


| Basic Information | |
|---|---|
| Family ID | F026104 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 199 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ANKKLAAELDIESYFADTFTKPEQEFVEACASVLATYLSKT |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 199 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.69 % |
| % of genes near scaffold ends (potentially truncated) | 87.44 % |
| % of genes from short scaffolds (< 2000 bps) | 82.91 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.422 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.075 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.643 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 199 Family Scaffolds |
|---|---|---|
| PF01895 | PhoU | 4.02 |
| PF05580 | Peptidase_S55 | 2.51 |
| PF03783 | CsgG | 2.01 |
| PF04055 | Radical_SAM | 1.51 |
| PF12706 | Lactamase_B_2 | 1.51 |
| PF07883 | Cupin_2 | 1.51 |
| PF04237 | YjbR | 1.51 |
| PF00891 | Methyltransf_2 | 1.01 |
| PF00501 | AMP-binding | 1.01 |
| PF03795 | YCII | 1.01 |
| PF01156 | IU_nuc_hydro | 1.01 |
| PF03729 | DUF308 | 1.01 |
| PF13620 | CarboxypepD_reg | 1.01 |
| PF01406 | tRNA-synt_1e | 1.01 |
| PF07238 | PilZ | 1.01 |
| PF12728 | HTH_17 | 1.01 |
| PF04389 | Peptidase_M28 | 1.01 |
| PF05163 | DinB | 1.01 |
| PF07589 | PEP-CTERM | 1.01 |
| PF08534 | Redoxin | 1.01 |
| PF01367 | 5_3_exonuc | 1.01 |
| PF10282 | Lactonase | 1.01 |
| PF07690 | MFS_1 | 1.01 |
| PF13193 | AMP-binding_C | 1.01 |
| PF04185 | Phosphoesterase | 1.01 |
| PF16864 | Dimerisation2 | 1.01 |
| PF02739 | 5_3_exonuc_N | 1.01 |
| PF00072 | Response_reg | 0.50 |
| PF01557 | FAA_hydrolase | 0.50 |
| PF00196 | GerE | 0.50 |
| PF01979 | Amidohydro_1 | 0.50 |
| PF12802 | MarR_2 | 0.50 |
| PF09190 | DALR_2 | 0.50 |
| PF07228 | SpoIIE | 0.50 |
| PF00440 | TetR_N | 0.50 |
| PF00578 | AhpC-TSA | 0.50 |
| PF17147 | PFOR_II | 0.50 |
| PF07670 | Gate | 0.50 |
| PF01609 | DDE_Tnp_1 | 0.50 |
| PF04773 | FecR | 0.50 |
| PF01435 | Peptidase_M48 | 0.50 |
| PF06127 | Mpo1-like | 0.50 |
| PF02954 | HTH_8 | 0.50 |
| PF00595 | PDZ | 0.50 |
| PF01740 | STAS | 0.50 |
| PF13420 | Acetyltransf_4 | 0.50 |
| PF13517 | FG-GAP_3 | 0.50 |
| PF07969 | Amidohydro_3 | 0.50 |
| PF16499 | Melibiase_2 | 0.50 |
| PF16640 | Big_3_5 | 0.50 |
| PF04952 | AstE_AspA | 0.50 |
| PF00482 | T2SSF | 0.50 |
| PF13364 | BetaGal_dom4_5 | 0.50 |
| PF00691 | OmpA | 0.50 |
| PF14534 | DUF4440 | 0.50 |
| PF07676 | PD40 | 0.50 |
| PF07335 | Glyco_hydro_75 | 0.50 |
| PF13450 | NAD_binding_8 | 0.50 |
| PF13649 | Methyltransf_25 | 0.50 |
| PF14117 | DUF4287 | 0.50 |
| PF00069 | Pkinase | 0.50 |
| PF00753 | Lactamase_B | 0.50 |
| PF02687 | FtsX | 0.50 |
| PF01070 | FMN_dh | 0.50 |
| PF10431 | ClpB_D2-small | 0.50 |
| PF05960 | DUF885 | 0.50 |
| PF13231 | PMT_2 | 0.50 |
| PF00083 | Sugar_tr | 0.50 |
| PF01425 | Amidase | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 199 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.01 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.01 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 2.01 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.51 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.51 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.01 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.01 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 1.01 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.01 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.01 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.01 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.01 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.50 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.50 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.50 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.50 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.50 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.50 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.50 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.42 % |
| Unclassified | root | N/A | 15.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M102GXSGY | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300001137|JGI12637J13337_1011302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300001167|JGI12673J13574_1001711 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300001181|JGI12663J13571_103249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Kordia → Kordia algicida | 581 | Open in IMG/M |
| 3300004080|Ga0062385_10328024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300004092|Ga0062389_100253486 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300004092|Ga0062389_100671667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1207 | Open in IMG/M |
| 3300004092|Ga0062389_100969623 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300004092|Ga0062389_101844492 | Not Available | 784 | Open in IMG/M |
| 3300005434|Ga0070709_10470034 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005564|Ga0070664_101290323 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005591|Ga0070761_10158586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300005591|Ga0070761_10694165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 637 | Open in IMG/M |
| 3300005764|Ga0066903_103892586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
| 3300005921|Ga0070766_10190346 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300005921|Ga0070766_11281869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300006052|Ga0075029_100504383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 799 | Open in IMG/M |
| 3300006059|Ga0075017_101538151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300006086|Ga0075019_10982042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300006172|Ga0075018_10568015 | Not Available | 599 | Open in IMG/M |
| 3300006176|Ga0070765_100017222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5292 | Open in IMG/M |
| 3300006176|Ga0070765_100240218 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300006176|Ga0070765_100630513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1011 | Open in IMG/M |
| 3300006176|Ga0070765_100688227 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300006755|Ga0079222_11238621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 673 | Open in IMG/M |
| 3300006893|Ga0073928_10003487 | All Organisms → cellular organisms → Bacteria | 24736 | Open in IMG/M |
| 3300006893|Ga0073928_10190737 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300006931|Ga0097620_100898519 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300007255|Ga0099791_10505239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300007265|Ga0099794_10185408 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300009518|Ga0116128_1033482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1690 | Open in IMG/M |
| 3300009641|Ga0116120_1077936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1109 | Open in IMG/M |
| 3300009665|Ga0116135_1279182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300009824|Ga0116219_10101910 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300009839|Ga0116223_10363570 | Not Available | 855 | Open in IMG/M |
| 3300010048|Ga0126373_10562097 | Not Available | 1189 | Open in IMG/M |
| 3300010341|Ga0074045_10975842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010343|Ga0074044_10887952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300010360|Ga0126372_11295451 | Not Available | 757 | Open in IMG/M |
| 3300010361|Ga0126378_10089260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3010 | Open in IMG/M |
| 3300010366|Ga0126379_10101957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2556 | Open in IMG/M |
| 3300010375|Ga0105239_12639622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300010379|Ga0136449_101596725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300010379|Ga0136449_104500432 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010403|Ga0134123_10970813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300010880|Ga0126350_12423476 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300011269|Ga0137392_10913320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300011271|Ga0137393_10301758 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300012202|Ga0137363_10119471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2032 | Open in IMG/M |
| 3300012203|Ga0137399_10915682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300012353|Ga0137367_10337093 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300012361|Ga0137360_11467832 | Not Available | 586 | Open in IMG/M |
| 3300012683|Ga0137398_10201692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300012685|Ga0137397_10039715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3366 | Open in IMG/M |
| 3300012685|Ga0137397_10984952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300012685|Ga0137397_11169749 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012918|Ga0137396_11012484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300012924|Ga0137413_11318505 | Not Available | 580 | Open in IMG/M |
| 3300012927|Ga0137416_11610142 | Not Available | 591 | Open in IMG/M |
| 3300012927|Ga0137416_11665476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012929|Ga0137404_10041734 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300012929|Ga0137404_10057769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2999 | Open in IMG/M |
| 3300012929|Ga0137404_10062528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2892 | Open in IMG/M |
| 3300012929|Ga0137404_12134541 | Not Available | 523 | Open in IMG/M |
| 3300012930|Ga0137407_10016388 | All Organisms → cellular organisms → Bacteria | 5430 | Open in IMG/M |
| 3300012944|Ga0137410_10078071 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300012957|Ga0164303_10537755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300013296|Ga0157374_11595738 | Not Available | 676 | Open in IMG/M |
| 3300014164|Ga0181532_10000137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 72477 | Open in IMG/M |
| 3300014200|Ga0181526_10025717 | All Organisms → cellular organisms → Bacteria | 3837 | Open in IMG/M |
| 3300014489|Ga0182018_10004173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12380 | Open in IMG/M |
| 3300015054|Ga0137420_1362167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300015245|Ga0137409_10135631 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300016294|Ga0182041_11176697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300017929|Ga0187849_1310049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300017931|Ga0187877_1080608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
| 3300017940|Ga0187853_10211405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 903 | Open in IMG/M |
| 3300017942|Ga0187808_10231971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300017955|Ga0187817_10465181 | Not Available | 807 | Open in IMG/M |
| 3300017970|Ga0187783_10218461 | Not Available | 1398 | Open in IMG/M |
| 3300017970|Ga0187783_10922476 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300017970|Ga0187783_10929781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300017974|Ga0187777_10046575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2790 | Open in IMG/M |
| 3300017974|Ga0187777_11322531 | Not Available | 530 | Open in IMG/M |
| 3300017975|Ga0187782_10351250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
| 3300017975|Ga0187782_10501136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300018007|Ga0187805_10170202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 992 | Open in IMG/M |
| 3300018030|Ga0187869_10175213 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300018040|Ga0187862_10770292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300018042|Ga0187871_10164679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1249 | Open in IMG/M |
| 3300018044|Ga0187890_10391655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300018060|Ga0187765_10616674 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300018086|Ga0187769_11083327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300018088|Ga0187771_10400049 | Not Available | 1158 | Open in IMG/M |
| 3300018088|Ga0187771_10755331 | Not Available | 825 | Open in IMG/M |
| 3300018090|Ga0187770_11750642 | Not Available | 508 | Open in IMG/M |
| 3300019789|Ga0137408_1100135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 2024 | Open in IMG/M |
| 3300019789|Ga0137408_1100136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 1363 | Open in IMG/M |
| 3300019890|Ga0193728_1139531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300020061|Ga0193716_1216108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 717 | Open in IMG/M |
| 3300020140|Ga0179590_1157621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300020170|Ga0179594_10408461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus | 515 | Open in IMG/M |
| 3300020580|Ga0210403_10593884 | Not Available | 894 | Open in IMG/M |
| 3300020581|Ga0210399_10239060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1513 | Open in IMG/M |
| 3300020581|Ga0210399_11371003 | Not Available | 554 | Open in IMG/M |
| 3300020583|Ga0210401_10498976 | Not Available | 1080 | Open in IMG/M |
| 3300021168|Ga0210406_10663322 | Not Available | 807 | Open in IMG/M |
| 3300021168|Ga0210406_10971169 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021168|Ga0210406_11054445 | Not Available | 601 | Open in IMG/M |
| 3300021171|Ga0210405_10736991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300021178|Ga0210408_10196216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1605 | Open in IMG/M |
| 3300021180|Ga0210396_10225546 | Not Available | 1669 | Open in IMG/M |
| 3300021181|Ga0210388_10576435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 985 | Open in IMG/M |
| 3300021402|Ga0210385_11524059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300021404|Ga0210389_10932131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021420|Ga0210394_10520939 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300021420|Ga0210394_11447843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 583 | Open in IMG/M |
| 3300021432|Ga0210384_10467090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300021432|Ga0210384_11697140 | Not Available | 537 | Open in IMG/M |
| 3300021433|Ga0210391_10203303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1558 | Open in IMG/M |
| 3300021475|Ga0210392_11370951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300021477|Ga0210398_10397918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1123 | Open in IMG/M |
| 3300021477|Ga0210398_10999975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021479|Ga0210410_10624199 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300022521|Ga0224541_1007072 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300022529|Ga0242668_1027500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 905 | Open in IMG/M |
| 3300022557|Ga0212123_10043448 | All Organisms → cellular organisms → Bacteria | 4268 | Open in IMG/M |
| 3300022873|Ga0224550_1004432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1986 | Open in IMG/M |
| 3300023090|Ga0224558_1178103 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300024181|Ga0247693_1035070 | Not Available | 701 | Open in IMG/M |
| 3300024288|Ga0179589_10391937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300024290|Ga0247667_1054258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300027034|Ga0209730_1028756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300027039|Ga0207855_1037364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300027432|Ga0209421_1113083 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027535|Ga0209734_1016022 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300027559|Ga0209222_1089325 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300027629|Ga0209422_1009841 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300027635|Ga0209625_1000251 | All Organisms → cellular organisms → Bacteria | 13747 | Open in IMG/M |
| 3300027635|Ga0209625_1004567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2999 | Open in IMG/M |
| 3300027635|Ga0209625_1091094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027671|Ga0209588_1095297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300027678|Ga0209011_1167881 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300027701|Ga0209447_10000497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10837 | Open in IMG/M |
| 3300027745|Ga0209908_10018228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1298 | Open in IMG/M |
| 3300027745|Ga0209908_10023391 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300027745|Ga0209908_10180862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300027783|Ga0209448_10225501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 620 | Open in IMG/M |
| 3300027812|Ga0209656_10087708 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300027812|Ga0209656_10382081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300027884|Ga0209275_10281499 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300027884|Ga0209275_10558774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 655 | Open in IMG/M |
| 3300027889|Ga0209380_10455271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300027889|Ga0209380_10842253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300027898|Ga0209067_10817118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300027908|Ga0209006_10136474 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300027911|Ga0209698_10146779 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300028789|Ga0302232_10665412 | Not Available | 511 | Open in IMG/M |
| 3300028877|Ga0302235_10118839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1193 | Open in IMG/M |
| 3300028906|Ga0308309_10161412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
| 3300029636|Ga0222749_10058105 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300029636|Ga0222749_10210042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300029922|Ga0311363_11478043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 547 | Open in IMG/M |
| 3300029944|Ga0311352_10803215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 735 | Open in IMG/M |
| 3300030659|Ga0316363_10294994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300030659|Ga0316363_10423996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 514 | Open in IMG/M |
| 3300030764|Ga0265720_1012838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300030940|Ga0265740_1017549 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300030991|Ga0073994_10065934 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300031057|Ga0170834_112227328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300031234|Ga0302325_12439637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300031236|Ga0302324_102586062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300031446|Ga0170820_16630811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 779 | Open in IMG/M |
| 3300031708|Ga0310686_105650058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300031708|Ga0310686_107889434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2957 | Open in IMG/M |
| 3300031708|Ga0310686_110845228 | Not Available | 804 | Open in IMG/M |
| 3300031715|Ga0307476_10000736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22793 | Open in IMG/M |
| 3300031715|Ga0307476_10739042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300031715|Ga0307476_10853195 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031716|Ga0310813_10282701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1394 | Open in IMG/M |
| 3300031718|Ga0307474_10085959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2344 | Open in IMG/M |
| 3300031718|Ga0307474_10578282 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300031823|Ga0307478_11278113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300031912|Ga0306921_10074154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3910 | Open in IMG/M |
| 3300031912|Ga0306921_11889859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300032035|Ga0310911_10652673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300032180|Ga0307471_100280670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1740 | Open in IMG/M |
| 3300032180|Ga0307471_103364766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300032783|Ga0335079_10128427 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
| 3300032783|Ga0335079_10237851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2007 | Open in IMG/M |
| 3300032783|Ga0335079_11304798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300032828|Ga0335080_10104663 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 3140 | Open in IMG/M |
| 3300032955|Ga0335076_10382508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300033402|Ga0326728_11069485 | Not Available | 550 | Open in IMG/M |
| 3300033547|Ga0316212_1038489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.53% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.02% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.02% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.51% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.51% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001181 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_04508750 | 2189573001 | Grass Soil | GSTLVKPEIVVPMYVNKALAGELDIESYFAVTFKSEQEFAQGCANVIADYLAKQK |
| JGI12637J13337_10113022 | 3300001137 | Forest Soil | IVVPIFVNKKLAAELDIESYFADTFNKSEQEFIEACAVVVANYLAKG* |
| JGI12673J13574_10017112 | 3300001167 | Forest Soil | VPIFVGKKLAAELDIESYFTDTFTKPEQKFVEACGAVIANYLRKILR* |
| JGI12663J13571_1032491 | 3300001181 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFSDTFTKPEQEFVEACGAVMAKYLGKE* |
| Ga0062385_103280241 | 3300004080 | Bog Forest Soil | KQKLAAEFDIESYFANTFTAAEQEFVEACAKVVGNYLEKL* |
| Ga0062389_1002534862 | 3300004092 | Bog Forest Soil | VKKKLAAELDIESYFVSTFTKSEQDFVEACATIVGEYLGKG* |
| Ga0062389_1006716671 | 3300004092 | Bog Forest Soil | VPIFLKHKLAAELDIESYFAGTFNKSEQEFVEACSTLVAKQLGKG* |
| Ga0062389_1009696232 | 3300004092 | Bog Forest Soil | KKKLAGELDIESYFADSFPKEEQEFIEACANVVANYMGKR* |
| Ga0062389_1012877702 | 3300004092 | Bog Forest Soil | LAAELDVESYFAGTFTQAEQDFIEACANIAGEYLGKGLEAQK* |
| Ga0062389_1018444921 | 3300004092 | Bog Forest Soil | VPIFLKHKLAAELDIESYFASTFNKSEQEFVEACAGLVAKHLGKG* |
| Ga0070709_104700341 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SEIVVPIFVNKQFAAELDAESYFTDTFNRDEQEFVEACAAVVAGFLGK* |
| Ga0070664_1012903231 | 3300005564 | Corn Rhizosphere | ELDIESYFASSFTKGEQEFVEGCAAVVAKYMATKK* |
| Ga0070761_101585861 | 3300005591 | Soil | KLAAELDIESYFAGTFNRSEQEFVEACAALVAKHLGKG* |
| Ga0070761_106941652 | 3300005591 | Soil | IFVKGQLVAELDIESYFTSTFTDGEKDFVEACAGVVGKYMGKG* |
| Ga0066903_1038925861 | 3300005764 | Tropical Forest Soil | EIDIESYFAQTFSKAEQEFVEACAALVGRYMENKH* |
| Ga0070766_101903463 | 3300005921 | Soil | GELDIESYFADTFTKPEQEFVEACANVISDYMARK* |
| Ga0070766_112818691 | 3300005921 | Soil | KDARYLAGSSMVKSEMVVPIFVNKKLAAELDVESYFADTFNKTEQEFVEACAAVVGNCLGKH* |
| Ga0075029_1005043831 | 3300006052 | Watersheds | VVPIFVNKKLAGELDIESYFADSFPKSEQEFVEACANVFAGYLAKC* |
| Ga0075017_1015381512 | 3300006059 | Watersheds | AAELDIESYFADTFTKPEQEFVEACANVVANVLAKR* |
| Ga0075019_109820422 | 3300006086 | Watersheds | MYAYKKLAAELDIESYFADTFTKSEQEFVEACAKLAADYLGKE* |
| Ga0075018_105680151 | 3300006172 | Watersheds | KLAAELDIESYFGDTFTLIEQPFVEACAQVLGDYLSKQG* |
| Ga0070765_1000172221 | 3300006176 | Soil | ELDIESYFADTFTKPEQEFVEICANVIADYMGRKK* |
| Ga0070765_1002402181 | 3300006176 | Soil | KKLAAELDIESYFAEAFPMPEQDFIEACAKVVANFLSKN* |
| Ga0070765_1006305132 | 3300006176 | Soil | VKNKLAAELDVESYFAGTFTKPEQDFVEACAAIVGKYLAKG* |
| Ga0070765_1006882271 | 3300006176 | Soil | KLAAELDIESYFEGTFTKSEQDFVEACASIVGAYLRK* |
| Ga0079222_112386212 | 3300006755 | Agricultural Soil | IFAKNKLAAELDIESYFAGTFTKPEQEFVEACAALVGKSLEKT* |
| Ga0073928_100034876 | 3300006893 | Iron-Sulfur Acid Spring | VGSSLVKSEIVVPIFVGKKLAAELDIESYFTVTFTKPEQEFVEACGTVIANYLGKE* |
| Ga0073928_101907372 | 3300006893 | Iron-Sulfur Acid Spring | AAELDIESYFSDTFTKPEQEFVEACGAVIAKYLGKE* |
| Ga0097620_1008985191 | 3300006931 | Switchgrass Rhizosphere | AELDIESYFASSFTKGEQEFVEGCAAVVAKYMATKK* |
| Ga0099791_105052392 | 3300007255 | Vadose Zone Soil | AELDIESYFADTFTKSEQEFVEACASLIANYLGRRY* |
| Ga0099794_101854081 | 3300007265 | Vadose Zone Soil | AELDIESYFAGTFTNSEQEFVEACANILANYLSKPR* |
| Ga0116128_10334822 | 3300009518 | Peatland | AAELDIESYFSGTFTKTEQEFVEACANVAGEYMGKG* |
| Ga0116120_10779362 | 3300009641 | Peatland | VRNKLAAELDIESYFTSTFTEPEKEFVEACAAVVGNYISKG* |
| Ga0116135_12791821 | 3300009665 | Peatland | MVKCEVVVPIFVKKKLAAELDIESYFLGTFTEAEQTFAEACAAVVGDYLGRT* |
| Ga0116219_101019103 | 3300009824 | Peatlands Soil | KGDLAGELDVESYFAGTFDKSEQDFVEACAAVVGKYLGKG* |
| Ga0116223_103635701 | 3300009839 | Peatlands Soil | IVVPIFVKNKLAAELDIESYFASTFNKPEQSFVEACAAVVGEYLGKR* |
| Ga0126373_105620972 | 3300010048 | Tropical Forest Soil | IVVPIYVNKKLAGELDIESYFADSFPKSEQEFAEACAGVFANYLTKG* |
| Ga0074045_109758422 | 3300010341 | Bog Forest Soil | VVPIFVKSKLAGELDVESYFASAFTEAEKEFVEACAGVVGKHLGRG* |
| Ga0074044_108879522 | 3300010343 | Bog Forest Soil | AELDIESYFADTFTKTEQEFVEACASVISDYLAKG* |
| Ga0126372_112954512 | 3300010360 | Tropical Forest Soil | VNKKLAGELDIESYFADSFPKSECEFVEACANVLASYLTKA* |
| Ga0126378_100892603 | 3300010361 | Tropical Forest Soil | IVVPIFVNKKLAGELDIESYFADSFPSSEQEFVGACAEILAGYLTKR* |
| Ga0126379_101019571 | 3300010366 | Tropical Forest Soil | IVVPISVNKKLAGELDIESYFADSFPKSECEFVEACANVLASYLTKA* |
| Ga0105239_126396221 | 3300010375 | Corn Rhizosphere | RYLSGSTMVKSEIVVPIIVNKVVAELDIESYFPSTFNQSERQFVEACAAVVGRHLAGL* |
| Ga0136449_1015967251 | 3300010379 | Peatlands Soil | AKNKLAAELDIESYFEGTFTKSEQDFVEACASIVGAYLRK* |
| Ga0136449_1045004322 | 3300010379 | Peatlands Soil | ELDVESYFAGTFTPAEQAFIEACANIVAKYLGKG* |
| Ga0134123_109708131 | 3300010403 | Terrestrial Soil | SKLVAELDIESYFASSFTKGEQEFVEGCAAVVAKYMATKK* |
| Ga0126350_124234762 | 3300010880 | Boreal Forest Soil | EMVVPIFVNKKLAAELDVESYFADTFNGTEQEFVEACAAVVGNYLGKS* |
| Ga0137392_109133201 | 3300011269 | Vadose Zone Soil | KSEIVVPIFVNKKLAAELDIESYFADTFTPPEQQFVESCANVLANYLAKA* |
| Ga0137393_103017581 | 3300011271 | Vadose Zone Soil | ANKKLAAELDIESYFADTFTKPEQEFVEACASVLATYLSKT* |
| Ga0137363_101194713 | 3300012202 | Vadose Zone Soil | KKLAAELDIESYFANTFTQPEQQFIESCASVLATYFAHSH* |
| Ga0137399_109156822 | 3300012203 | Vadose Zone Soil | VPIFVNKQLAAELDIESYFAGTFTDPEQEFVEACANILVNYLSKPR* |
| Ga0137367_103370931 | 3300012353 | Vadose Zone Soil | IFVKNKFAAELDIDSYFAGTFTKPEQDFAEACASIVGECLGRR* |
| Ga0137360_114678322 | 3300012361 | Vadose Zone Soil | AELDIESYFADTFGKSDQDFIEGCANLLAGYLSKE* |
| Ga0137398_102016921 | 3300012683 | Vadose Zone Soil | SKKLAAELDIESYFANTFTQPEQQFIESCASVLATYFAQSH* |
| Ga0137397_100397151 | 3300012685 | Vadose Zone Soil | PILVNNKLAAELDIESYFADTFTKSEQEFIEACASLIANYLGRR* |
| Ga0137397_109849521 | 3300012685 | Vadose Zone Soil | FVNKKLAAELDIESYFADTFTKSEQEFVEACASLIANYLGRRY* |
| Ga0137397_111697492 | 3300012685 | Vadose Zone Soil | LAAELDIESYFAGTFTSSDQEFVEACANTVATYLSKPH* |
| Ga0137396_110124841 | 3300012918 | Vadose Zone Soil | LDIESYFAGTFTNSEQEFVEACANILANYLSKPH* |
| Ga0137413_113185051 | 3300012924 | Vadose Zone Soil | IYVKKKLAAELDIESYFADTFGRSDQEFVEGCATVLAGYLSKA* |
| Ga0137416_116101421 | 3300012927 | Vadose Zone Soil | YAKKKLAAELDIESYFADTFGKSERDFSEGCAKVIADYLGRE* |
| Ga0137416_116654762 | 3300012927 | Vadose Zone Soil | VVPIFVKNKLAAELDIESYFMGTFAKSEQEFVEACATLVGKYMGKQ* |
| Ga0137404_100417341 | 3300012929 | Vadose Zone Soil | SEIVVPIFVNQQLAAELDIESYFADTFNKAEQEFVEACANTVASYLSRAH* |
| Ga0137404_100577691 | 3300012929 | Vadose Zone Soil | EIVVPIFVNKQLAAELDIESYFAGTFTNSEQEFVEACANILANYLSKPH* |
| Ga0137404_100625281 | 3300012929 | Vadose Zone Soil | SEIVVPIFVNQQLAAELDIESYFADTFNKAEQEFVEACANILANYLSKLH* |
| Ga0137404_121345412 | 3300012929 | Vadose Zone Soil | ESYFVGTFTAPEQEFVEACAAVVGAYMSKKAKPFSA* |
| Ga0137407_100163881 | 3300012930 | Vadose Zone Soil | SEIVVPIFVNQQLAAELDIESYFADTFNKAEQEFVEACANTIAGYLSNAH* |
| Ga0137410_100780714 | 3300012944 | Vadose Zone Soil | VPIFVNQQLAAELDIESYFAGTFTSSDQEFVEACANILANYLSKLH* |
| Ga0164303_105377552 | 3300012957 | Soil | VPIFVKSKLVAELDIESYFASSFTKGEQEFVEGCAAVVAKYMATKK* |
| Ga0157374_115957381 | 3300013296 | Miscanthus Rhizosphere | VAELDIESYFASSFTKGEQEFVEGCAAVVAKYMATKK* |
| Ga0181532_100001374 | 3300014164 | Bog | VKNKLAAELDIESYFTSTFTPPEQEFVEACATLVGKYLGKK* |
| Ga0181526_100257174 | 3300014200 | Bog | ELDIESYFADTFTAPEQEFVEDCAAVIATYLEEK* |
| Ga0182018_100041731 | 3300014489 | Palsa | ELDIESYFANTFTKAEQHFVEACAMVVGKYLGRG* |
| Ga0137420_13621672 | 3300015054 | Vadose Zone Soil | QLAAELDIESYFADTFGKSERDFIEGCAKVIADYLGKE* |
| Ga0137409_101356311 | 3300015245 | Vadose Zone Soil | ELDIESYFAGTFTSSDQEFVEACANILANYLSKLH* |
| Ga0182041_111766971 | 3300016294 | Soil | IPIYVHETLAGELDIESYFADTFNQSEQEFAQACAGVIADYLAKQK |
| Ga0187849_13100491 | 3300017929 | Peatland | VKKKLAAELDIESYFSGTFTKTEQEFVEACANVAGEYMGKG |
| Ga0187877_10806083 | 3300017931 | Peatland | AAELDIESYFSGTFTKTEQEFVEACANVAGEYMGKG |
| Ga0187853_102114052 | 3300017940 | Peatland | VVPIFVRKQLVGELDIESYFTSTFTDAEKEFVEACAGVVERYMEKR |
| Ga0187808_102319711 | 3300017942 | Freshwater Sediment | IYADKKLAAELDIESYFADTFTKPEQDFVEACSHVVADYLGKQ |
| Ga0187817_104651811 | 3300017955 | Freshwater Sediment | PIFAENKLAAELDINSYFAGTFPRSEQDFIEACAAVVGSLLEKGSRLKIEQHR |
| Ga0187783_102184611 | 3300017970 | Tropical Peatland | MVKCEIVVPILVKNKLHGELDVESYFSGTFTKAEEEFVVACAGVVGKYLGRG |
| Ga0187783_109224762 | 3300017970 | Tropical Peatland | EMVVPIFVKNVLAGELDVESYFPHSFTQIEQEFVQACAGIVEKYLAKN |
| Ga0187783_109297811 | 3300017970 | Tropical Peatland | LVAELDINSYFPATFTKSEQEFVEACAKLAGRYLARGGSGQAAAK |
| Ga0187781_109336582 | 3300017972 | Tropical Peatland | DKLAAELDVESYFPATFVKAEQAFVEACAAIVGKYLEKG |
| Ga0187777_100465753 | 3300017974 | Tropical Peatland | HVDKKLVAELDIESYFADTFTRSEQDLIESCAHLVAVSLTRV |
| Ga0187777_113225312 | 3300017974 | Tropical Peatland | GTSTVKSEMVVPIFVKNKVAAELDVESYFVDSFPKSEQEFVEACAKVVAEYLARA |
| Ga0187782_103512501 | 3300017975 | Tropical Peatland | KKLAAELDVESYFVDTFPKAEQEFVEACAKVVEEYLERG |
| Ga0187782_105011361 | 3300017975 | Tropical Peatland | LVAELDINSYFPATFTKPEQDFVEACARLAGKCLSKGGPGQAAAR |
| Ga0187805_101702021 | 3300018007 | Freshwater Sediment | IVVPIFVKGKLAAEFDIESYFTSTFVDAEKDFVEACAGVVGKYLAKPPAS |
| Ga0187869_101752131 | 3300018030 | Peatland | SEIVVPIFAKNKLAAELDIESYFTSTFTKPEQEFVEACAAIAGKYLGKG |
| Ga0187862_107702921 | 3300018040 | Peatland | IVVPIFVKGQLAAELDVESYFTTTFTEPEKEFVEACAGIVGTYLSKA |
| Ga0187871_101646792 | 3300018042 | Peatland | AELDIESYFAGTFTKPEQDFSEDCARIVGEYLGKA |
| Ga0187890_103916553 | 3300018044 | Peatland | AAELDVESYFTTTFTEPEKEFVEACAGIVGTYLSKA |
| Ga0187765_106166742 | 3300018060 | Tropical Peatland | VNKKLQAELDIESYFAETFASEEREFVEACAAVIAEYLSRTKPM |
| Ga0187772_114028412 | 3300018085 | Tropical Peatland | VPIFASKKLVAELDVESYFPSTFTGPEQEFVETCAALVGQSWERK |
| Ga0187769_110833271 | 3300018086 | Tropical Peatland | PIFVKNKLAAELDVESYFAGTFTRSEQDFVAACAAILGDYWGKR |
| Ga0187771_104000492 | 3300018088 | Tropical Peatland | AAELDVESYFAGTFTKSDQEFVAACAAIVGDYLGKSRAV |
| Ga0187771_107553312 | 3300018088 | Tropical Peatland | LAAELDIESYFADTFNKTEQEFSEASASVVAGYLAKNP |
| Ga0187770_117506421 | 3300018090 | Tropical Peatland | LAGELDIESYFADTFNKTEQEFSEACANVVAAYLEKAH |
| Ga0137408_11001353 | 3300019789 | Vadose Zone Soil | VVPIFVKNKLAAELDIESYFMGTFAKSEQEFVEACATLVGKYMGKQ |
| Ga0137408_11001361 | 3300019789 | Vadose Zone Soil | CAYLRHIFVKNKLAAELDIESYFMGTFAKSEQEFVEACATLVGKYMGKQ |
| Ga0193728_11395312 | 3300019890 | Soil | MVKCEVVVPIFVKSKLAAELDIESYFVGTFTKAEQDFVEACAAILGGYLGRG |
| Ga0193716_12161081 | 3300020061 | Soil | IFANKKLAAELDIESYFANTFVTSEQEFIEACAAVLGNYLTKGL |
| Ga0179590_11576211 | 3300020140 | Vadose Zone Soil | YAKKQLAAELDIESYFADTFGKSERDFIEGCAKVIADYLGKE |
| Ga0179594_104084611 | 3300020170 | Vadose Zone Soil | EIVVPIFVNKKLAAELDIESYFADTFTKSEQEFIEACASLIANYLGRRY |
| Ga0210403_105938841 | 3300020580 | Soil | IFVNKKLAGELDAESYFADTFTKMEQEFVEACASVVANYMGKG |
| Ga0210399_102390601 | 3300020581 | Soil | VPIYANKKLAGELDIESYFADTFTKPEQEFVEACASVIAHYLERK |
| Ga0210399_113710031 | 3300020581 | Soil | VPIYVKKKLAAELDIESYFSDTFGKSDQDFIEGCAQVLAGYLAKE |
| Ga0210401_104989762 | 3300020583 | Soil | MVKSEMVVPISVNKKLAGELNVESYFADTFPKSEQEFVEACATIAATYLAKA |
| Ga0210401_105497912 | 3300020583 | Soil | AAELDIESYFAGAFPMPEQQFIESCAKVVANFLSKN |
| Ga0210406_106633223 | 3300021168 | Soil | AAELDIESYFADTFNKSEQEFIEGCAKVMADYLARE |
| Ga0210406_109711692 | 3300021168 | Soil | VVPIFIDKKLAAELDIESYFADTFTKTEQEFIESCAAVLATFLAKA |
| Ga0210406_110544451 | 3300021168 | Soil | AAELDIESYFADTFTTPEQEFIESCASVVASFLAKA |
| Ga0210405_107369912 | 3300021171 | Soil | PIFVNKKLAAELDIDSYFAGTFNKTEQAFVETCASVLANYLAKT |
| Ga0210408_101962163 | 3300021178 | Soil | RLAAELDIESYFADTFTKSEQEFVEACANVLANCLTKA |
| Ga0210396_102255462 | 3300021180 | Soil | PIYAKKKLTAELDIESYFADTFGKSDQEFIESCAKVMADYLGKQ |
| Ga0210388_105764353 | 3300021181 | Soil | NLAAELDIESYFVDTFTKPEQEFVEACASVLANYLAKG |
| Ga0210385_115240591 | 3300021402 | Soil | VPILVGNKLAGELDIESYFSGAFTKAEQDFVEACAEMVGAYLAKTSR |
| Ga0210389_109321312 | 3300021404 | Soil | VPIFLKKKLAAELDIESYFANTFVKTEQDFIEACAGVVGNYLAKSA |
| Ga0210394_105209393 | 3300021420 | Soil | KLAAELDVESYFAGTFTKPEQEFVEACATVVGKYLGK |
| Ga0210394_114478431 | 3300021420 | Soil | IYAKKKLAAELDIESYFADTFNRTEQEFVEACAAVVADYLETK |
| Ga0210384_104670901 | 3300021432 | Soil | MVKCEIMAPIFVKEKLVAELDIESYFANTFTPMEQDFVENCAAVVGKYFGADG |
| Ga0210384_116971402 | 3300021432 | Soil | KKLAAELDIESYFVDTFTKAEQEFVEACATILAQYLAKKGYQR |
| Ga0210391_102033032 | 3300021433 | Soil | PIYGNQKLAAELDINSYFAETFNRTERQFVEACAKVIANYLAKG |
| Ga0210392_113709511 | 3300021475 | Soil | GSSMVKSEMVVPIFVNKKLAAELDVESYFADTFNGTEQEFVEACAAVVGNYLGKS |
| Ga0210398_103979181 | 3300021477 | Soil | EVVVPIFVKGKLAAELDIESYFANTFDLAEREFVEACAALVGRFLGKG |
| Ga0210398_109999752 | 3300021477 | Soil | IHVNKKLEAELDIESYFADTFTKSEQEFVEACAGVVANYLLTKV |
| Ga0210410_106241991 | 3300021479 | Soil | LVKSEIVVPIFANKKLAAELDIESYFAGTFTPPEQQFIESCASILATCLAKSR |
| Ga0224541_10070724 | 3300022521 | Soil | VVPIFVRNKLAAELDIESYFAGTFTKSEQDFVEACAAIVGRYIEKS |
| Ga0242668_10275002 | 3300022529 | Soil | VKKKLSAELDIESYFADTFAKSDQDFIESCAQVLAGYLAKE |
| Ga0212123_100434485 | 3300022557 | Iron-Sulfur Acid Spring | VKSEIVVPIFVGKKLAAELDIESYFTVTFTKPEQEFVEACGAVIANYLGKE |
| Ga0224550_10044321 | 3300022873 | Soil | KKKLAAELDIESYFAGTFTKSDQDFVESCAAIIAKYLDKK |
| Ga0224558_11781031 | 3300023090 | Soil | EIVVPIFVKNKLAAELDIESYFTSTFTEPEKVFVEACAAVVAKYMEKR |
| Ga0247693_10350702 | 3300024181 | Soil | KKLAAELDIESYFADTFGKSDQEFIEGCANLMAEYLAKA |
| Ga0179589_103919371 | 3300024288 | Vadose Zone Soil | IVVPIYAKKQLAAELDIESYFADTFGKSERDFIEGCAKVIADYLGRE |
| Ga0247667_10542582 | 3300024290 | Soil | KKLAAELDIESYFADTFGKSDQDFIEGCANLLAGYLSKE |
| Ga0209730_10287562 | 3300027034 | Forest Soil | SEIVVPIFAKKKLAYELDVESYFTDSFPKTEQEFVEACAAIVAEYLEVH |
| Ga0207855_10373641 | 3300027039 | Tropical Forest Soil | NKKLAAELDIESYFADTFTATEQAFIEACAQVLGEYLAKT |
| Ga0209421_11130832 | 3300027432 | Forest Soil | QTDSRYLSGSTMVKSEIVVPIIVNKLVAELDIESYFPSTFNQSEQQFVEACAAVVGRYLAGL |
| Ga0209734_10160221 | 3300027535 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFSDTFTKPEQEFVEACGAVMAKYLGKE |
| Ga0209222_10893251 | 3300027559 | Forest Soil | IFVKGKLAGELDIESYFASVFNKVEQEFVEECAEVAGRCLGKG |
| Ga0209422_10098413 | 3300027629 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFSDTFTKPEQEFV |
| Ga0209625_100025110 | 3300027635 | Forest Soil | VGKKLAAELDIESYFTDTFTKPEQKFVEACGAVIANYLRKILR |
| Ga0209625_10045672 | 3300027635 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFADTFTKPEQEFVEACGAVITNYLGKE |
| Ga0209625_10910942 | 3300027635 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFSDTFTKPEQEFVEACGAVISKYLGKE |
| Ga0209588_10952971 | 3300027671 | Vadose Zone Soil | CAELDIESYFAGTFTNSEQEFVEACANILANYLSKLH |
| Ga0209011_11678812 | 3300027678 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFSDTFTKPEQEFVEACGAVMAK |
| Ga0209447_1000049710 | 3300027701 | Bog Forest Soil | VPIYVKKKLVGELDIESYFTDTFIKQEQEFIEACANIVAGYLGKG |
| Ga0209908_100182282 | 3300027745 | Thawing Permafrost | LWFPSSPKKKLAAELDIESYFANTFTKAEQHFVEACAMVVGKYLGRG |
| Ga0209908_100233911 | 3300027745 | Thawing Permafrost | MVNSEIVVPVFVKNKLAGELDVESYFAGTFSKPEQEFVEACAGVVGKYLGKG |
| Ga0209908_101808622 | 3300027745 | Thawing Permafrost | KLAAELDIESYFAGTFTKSDQDFVESCAAIIAKYLDKK |
| Ga0209448_102255011 | 3300027783 | Bog Forest Soil | LAGSSMVNSEVVVPIFVKGKLAAELDIESYFANTFDLAEREFVEACAALVGRFLGKG |
| Ga0209656_100877083 | 3300027812 | Bog Forest Soil | LAAELDIESYFADTFTKSEQEFVQACAILIANYLGRT |
| Ga0209656_103820811 | 3300027812 | Bog Forest Soil | VVPIFVNKKLAAELDIESYFADTFTKPEQEFVEACAGALANYLAKS |
| Ga0209275_102814992 | 3300027884 | Soil | FVKGKLVAELDIESYFTGTFSGAEAEFVEGCAGVVGKFLGKR |
| Ga0209275_105587742 | 3300027884 | Soil | FVKNKLAAELDVESYFAGTFTKPEQEFVEACATVVGKYLGK |
| Ga0209380_104552712 | 3300027889 | Soil | MVKSEMVVPFSVHQKLAGELDVESYFADTFPKSEQEFVEACAAIVATYLAKS |
| Ga0209380_108422532 | 3300027889 | Soil | KDARYLAGSSMVKSEMVVPIFVNKKLAAELDVESYFADTFNKTEQEFVEACAAVVGNCLGKH |
| Ga0209067_108171182 | 3300027898 | Watersheds | MYAYKKLAAELDIESYFADTFTKSEQEFVEACAKLAADYLGKE |
| Ga0209006_101364742 | 3300027908 | Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFSDTFTKPEQEFVEACGALIAKYLGKE |
| Ga0209698_101467793 | 3300027911 | Watersheds | KKLAAELDIESYFANTFTPFEQQFIESCASVLANYLAVQERNR |
| Ga0302232_106654121 | 3300028789 | Palsa | LAAELDIESYFGSTFTEPEKEFVEACADVVGKRLEGG |
| Ga0302235_101188392 | 3300028877 | Palsa | ILVRNRLAAELDIESYFFSTFTDPEKEFVEACAGVVAKCLEKS |
| Ga0308309_101614123 | 3300028906 | Soil | KNKLAAELDIESYFEGTFTKSEQDFVEACASIVGAYLRK |
| Ga0222749_100581053 | 3300029636 | Soil | VVPILVKNKLAAELDIESYFADTFTKPEQEFIEACAAVVGRYLGKS |
| Ga0222749_102100422 | 3300029636 | Soil | PIFVNKKLAGELDAESYFADTFTKMEQEFVEACASVVANYMGKG |
| Ga0311363_114780432 | 3300029922 | Fen | NKLAAELDIESYFTSTFTKPEQEFVEACAAIAGKYLGKG |
| Ga0311352_108032151 | 3300029944 | Palsa | AKKKLAGELDVESYFANTFSKSEQEFVQACAAVVAIYFEKG |
| Ga0316363_102949942 | 3300030659 | Peatlands Soil | LAAELDIESYFANTFTAMEQEFVEACANVVGNYLGKGK |
| Ga0316363_104239961 | 3300030659 | Peatlands Soil | KGKLAGELDIESYFPGTFIRPEKDFVEACAAVVRDYLGKAQPA |
| Ga0265720_10128382 | 3300030764 | Soil | EIVVPIYVNKKLEAELDIESYFADTFTKPEQEFVEACAGVISSYLAKG |
| Ga0265740_10175491 | 3300030940 | Soil | IFVKGKLVAELDIESYFTGTFSGAEAEFVEGCAGVVGKFLGKR |
| Ga0073994_100659342 | 3300030991 | Soil | VGKTLAAELDIESYFSDTFTKPEQEFVEACGAVIANYLGKE |
| Ga0170834_1122273282 | 3300031057 | Forest Soil | NSEVVVPICVKGKLAGELDIESYFANTFDPAEREFVEACAAVVGRFLGKG |
| Ga0302325_124396372 | 3300031234 | Palsa | AELDIESYFASTFNASEQNFVEACAATVRDYLAKGQ |
| Ga0302324_1025860621 | 3300031236 | Palsa | LAAELDIESYFANTFTQLEQRFVEACAAVVGKYLGRG |
| Ga0170820_166308111 | 3300031446 | Forest Soil | LVKKSLFAELDIESYFANTFTMDEQSFVETCATLVGKYLEMQ |
| Ga0310686_1056500581 | 3300031708 | Soil | PIYVNKNLAAELDIESYFVDTFTKPEQEFVEACASVFATYLAKV |
| Ga0310686_1078894343 | 3300031708 | Soil | PIYVNKNLAAELDIESYFVDTFTKPEQEFVEACASVLATYLAKV |
| Ga0310686_1108452281 | 3300031708 | Soil | LAAELDIESYFAGTFSKAEQDFVEAGAAVVGECLEKSVT |
| Ga0307476_100007361 | 3300031715 | Hardwood Forest Soil | VVPIFVKGKLVAELDIESYFSGTFNTAETEFVEGCAGVVGRFLAKR |
| Ga0307476_107390422 | 3300031715 | Hardwood Forest Soil | FVNKKLAGELDAESYFVDTFTNQEQEFVEACAGVVVKYLGKG |
| Ga0307476_108531951 | 3300031715 | Hardwood Forest Soil | LDIESYFADTFTKAEQEFVEACGTSLAQYLLKTEPRS |
| Ga0310813_102827012 | 3300031716 | Soil | LVAELDIESYFASSFTKGEEEFVEGCAAVVAKYMATKK |
| Ga0307474_100859594 | 3300031718 | Hardwood Forest Soil | MVKSEIVVPIFVGKKLAAELDIESYFADTFTKPEQEFVEACGAVITNFLGKQ |
| Ga0307474_105782822 | 3300031718 | Hardwood Forest Soil | VKNKLVAELDIESYFSGTFNRAETEFVEGCAGVVGKFFGKR |
| Ga0307478_112781131 | 3300031823 | Hardwood Forest Soil | SEMVVPIFVNKKLAGELDAESYFVDTFTNQEQEFVEACAGVVVKYLGKG |
| Ga0306921_100741545 | 3300031912 | Soil | PIFAKKKLAAELDIESYFADTFTKPEQEFVEGCANIVANYLAKEQ |
| Ga0306921_118898591 | 3300031912 | Soil | GELDIESYFADTFNQSEQEFAQACAGVIADYLAKQK |
| Ga0310911_106526732 | 3300032035 | Soil | EIVVPIFAKKKLAAELDIESYFADTFTKPEQEFVEGCANIVANYLAKEQ |
| Ga0307471_1002806702 | 3300032180 | Hardwood Forest Soil | AELDIESYFADTFTKSEQEFVEACANIFANYLSKPH |
| Ga0307471_1033647662 | 3300032180 | Hardwood Forest Soil | VNKTLATELDIESYFAETFNKSEQEFAQACANVIADYVAKQK |
| Ga0335079_101284273 | 3300032783 | Soil | VPIFVNKKLRGELDVESYFADSFPKSEQEFVETCAKVFADYLAKN |
| Ga0335079_102378511 | 3300032783 | Soil | AGELDIESYFPSTFTTAEQAFVEACAGIVGKYMARG |
| Ga0335079_113047982 | 3300032783 | Soil | NKTLAAELDIESYFADTFNKSEQEFSQACSNVIAEYLAKQK |
| Ga0335080_101046631 | 3300032828 | Soil | VVPIFVNKKLRGELDVESYFADSFPKSEQEFVETCAKVFADYLAKN |
| Ga0335076_103825083 | 3300032955 | Soil | VPIFVHKKLAAELDIESYFTDTFTKAEQEFVEACANLVGAYLAKG |
| Ga0326728_110694851 | 3300033402 | Peat Soil | FAAELDIESYFARTFIKPEQDFAEACAKAVEEYWGKRP |
| Ga0316212_10384892 | 3300033547 | Roots | KGKLVAELDVESYFASTFTDPEKEFVEACARLVGAHLSKG |
| ⦗Top⦘ |