


| Basic Information | |
|---|---|
| Family ID | F026283 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 198 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYN |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 198 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.75 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.30 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (43.434 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (75.252 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.404 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.63% Coil/Unstructured: 85.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 198 Family Scaffolds |
|---|---|---|
| PF13759 | 2OG-FeII_Oxy_5 | 6.57 |
| PF16778 | Phage_tail_APC | 5.56 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.03 |
| PF00622 | SPRY | 1.01 |
| PF08007 | JmjC_2 | 0.51 |
| PF07460 | NUMOD3 | 0.51 |
| PF05203 | Hom_end_hint | 0.51 |
| PF02195 | ParBc | 0.51 |
| PF01075 | Glyco_transf_9 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.15 % |
| Unclassified | root | N/A | 34.34 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10104883 | Not Available | 1161 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10095852 | Not Available | 985 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10008339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5523 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10034615 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10051097 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10128007 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10169559 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300001934|GOS2267_102667 | Not Available | 1654 | Open in IMG/M |
| 3300001963|GOS2229_1010533 | unclassified Hyphomonas → Hyphomonas sp. | 1761 | Open in IMG/M |
| 3300006026|Ga0075478_10034446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1683 | Open in IMG/M |
| 3300006026|Ga0075478_10058386 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
| 3300006026|Ga0075478_10103937 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006027|Ga0075462_10003142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5377 | Open in IMG/M |
| 3300006027|Ga0075462_10033252 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300006027|Ga0075462_10081062 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300006357|Ga0075502_1016205 | Not Available | 1073 | Open in IMG/M |
| 3300006357|Ga0075502_1703693 | Not Available | 639 | Open in IMG/M |
| 3300006403|Ga0075514_1185849 | Not Available | 1067 | Open in IMG/M |
| 3300006637|Ga0075461_10027280 | All Organisms → Viruses → Predicted Viral | 1882 | Open in IMG/M |
| 3300006802|Ga0070749_10161962 | Not Available | 1296 | Open in IMG/M |
| 3300006802|Ga0070749_10576933 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006810|Ga0070754_10102185 | Not Available | 1415 | Open in IMG/M |
| 3300006810|Ga0070754_10143304 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300006810|Ga0070754_10208371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 908 | Open in IMG/M |
| 3300006810|Ga0070754_10308305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 709 | Open in IMG/M |
| 3300006810|Ga0070754_10417288 | Not Available | 585 | Open in IMG/M |
| 3300006810|Ga0070754_10473277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 541 | Open in IMG/M |
| 3300006867|Ga0075476_10336964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 523 | Open in IMG/M |
| 3300006868|Ga0075481_10024771 | All Organisms → Viruses → Predicted Viral | 2352 | Open in IMG/M |
| 3300006869|Ga0075477_10439997 | Not Available | 503 | Open in IMG/M |
| 3300006916|Ga0070750_10003020 | All Organisms → cellular organisms → Bacteria | 9364 | Open in IMG/M |
| 3300006916|Ga0070750_10186675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 924 | Open in IMG/M |
| 3300006919|Ga0070746_10003253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9719 | Open in IMG/M |
| 3300006919|Ga0070746_10004549 | All Organisms → cellular organisms → Bacteria | 8165 | Open in IMG/M |
| 3300006919|Ga0070746_10031311 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2861 | Open in IMG/M |
| 3300006919|Ga0070746_10383890 | Not Available | 632 | Open in IMG/M |
| 3300006919|Ga0070746_10464144 | Not Available | 561 | Open in IMG/M |
| 3300007234|Ga0075460_10023076 | All Organisms → Viruses → Predicted Viral | 2434 | Open in IMG/M |
| 3300007234|Ga0075460_10100259 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300007236|Ga0075463_10010460 | Not Available | 3092 | Open in IMG/M |
| 3300007236|Ga0075463_10257615 | Not Available | 560 | Open in IMG/M |
| 3300007276|Ga0070747_1234547 | Not Available | 640 | Open in IMG/M |
| 3300007344|Ga0070745_1142783 | Not Available | 911 | Open in IMG/M |
| 3300007344|Ga0070745_1181492 | Not Available | 785 | Open in IMG/M |
| 3300007344|Ga0070745_1304300 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda | 567 | Open in IMG/M |
| 3300007345|Ga0070752_1060366 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300007346|Ga0070753_1363363 | Not Available | 508 | Open in IMG/M |
| 3300007538|Ga0099851_1083351 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300007539|Ga0099849_1022670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 2727 | Open in IMG/M |
| 3300007539|Ga0099849_1046045 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300007539|Ga0099849_1272121 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda | 617 | Open in IMG/M |
| 3300007539|Ga0099849_1310257 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300007539|Ga0099849_1364302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 512 | Open in IMG/M |
| 3300007541|Ga0099848_1009587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage Venkman EXVC282S | 4300 | Open in IMG/M |
| 3300007541|Ga0099848_1099786 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300007542|Ga0099846_1154595 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300007542|Ga0099846_1341469 | Not Available | 508 | Open in IMG/M |
| 3300007640|Ga0070751_1145686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 950 | Open in IMG/M |
| 3300007640|Ga0070751_1386053 | All Organisms → Viruses | 506 | Open in IMG/M |
| 3300008012|Ga0075480_10023197 | Not Available | 3799 | Open in IMG/M |
| 3300008012|Ga0075480_10158616 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300008012|Ga0075480_10188906 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300008012|Ga0075480_10350302 | Not Available | 738 | Open in IMG/M |
| 3300009001|Ga0102963_1046727 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300009001|Ga0102963_1196194 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300009027|Ga0102957_1411458 | Not Available | 507 | Open in IMG/M |
| 3300010296|Ga0129348_1034531 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300010296|Ga0129348_1052848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1463 | Open in IMG/M |
| 3300010297|Ga0129345_1036361 | Not Available | 1909 | Open in IMG/M |
| 3300010297|Ga0129345_1169459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 783 | Open in IMG/M |
| 3300010299|Ga0129342_1040156 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300010299|Ga0129342_1271079 | Not Available | 588 | Open in IMG/M |
| 3300010299|Ga0129342_1303802 | Not Available | 548 | Open in IMG/M |
| 3300010300|Ga0129351_1179666 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010300|Ga0129351_1322548 | All Organisms → Viruses | 582 | Open in IMG/M |
| 3300010316|Ga0136655_1063647 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300010318|Ga0136656_1029242 | Not Available | 1998 | Open in IMG/M |
| 3300010368|Ga0129324_10046197 | All Organisms → Viruses → Predicted Viral | 2006 | Open in IMG/M |
| 3300010368|Ga0129324_10083222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda | 1403 | Open in IMG/M |
| 3300010368|Ga0129324_10206233 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010370|Ga0129336_10044292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 2668 | Open in IMG/M |
| 3300017697|Ga0180120_10036088 | Not Available | 2266 | Open in IMG/M |
| 3300017697|Ga0180120_10088004 | Not Available | 1361 | Open in IMG/M |
| 3300017697|Ga0180120_10304972 | Not Available | 637 | Open in IMG/M |
| 3300017697|Ga0180120_10332841 | Not Available | 603 | Open in IMG/M |
| 3300019711|Ga0193993_1019970 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300019751|Ga0194029_1033475 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300019756|Ga0194023_1012137 | Not Available | 1730 | Open in IMG/M |
| 3300021373|Ga0213865_10506581 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300021389|Ga0213868_10246296 | All Organisms → Viruses | 1047 | Open in IMG/M |
| 3300021958|Ga0222718_10055172 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300021958|Ga0222718_10407920 | Not Available | 677 | Open in IMG/M |
| 3300021959|Ga0222716_10295877 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda | 979 | Open in IMG/M |
| 3300021959|Ga0222716_10550824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 639 | Open in IMG/M |
| 3300021960|Ga0222715_10348551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 825 | Open in IMG/M |
| 3300021961|Ga0222714_10376609 | Not Available | 756 | Open in IMG/M |
| 3300021964|Ga0222719_10122348 | Not Available | 1871 | Open in IMG/M |
| 3300022050|Ga0196883_1002532 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300022050|Ga0196883_1009960 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300022050|Ga0196883_1021038 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300022050|Ga0196883_1026128 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300022053|Ga0212030_1018328 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300022057|Ga0212025_1006177 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300022057|Ga0212025_1068032 | Not Available | 615 | Open in IMG/M |
| 3300022063|Ga0212029_1025981 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300022063|Ga0212029_1056150 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300022067|Ga0196895_1025685 | Not Available | 664 | Open in IMG/M |
| 3300022068|Ga0212021_1053231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 823 | Open in IMG/M |
| 3300022068|Ga0212021_1097707 | Not Available | 603 | Open in IMG/M |
| 3300022068|Ga0212021_1108268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 569 | Open in IMG/M |
| 3300022069|Ga0212026_1052452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 616 | Open in IMG/M |
| 3300022071|Ga0212028_1104061 | Not Available | 527 | Open in IMG/M |
| 3300022159|Ga0196893_1018078 | Not Available | 643 | Open in IMG/M |
| 3300022167|Ga0212020_1009986 | Not Available | 1396 | Open in IMG/M |
| 3300022167|Ga0212020_1034599 | Not Available | 849 | Open in IMG/M |
| 3300022168|Ga0212027_1020354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 904 | Open in IMG/M |
| 3300022168|Ga0212027_1029260 | Not Available | 733 | Open in IMG/M |
| 3300022178|Ga0196887_1095469 | Not Available | 672 | Open in IMG/M |
| 3300022183|Ga0196891_1005863 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| 3300022187|Ga0196899_1022681 | Not Available | 2286 | Open in IMG/M |
| 3300022187|Ga0196899_1057015 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300022187|Ga0196899_1084416 | Not Available | 966 | Open in IMG/M |
| 3300022198|Ga0196905_1033618 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
| 3300022198|Ga0196905_1048008 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300022200|Ga0196901_1023726 | Not Available | 2445 | Open in IMG/M |
| 3300022200|Ga0196901_1034004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1976 | Open in IMG/M |
| 3300022200|Ga0196901_1052235 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300022200|Ga0196901_1062406 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300022200|Ga0196901_1255822 | Not Available | 541 | Open in IMG/M |
| 3300022200|Ga0196901_1278159 | Not Available | 510 | Open in IMG/M |
| 3300022821|Ga0222673_1015970 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300024262|Ga0210003_1228281 | Not Available | 747 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10260157 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300025543|Ga0208303_1008827 | All Organisms → cellular organisms → Bacteria | 3201 | Open in IMG/M |
| 3300025543|Ga0208303_1010751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 2840 | Open in IMG/M |
| 3300025543|Ga0208303_1013744 | All Organisms → Viruses → Predicted Viral | 2431 | Open in IMG/M |
| 3300025543|Ga0208303_1042063 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300025543|Ga0208303_1052662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 982 | Open in IMG/M |
| 3300025610|Ga0208149_1021371 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300025610|Ga0208149_1059169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 975 | Open in IMG/M |
| 3300025610|Ga0208149_1065638 | Not Available | 913 | Open in IMG/M |
| 3300025630|Ga0208004_1017727 | Not Available | 2258 | Open in IMG/M |
| 3300025630|Ga0208004_1110173 | All Organisms → Viruses | 642 | Open in IMG/M |
| 3300025646|Ga0208161_1108490 | Not Available | 753 | Open in IMG/M |
| 3300025647|Ga0208160_1030518 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300025647|Ga0208160_1044301 | Not Available | 1290 | Open in IMG/M |
| 3300025647|Ga0208160_1105571 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300025647|Ga0208160_1118104 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300025647|Ga0208160_1123038 | Not Available | 653 | Open in IMG/M |
| 3300025652|Ga0208134_1136025 | Not Available | 636 | Open in IMG/M |
| 3300025653|Ga0208428_1059783 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300025655|Ga0208795_1025273 | All Organisms → Viruses → Predicted Viral | 1920 | Open in IMG/M |
| 3300025655|Ga0208795_1034623 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300025671|Ga0208898_1000998 | Not Available | 19781 | Open in IMG/M |
| 3300025671|Ga0208898_1011430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4391 | Open in IMG/M |
| 3300025671|Ga0208898_1020174 | All Organisms → Viruses → Predicted Viral | 2964 | Open in IMG/M |
| 3300025671|Ga0208898_1035627 | All Organisms → Viruses | 1971 | Open in IMG/M |
| 3300025671|Ga0208898_1054162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1434 | Open in IMG/M |
| 3300025674|Ga0208162_1012506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 3501 | Open in IMG/M |
| 3300025674|Ga0208162_1041605 | Not Available | 1599 | Open in IMG/M |
| 3300025674|Ga0208162_1158391 | Not Available | 613 | Open in IMG/M |
| 3300025674|Ga0208162_1201216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 506 | Open in IMG/M |
| 3300025687|Ga0208019_1002607 | All Organisms → Viruses | 9032 | Open in IMG/M |
| 3300025687|Ga0208019_1045980 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300025687|Ga0208019_1062035 | Not Available | 1250 | Open in IMG/M |
| 3300025695|Ga0209653_1043535 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300025695|Ga0209653_1206544 | Not Available | 532 | Open in IMG/M |
| 3300025751|Ga0208150_1023577 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300025759|Ga0208899_1017705 | All Organisms → Viruses → Predicted Viral | 3663 | Open in IMG/M |
| 3300025759|Ga0208899_1025052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 2900 | Open in IMG/M |
| 3300025759|Ga0208899_1045450 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300025759|Ga0208899_1064429 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300025769|Ga0208767_1022808 | Not Available | 3418 | Open in IMG/M |
| 3300025769|Ga0208767_1058587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1746 | Open in IMG/M |
| 3300025769|Ga0208767_1203902 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025769|Ga0208767_1271660 | Not Available | 515 | Open in IMG/M |
| 3300025771|Ga0208427_1063508 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300025803|Ga0208425_1007395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 3118 | Open in IMG/M |
| 3300025810|Ga0208543_1029793 | All Organisms → Viruses | 1374 | Open in IMG/M |
| 3300025815|Ga0208785_1025884 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300025840|Ga0208917_1082279 | Not Available | 1206 | Open in IMG/M |
| 3300025840|Ga0208917_1171385 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025853|Ga0208645_1024314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3256 | Open in IMG/M |
| 3300025889|Ga0208644_1006813 | Not Available | 8238 | Open in IMG/M |
| 3300025889|Ga0208644_1019247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 4344 | Open in IMG/M |
| 3300025889|Ga0208644_1080721 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300025889|Ga0208644_1097152 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300025889|Ga0208644_1179241 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300025889|Ga0208644_1337776 | Not Available | 581 | Open in IMG/M |
| 3300032277|Ga0316202_10148092 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300034374|Ga0348335_009581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5463 | Open in IMG/M |
| 3300034374|Ga0348335_097811 | Not Available | 933 | Open in IMG/M |
| 3300034374|Ga0348335_161193 | Not Available | 598 | Open in IMG/M |
| 3300034375|Ga0348336_075006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1249 | Open in IMG/M |
| 3300034375|Ga0348336_119154 | All Organisms → Viruses | 848 | Open in IMG/M |
| 3300034375|Ga0348336_122319 | All Organisms → Viruses → unclassified viruses | 829 | Open in IMG/M |
| 3300034418|Ga0348337_130052 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300034418|Ga0348337_169637 | Not Available | 587 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 75.25% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.60% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.54% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.02% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.01% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.01% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.51% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.51% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.51% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.51% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300019711 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101048831 | 3300000101 | Marine | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKF |
| DelMOSum2011_100958521 | 3300000115 | Marine | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNP |
| DelMOSpr2010_100083391 | 3300000116 | Marine | MSGCNNVNLITGGSTVDDIPFYLAVQQGKVPGYSMVNKF |
| DelMOWin2010_100346154 | 3300000117 | Marine | MSCNNVNPITGGSTVDDIPFYLAIQQGKVPGYSMINK |
| DelMOWin2010_100510971 | 3300000117 | Marine | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKF |
| DelMOWin2010_101280073 | 3300000117 | Marine | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMV |
| DelMOWin2010_101695593 | 3300000117 | Marine | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYN |
| GOS2267_1026675 | 3300001934 | Marine | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTI |
| GOS2229_10105335 | 3300001963 | Marine | MSACNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNK |
| Ga0075478_100344463 | 3300006026 | Aqueous | VSCNNVNPVTGGSTVDDIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0075478_100583863 | 3300006026 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFG |
| Ga0075478_101039371 | 3300006026 | Aqueous | MSCNNVNPVTGGSTVDDIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0075462_100031429 | 3300006027 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGS |
| Ga0075462_100332521 | 3300006027 | Aqueous | MNCNNVNPVTGGSTVDNIPFYLAVQQGKVPGYSMINKFGYNPSI |
| Ga0075462_100810623 | 3300006027 | Aqueous | VSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIG |
| Ga0075502_10162052 | 3300006357 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTIGSGA |
| Ga0075502_17036934 | 3300006357 | Aqueous | MVFNAMSNCNNINPITGGSTVDDIPFYLAVQQGKVPGYSM |
| Ga0075514_11858491 | 3300006403 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0075461_100272803 | 3300006637 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0070749_101619621 | 3300006802 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNSTIGSGS |
| Ga0070749_105769331 | 3300006802 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGSG |
| Ga0070754_101021851 | 3300006810 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNPSIGSGA |
| Ga0070754_101433041 | 3300006810 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSAIG |
| Ga0070754_102083713 | 3300006810 | Aqueous | MSDCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMIN |
| Ga0070754_103083053 | 3300006810 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINK |
| Ga0070754_104172884 | 3300006810 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYN |
| Ga0070754_104732771 | 3300006810 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNP |
| Ga0075476_103369643 | 3300006867 | Aqueous | MSDCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSM |
| Ga0075481_100247714 | 3300006868 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTIGSG |
| Ga0075477_104399971 | 3300006869 | Aqueous | MVFNAMSNCNNINPITGGSTVGDIPFYLAVQQGKVPGYSMVNKFGYNPS |
| Ga0070750_100030201 | 3300006916 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNP |
| Ga0070750_101866751 | 3300006916 | Aqueous | MSDCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMINKFGYNP |
| Ga0070746_1000325314 | 3300006919 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAIQQGKVPGYSMVNKFGYNSSIGS |
| Ga0070746_1000454914 | 3300006919 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFG |
| Ga0070746_100313111 | 3300006919 | Aqueous | MSCNNINPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGS |
| Ga0070746_103838903 | 3300006919 | Aqueous | MSNCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMVNKFGYNPSIGS |
| Ga0070746_104641441 | 3300006919 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKF |
| Ga0075460_100230764 | 3300007234 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTIGS |
| Ga0075460_101002591 | 3300007234 | Aqueous | MSDCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKF |
| Ga0075463_100104601 | 3300007236 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINK |
| Ga0075463_102576153 | 3300007236 | Aqueous | MSCNNVNPVTGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNS |
| Ga0070747_12345473 | 3300007276 | Aqueous | MSNCNNINPITGGSTVGDIPFYLAVQQGKVPGYSMINKFGYNPSI |
| Ga0070745_11427832 | 3300007344 | Aqueous | MSCNNVNPIIGGSTVGNIPFYLAVQQGKVPGYSIVNKFGYNPTIGS |
| Ga0070745_11814921 | 3300007344 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMINKFGYNPTIGSGA |
| Ga0070745_13043001 | 3300007344 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGY |
| Ga0070752_10603661 | 3300007345 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMIN |
| Ga0070753_13633633 | 3300007346 | Aqueous | MSCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMINK |
| Ga0099851_10833514 | 3300007538 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0099849_10226704 | 3300007539 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSSIGSD |
| Ga0099849_10460453 | 3300007539 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYNSSIGS |
| Ga0099849_12721211 | 3300007539 | Aqueous | MSCNNINPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0099849_13102571 | 3300007539 | Aqueous | MSCNNVNPVTGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNPS |
| Ga0099849_13643021 | 3300007539 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNPSI |
| Ga0099848_10095876 | 3300007541 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSI |
| Ga0099848_10997861 | 3300007541 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYN |
| Ga0099846_11545953 | 3300007542 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGY |
| Ga0099846_13414693 | 3300007542 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNS |
| Ga0070751_11456861 | 3300007640 | Aqueous | MSDCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMINK |
| Ga0070751_13860533 | 3300007640 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKF |
| Ga0075480_100231971 | 3300008012 | Aqueous | MSDCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSM |
| Ga0075480_101586161 | 3300008012 | Aqueous | MSSCNNVNPITGGSTVGDIPFYLAIQQGKVPGYSMVNKFGYN |
| Ga0075480_101889061 | 3300008012 | Aqueous | MSCNNVNPITGGSTVGDIPFYLAIQQGKVPGYSMI |
| Ga0075480_103503023 | 3300008012 | Aqueous | MSGCNNVNLITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNS |
| Ga0102963_10467271 | 3300009001 | Pond Water | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMVNKFGYNPSIGSLAF |
| Ga0102963_11961943 | 3300009001 | Pond Water | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMVN |
| Ga0102957_14114581 | 3300009027 | Pond Water | MSGCNNVNPITGGSTVGDIPFYLAVQQGKVPGYTMVN |
| Ga0129348_10345311 | 3300010296 | Freshwater To Marine Saline Gradient | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMV |
| Ga0129348_10528484 | 3300010296 | Freshwater To Marine Saline Gradient | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMV |
| Ga0129345_10363613 | 3300010297 | Freshwater To Marine Saline Gradient | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSSIGS |
| Ga0129345_11694593 | 3300010297 | Freshwater To Marine Saline Gradient | MSCNNVNPITGRSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0129342_10401561 | 3300010299 | Freshwater To Marine Saline Gradient | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGSG |
| Ga0129342_12710791 | 3300010299 | Freshwater To Marine Saline Gradient | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKF |
| Ga0129342_13038023 | 3300010299 | Freshwater To Marine Saline Gradient | MSGCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGY |
| Ga0129351_11796663 | 3300010300 | Freshwater To Marine Saline Gradient | VSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYNSSIGS |
| Ga0129351_13225483 | 3300010300 | Freshwater To Marine Saline Gradient | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGY |
| Ga0136655_10636471 | 3300010316 | Freshwater To Marine Saline Gradient | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNS |
| Ga0136656_10292423 | 3300010318 | Freshwater To Marine Saline Gradient | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFG |
| Ga0129324_100461973 | 3300010368 | Freshwater To Marine Saline Gradient | VSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYN |
| Ga0129324_100832224 | 3300010368 | Freshwater To Marine Saline Gradient | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYN |
| Ga0129324_102062331 | 3300010368 | Freshwater To Marine Saline Gradient | MSCNNVNPITGGSTVDDIPFYLAVQQGKVSGYSMINKFGY |
| Ga0129336_100442928 | 3300010370 | Freshwater To Marine Saline Gradient | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKF |
| Ga0180120_100360881 | 3300017697 | Freshwater To Marine Saline Gradient | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0180120_100880041 | 3300017697 | Freshwater To Marine Saline Gradient | MSCNNVNPITGGSTVDDIPFYLAVQEGKVPGYSMVNKFGYNSSIG |
| Ga0180120_103049721 | 3300017697 | Freshwater To Marine Saline Gradient | MSNCNNINPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSSI |
| Ga0180120_103328411 | 3300017697 | Freshwater To Marine Saline Gradient | MSCNNVNPVTGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGS |
| Ga0193993_10199701 | 3300019711 | Sediment | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTIGSGS |
| Ga0194029_10334753 | 3300019751 | Freshwater | VSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMI |
| Ga0194023_10121377 | 3300019756 | Freshwater | MVFNAMSNCNNINPITGGSTVGDIPFYLAVQEGKVPGYSMINKFGYNP |
| Ga0213865_105065811 | 3300021373 | Seawater | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYN |
| Ga0213868_102462964 | 3300021389 | Seawater | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTM |
| Ga0222718_100551721 | 3300021958 | Estuarine Water | MSGCNNVNPITGGSTVSDIPFYLAVQQGKVPGYTMVNKFGYNPSIGSGA |
| Ga0222718_104079203 | 3300021958 | Estuarine Water | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFG |
| Ga0222716_102958771 | 3300021959 | Estuarine Water | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMVNKFGYNP |
| Ga0222716_105508241 | 3300021959 | Estuarine Water | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVTGYTMINKFGYNPSIGSGAF |
| Ga0222715_103485513 | 3300021960 | Estuarine Water | MSDCNNVNPITGGSTVGDIPFYLAVQQGKVPGYTM |
| Ga0222714_103766091 | 3300021961 | Estuarine Water | MSSCNNVNPITGGSTVGDIPFYLAVQQGKVPGYTMVNKFGY |
| Ga0222719_101223481 | 3300021964 | Estuarine Water | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMVNKFGYNPS |
| Ga0196883_10025321 | 3300022050 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0196883_10099601 | 3300022050 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYN |
| Ga0196883_10210381 | 3300022050 | Aqueous | MSCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMVNKFGYNPSIGF |
| Ga0196883_10261282 | 3300022050 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTIGSGF |
| Ga0212030_10183281 | 3300022053 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNK |
| Ga0212025_10061771 | 3300022057 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYFM |
| Ga0212025_10680321 | 3300022057 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSIVNKFGYNPTI |
| Ga0212029_10259813 | 3300022063 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGSG |
| Ga0212029_10561503 | 3300022063 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYNS |
| Ga0196895_10256851 | 3300022067 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFW |
| Ga0212021_10532314 | 3300022068 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTIGSG |
| Ga0212021_10977073 | 3300022068 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFG |
| Ga0212021_11082681 | 3300022068 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIG |
| Ga0212026_10524521 | 3300022069 | Aqueous | MSDCNNVNPITGGSTVGDIPFYLAVQQGKVPGYTMVS |
| Ga0212028_11040611 | 3300022071 | Aqueous | MNCNNVNPITGGSTVDNIPFYLAVQQGKVLGYSMINKFGYNPSIGSG |
| Ga0196893_10180781 | 3300022159 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPT |
| Ga0212020_10099864 | 3300022167 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMI |
| Ga0212020_10345993 | 3300022167 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNGSIGSLAS |
| Ga0212027_10203543 | 3300022168 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNK |
| Ga0212027_10292601 | 3300022168 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVN |
| Ga0196887_10954693 | 3300022178 | Aqueous | MSGCNNVNPITGGSTVGDIPFYLAVQEGKVPGYSMIN |
| Ga0196891_10058634 | 3300022183 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNP |
| Ga0196899_10226811 | 3300022187 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGSGA |
| Ga0196899_10570151 | 3300022187 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGSG |
| Ga0196899_10844163 | 3300022187 | Aqueous | MATCNNVNPVTGGSTVDDIPFYLAIQQGKVPGYSMINKFGYNSSIG |
| Ga0196905_10336183 | 3300022198 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYNSSIGSG |
| Ga0196905_10480083 | 3300022198 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAIQQGKVPGYFMVNKFG |
| Ga0196901_10237261 | 3300022200 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNS |
| Ga0196901_10340041 | 3300022200 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYN |
| Ga0196901_10522351 | 3300022200 | Aqueous | VSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYNS |
| Ga0196901_10624064 | 3300022200 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVSGYSMINKFGYN |
| Ga0196901_12558223 | 3300022200 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSM |
| Ga0196901_12781591 | 3300022200 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSS |
| Ga0222673_10159703 | 3300022821 | Saline Water | MSCNNINPITGGSTVSDIPFYLAVQQGKVPGYSIINKFGYNSSI |
| Ga0210003_12282811 | 3300024262 | Deep Subsurface | MSCNNINPITGGSTVSDVPFYLAVQQGQVSGYSSINKFG |
| (restricted) Ga0255046_102601573 | 3300024519 | Seawater | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSIINKFGYN |
| Ga0208303_10088271 | 3300025543 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKF |
| Ga0208303_10107511 | 3300025543 | Aqueous | VSCNNVNPITGGSTVDDIPFYLAVQQNKVPGYSMINKFGYNSSIGSG |
| Ga0208303_10137444 | 3300025543 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSS |
| Ga0208303_10420633 | 3300025543 | Aqueous | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0208303_10526621 | 3300025543 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSSI |
| Ga0208149_10213713 | 3300025610 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGSGA |
| Ga0208149_10591691 | 3300025610 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNDSIG |
| Ga0208149_10656383 | 3300025610 | Aqueous | MSNCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMINKF |
| Ga0208004_10177271 | 3300025630 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFG |
| Ga0208004_11101733 | 3300025630 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGSLSF |
| Ga0208161_11084901 | 3300025646 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSSIGS |
| Ga0208160_10305183 | 3300025647 | Aqueous | MNCNNVNPITGGSTVDNIPFYLAVQQGKVPGYSMVNKFGYN |
| Ga0208160_10443014 | 3300025647 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFG |
| Ga0208160_11055711 | 3300025647 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMV |
| Ga0208160_11181041 | 3300025647 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGY |
| Ga0208160_11230381 | 3300025647 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMV |
| Ga0208134_11360252 | 3300025652 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0208428_10597833 | 3300025653 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNPTI |
| Ga0208795_10252736 | 3300025655 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNDS |
| Ga0208795_10346231 | 3300025655 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYN |
| Ga0208898_10009981 | 3300025671 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNK |
| Ga0208898_10114301 | 3300025671 | Aqueous | MSSCNNVNPITGGSTVGDIPFYLAIQQGKVPGYSMVNK |
| Ga0208898_10201741 | 3300025671 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSIVNKF |
| Ga0208898_10356273 | 3300025671 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYND |
| Ga0208898_10541624 | 3300025671 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYN |
| Ga0208162_10125061 | 3300025674 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPS |
| Ga0208162_10416054 | 3300025674 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKF |
| Ga0208162_11583911 | 3300025674 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMIN |
| Ga0208162_12012163 | 3300025674 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNS |
| Ga0208019_100260713 | 3300025687 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSS |
| Ga0208019_10459804 | 3300025687 | Aqueous | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSS |
| Ga0208019_10620355 | 3300025687 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSM |
| Ga0209653_10435353 | 3300025695 | Marine | VSCNNVNPITGGSTVGDIPFYLAVQQGKVPGYTMVNKFGYNPSI |
| Ga0209653_12065443 | 3300025695 | Marine | MSSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMV |
| Ga0208150_10235771 | 3300025751 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNP |
| Ga0208899_10177056 | 3300025759 | Aqueous | MFCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMVN |
| Ga0208899_10250521 | 3300025759 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVN |
| Ga0208899_10454505 | 3300025759 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAIQQGKVPGYSMVNKFGYNSSI |
| Ga0208899_10644291 | 3300025759 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGSG |
| Ga0208767_10228085 | 3300025769 | Aqueous | MSDCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0208767_10585871 | 3300025769 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNSTIG |
| Ga0208767_12039021 | 3300025769 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKF |
| Ga0208767_12716603 | 3300025769 | Aqueous | MATCNNVNPVTGGSTVDDIPFYLAVQQGKVPGYSM |
| Ga0208427_10635081 | 3300025771 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMI |
| Ga0208425_10073951 | 3300025803 | Aqueous | MSNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGSGA |
| Ga0208543_10297933 | 3300025810 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSMVNKFG |
| Ga0208785_10258841 | 3300025815 | Aqueous | MSDCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFG |
| Ga0208917_10822792 | 3300025840 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSIVNKFGYNP |
| Ga0208917_11713851 | 3300025840 | Aqueous | MSGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKF |
| Ga0208645_10243141 | 3300025853 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0208644_10068131 | 3300025889 | Aqueous | MATCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMINKFGYNSS |
| Ga0208644_10192471 | 3300025889 | Aqueous | MNCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNDSI |
| Ga0208644_10807211 | 3300025889 | Aqueous | MSCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMVNKFGYNSSIG |
| Ga0208644_10971521 | 3300025889 | Aqueous | MSCNNINPITGGSTVDDIPFYLAVQQGKVPGYSMVN |
| Ga0208644_11792411 | 3300025889 | Aqueous | MSCNNVNPIIGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNS |
| Ga0208644_13377763 | 3300025889 | Aqueous | MSQGCNNVNPITGGSTVDDIPFYLAVQQGKVPGYS |
| Ga0316202_101480921 | 3300032277 | Microbial Mat | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSMVN |
| Ga0348335_009581_5322_5462 | 3300034374 | Aqueous | MSDCNNVNPITGGSTVDDIPFYLAVQQGKVPGYSMVNKFGYNSSIGS |
| Ga0348335_097811_814_933 | 3300034374 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSIVNKFGY |
| Ga0348335_161193_469_597 | 3300034374 | Aqueous | MSCNNVNPIIGGSTVGNIPFYLAVQQGKVPGYSIVNKFGYNPT |
| Ga0348336_075006_1140_1247 | 3300034375 | Aqueous | MSCNNVNPITGGSTVGNIPFYLAVQQGKVPGYSIVN |
| Ga0348336_119154_728_847 | 3300034375 | Aqueous | MSCNNVNPITGGSTVSNIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0348336_122319_706_828 | 3300034375 | Aqueous | MSGCNNVNPITGGSTVGDIPFYLAVQQGKVPGYSMVNKFGY |
| Ga0348337_130052_2_139 | 3300034418 | Aqueous | MSCNNVNPITGGSTVDDIPFYLAVQQGKVPGYTMINKFGYNPSIGS |
| Ga0348337_169637_1_111 | 3300034418 | Aqueous | MSCNNVNTITGGSTVGNIPFYLAVQQGKVPGYSIVNK |
| ⦗Top⦘ |