRR |
| Ga0190265_119152161 | 3300018422 | Soil | MDFIERIFGIAPDGGSGSLELLLFVVPVLGAAAALAVRRRVRRRPRK |
| Ga0066669_105184713 | 3300018482 | Grasslands Soil | MDFIERIFGTAPDHGDGSLELLLFLVPLALIATFALRHARQQRRG |
| Ga0184648_10027561 | 3300019249 | Groundwater Sediment | EDKQMDFIEKLLGFAPDGGSGSFEFLLFALPIAGIAFLIVRKRTRDKRKP |
| Ga0193751_100185911 | 3300019888 | Soil | MDFIERIFGFSPDGGSGSFEFLLFALPIAGVIYLVRRCRTRAKRTP |
| Ga0193751_10326022 | 3300019888 | Soil | MDFIERLFGLSPDGGSGSLEFLLFAIPIAGIAYLTIRRSSNRRRNS |
| Ga0194062_10550812 | 3300021069 | Anoxic Zone Freshwater | MDFIEKIFGVSPDGGSGSFEFLLFAIPIIAIVVIWALRNRSRRK |
| Ga0210400_103946801 | 3300021170 | Soil | MDFIERIFGISPDGGSGVFEVLLFGIPIIGLYLLYRSRSRSHTRKR |
| Ga0193750_10194093 | 3300021413 | Soil | MDFIERIFGFSPDGGSGSFEFLLFALPIAGVIYLVRRRRTRAKRTP |
| Ga0242653_10985032 | 3300022712 | Soil | MDFIERLFDISPDGGSGSLELLLFAIPIIGLAILYAARRHRRKLR |
| Ga0242654_104373381 | 3300022726 | Soil | MDFIERLFGVAPDGGSGALEFLLFAIPIAGVCYLALRRRIGGKNRTSREP |
| Ga0222622_100076913 | 3300022756 | Groundwater Sediment | MNFIETLFGFSPDGGSGAFEILLFLIPMAGVAFLAIRRALKRRR |
| Ga0247677_10127682 | 3300024245 | Soil | MDFIERIFGIVPDGGSGSLEVLLFLVPLAGIACLALRARAQRRRRK |
| Ga0247681_10240612 | 3300024310 | Soil | MDFIERIFGIVPDGGSGSLEVLLFLVPLAGIACVALRARAQRRRRK |
| Ga0209172_100636152 | 3300025310 | Hot Spring Sediment | MDFIERIFGISPDGGSGSFEFLLLTIPIIVIAYRIARRQRRRKQIARGA |
| Ga0207697_100317762 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRRRKDRDKD |
| Ga0210132_10185462 | 3300025538 | Natural And Restored Wetlands | RIFGISPDGGSGMFEVLLFAVPIAGICYYMLRRRSKKPLQ |
| Ga0210132_10228312 | 3300025538 | Natural And Restored Wetlands | MDFIERIFGFSPDGGSGLFEVLLFALPLAGICYLVLKRRSRKPFR |
| Ga0210094_10079381 | 3300025549 | Natural And Restored Wetlands | FSPDGGSGLFEVLLFALPLAGICYLVLKRRSRKPFR |
| Ga0210094_10457202 | 3300025549 | Natural And Restored Wetlands | MDFIERIFGISPDGGSGMFEVLLFAVPIAGICYYMLRRRSKKPLQ |
| Ga0207642_100174413 | 3300025899 | Miscanthus Rhizosphere | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIAYLAFRRRRRKDRDKD |
| Ga0207649_103725691 | 3300025920 | Corn Rhizosphere | MDFIERIFGIAPDGGSGSLEFLLFAIPIAGIVYLAYRRRR |
| Ga0207646_115815342 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LFGIAPDGGDGTLEFWLFAIPIAGICYLALRRRQSRQRKKRDE |
| Ga0207650_118647781 | 3300025925 | Switchgrass Rhizosphere | MDFIEQIFGFAPDGGNGLFEFLLFAIPIAGLVALAAARRLRSGSKRKR |
| Ga0207658_113555821 | 3300025986 | Switchgrass Rhizosphere | MDFIERLLSISPDGGSGSLEFALFAIPICGIAILAAVRRRRAQ |
| Ga0207678_108786642 | 3300026067 | Corn Rhizosphere | MDFIERIFGFSPDGGNGTFEMLLFLIPIAGIAYFIVKRRQRKP |
| Ga0209648_102706402 | 3300026551 | Grasslands Soil | MDFIERLFGFAPDGGSGALEMLLIAAPITVLCYFALRRGQRQRHGQ |
| Ga0208685_10355792 | 3300027513 | Soil | MDFIERIFGVSPDGGSGSLEFLLFAVPVCGLIYLSVRRRSRKQRPL |
| Ga0209593_102741811 | 3300027743 | Freshwater Sediment | MDFIEKLFGIAPDGGSGALEFLLFAIPIAGICYLALRRPWHRKP |
| Ga0209656_100347694 | 3300027812 | Bog Forest Soil | MDFIETIFGIAPDGDSGVLELLLLAIPVAGICYLLVRRWRRHG |
| Ga0209060_105271871 | 3300027826 | Surface Soil | MDFIERIFGIAPDGGSGVLEACLILIPLGIAVLLYTRRKQTL |
| Ga0209515_100069024 | 3300027835 | Groundwater | MDFIEKLFGIAPDGGDGTLEFWLFAIPIAGICYLALRRRQSRQRKKRDE |
| Ga0209798_100880592 | 3300027843 | Wetland Sediment | MDFIERIFGFSPDGGSGAFEVLLFLIPLAGILILYRRRKRAGRREEPRR |
| Ga0209180_107397121 | 3300027846 | Vadose Zone Soil | TKMDFIEKIFGIAPDGGSGALEFLLFAIPIAGIAFLLTKKKPWHVCDERRL |
| Ga0209813_101707851 | 3300027866 | Populus Endosphere | MDFIERLFGIAPDGGDGTLEFWLFAIPIAGICYLALRRRQSRQRKKRDE |
| Ga0209397_103860411 | 3300027871 | Wetland | MDFIEKIFGISPDGGSGAFEVLLFALPIAGIAFLLARRKRWFVRDKRKP |
| Ga0209481_105477582 | 3300027880 | Populus Rhizosphere | MDFIEKIFGVAPDGGSGALEFLLIAIPIAGICYLVLRRRFGNKA |
| Ga0209068_101764464 | 3300027894 | Watersheds | MDFIERLFGFSPDGGDGSFEILLFAIPLAGLALLLYWRTISRRRQP |
| Ga0209048_100111505 | 3300027902 | Freshwater Lake Sediment | MDFIEKIFGFAPDGGSGSFELLLFAIPIAGICYIVLRRHLRKQRKD |
| Ga0209048_101099702 | 3300027902 | Freshwater Lake Sediment | MDFIEKIFGLAPDGGSGSFELLLFAVPIAGICYLVLRRHLRRQRRD |
| Ga0209488_106038872 | 3300027903 | Vadose Zone Soil | MDFIERLFGIAPDGGSGALEFLLIAIPIAGLCYLTLRRRVGGKRVGGKR |
| Ga0247675_10625451 | 3300028072 | Soil | DFIERIFGVAPDGGDGSLELLLFLVPLALIAALALHRARRRG |
| Ga0268266_100802993 | 3300028379 | Switchgrass Rhizosphere | VDFIERLLSISPDGGSGSLEFALFAIPICGIAILAAVRRRRAQTRAR |
| Ga0247827_109262261 | 3300028889 | Soil | MDFIEQIFGMAPDGGNGTLELLLFLIPIAGIAYLVMKRRQR |
| Ga0311332_115685871 | 3300029984 | Fen | MDFIERIFGFSPDGGSGSFEFLLFAIPIAGICYLVLRRRARKERKSKN |
| Ga0311350_111237252 | 3300030002 | Fen | MDFIERIFGFAPDGGSGTWEMLLFALPIAGLCYLAWRRRGPDRDRD |
| Ga0302299_104401481 | 3300030010 | Fen | MDFIEQIFGFSPDGGDGSFEFLLFAIPIAGLCWLAWRRRQKRLQRPLDDR |
| Ga0311333_109315881 | 3300030114 | Fen | IERIFGFAPDGGSGTWEMLLFALPIAGLCYLAWRRRGPDRDPD |
| Ga0311349_121352251 | 3300030294 | Fen | MDFIERIFGFAPDGGSGTWEMLLFALPIAGLCYLAWRRRGPDRDPD |
| Ga0268240_101870842 | 3300030496 | Soil | MDFIERIFGFAPDGGNGMFELLLFAIPIAGIIVLWRKRKRSTRN |
| Ga0308197_100315003 | 3300031093 | Soil | VKVGGLAMDFIEKIFGVAPDGGSGALEFLLIAIPIAGICYLVLRRRFGNKA |
| Ga0302323_1025398011 | 3300031232 | Fen | TETTMDFIERVFGFAPDGGDGSFEYLLFAIPIAGIAYLVWHRRRTKK |
| Ga0311364_109626292 | 3300031521 | Fen | MDFIEQIFGFSPDGGDGSFEFLLFAIPIAGLCWLGWRRRQKRLQRPHDDR |
| Ga0318534_102076691 | 3300031544 | Soil | MDFIERIFGIAPDGGSGTLEGLLFLIPLVGIYLIYRARKHSRDRRDP |
| Ga0307408_1007875682 | 3300031548 | Rhizosphere | MDFIERWFGIAPDGGSGLLELLILVTLFIAGGLIVRRRRSSARRDR |
| Ga0307436_10133121 | 3300031563 | Salt Marsh | MDFIEKIFSIAPDGGSGALEMLLFSVPVAGLVLLLAVRRRYSGRARCKR |
| Ga0318542_104732763 | 3300031668 | Soil | MDFIERIFGLSPDGGSGSLEFLILATALVGLYLVYRT |
| Ga0310813_104516752 | 3300031716 | Soil | MDFIERIFGFSPDGGSGTFEMLLFLIPIAGIAYFIVKRRQRKP |
| Ga0302321_1003677562 | 3300031726 | Fen | LDFIEQLFGFSPDGGDGSFEFLLFAIPIAGLCWLAWRRRQKKLQRTSEDR |
| Ga0302321_1007096532 | 3300031726 | Fen | MDFIEKIFGFNPDDGSGSFEFFLFAVPIAGIIYLALRRRQKMQRAKRKD |
| Ga0302321_1027641413 | 3300031726 | Fen | NPESEAVMDFIERIFGFSPDGGSGSFEFLLFAIPIAGICYLVLRRRARKERKSKN |
| Ga0318546_109062591 | 3300031771 | Soil | MEGETDMDFIERIFGIAPDGGSGTLEGLLFLIPLVGIYLIYRARKHSRDRRDP |
| Ga0318552_101722363 | 3300031782 | Soil | MDFIERIFGLSPDGGSGSLEFLILATALVGLYLVYRTW |
| (restricted) Ga0255338_10045673 | 3300031825 | Sandy Soil | MDFIERIFGFSPDGGNGMFELMLFLVPILGLLALARRRRHRRKDEDG |
| (restricted) Ga0255338_12184592 | 3300031825 | Sandy Soil | MDFIERIFGFLPDGGNGMFELMLFLVPILGLLALARWRSHRRKDEDG |
| Ga0308175_1001187032 | 3300031938 | Soil | MDFIEQIFGFAPDGGSGVFEFLLFAIPIAGLAALAAARRLRPGSKRKR |
| Ga0308175_1002434954 | 3300031938 | Soil | MDFIERIFGFAPDGGNGMYELLLFIIPVLGLIALARRRSSRRKQVDK |
| Ga0308175_1027378572 | 3300031938 | Soil | MDFIERLFGIAPDGGSGAFEFLILALPVAGIVFWAYTQRRRRQRSR |
| Ga0310916_115400471 | 3300031942 | Soil | ERIFGIAPDGGSGTLEGLLFLIPLVGIYLIYRARKHSRDRRDP |
| Ga0306922_112784342 | 3300032001 | Soil | MDFIEQLFGVSPDGGNGIFELLLFALPIAGIVTLFA |
| Ga0306924_108274623 | 3300032076 | Soil | FIERIFGIAPDGGSGTLEGLLFLIPLVGIYLIYRARKHSRDRRDP |
| Ga0318525_106566831 | 3300032089 | Soil | LMEGETDMDFIERIFGIAPDGGSGTLEGLLFLIPLVGIYLIYRARKHSRDRRDP |
| Ga0315268_102239683 | 3300032173 | Sediment | MDFIEKIFGIAPDGGSGSFEFLLFALPIVGIAFLPAKRKRWFVRDKRKP |
| Ga0315271_101846143 | 3300032256 | Sediment | MDFIEKIFGIAPDGGSGSFEFLLFALPIVGIAFLLAKRKRWFVRDKRKP |
| Ga0306920_1014918782 | 3300032261 | Soil | MDFIEKLFGVAPDGGSGALEFLLFAIPIAGVCYLALRRRVGGKK |
| Ga0335070_100885081 | 3300032829 | Soil | PYALLRTSTAREISMDFIERIFGIAPDGGSGALEFLLFAIPIAGVILLLAKRARWRQREK |
| Ga0335084_100274003 | 3300033004 | Soil | MDFIEKIFGIAPDGGSGAFEFLLFAIPIAGIAFLLAKKKRRFVRGKRKL |
| Ga0316605_123384691 | 3300033408 | Soil | FIEKIFGISPDGGSGAFEVLLFALPIAGIAFLLARRKRWFVRDKRKP |
| Ga0326726_105020832 | 3300033433 | Peat Soil | MDFIERLFGFSPDGGNGMFEFLLFAVPIAGIVMLAAWRRKKAPTRRKP |
| Ga0310811_102192972 | 3300033475 | Soil | MDFIEHLFGIAPDNGSGALEFLLFALPLAGIAWLVLRKRKAVKNRDE |
| Ga0316620_103291552 | 3300033480 | Soil | MDFIERIFGIALDGGNGNLELLLFAIPIAGTLVFMARRRRRNVKRPAT |
| Ga0316620_107784992 | 3300033480 | Soil | MDFIERIFGFAPDGGSGSLELLLFALPIAGLCYLAWRRRRHNRDPD |
| Ga0316620_120333952 | 3300033480 | Soil | MDFIERIFGIAPDGGSGSLELLLFAIPIAGICYLLLRRRS |
| Ga0316621_112386502 | 3300033488 | Soil | MDFIEKIFGIAPDGGSGAFEVLLFALPIAGIAFLLAKRKRWFVR |
| Ga0316628_1039447761 | 3300033513 | Soil | MDFIERIFGISPDGGSGVFEALLFLIPLAGLYLLHRMRSHKRKR |
| Ga0316617_1002669752 | 3300033557 | Soil | MDFIEKIFGIAPDGGSGAFEVLLFALPIAGIAFLLAKRKRWFVRDKRKP |
| Ga0372946_0146588_531_671 | 3300034384 | Soil | MDFIERIFGFSPDGGSGTFEFLLFAIPIAGIAYLVIRRRQRGRRQP |
| Ga0373948_0081670_433_579 | 3300034817 | Rhizosphere Soil | MDFIEQIFGFAPDGGNGVFELLLFIVPVAGIITLALRRRKRAAERRKV |
| ⦗Top⦘ |