


| Basic Information | |
|---|---|
| Family ID | F025994 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 199 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 199 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 47.96 % |
| % of genes near scaffold ends (potentially truncated) | 22.61 % |
| % of genes from short scaffolds (< 2000 bps) | 69.85 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.789 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (40.201 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (59.799 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 199 Family Scaffolds |
|---|---|---|
| PF02867 | Ribonuc_red_lgC | 20.10 |
| PF08774 | VRR_NUC | 6.03 |
| PF13392 | HNH_3 | 3.52 |
| PF01555 | N6_N4_Mtase | 2.51 |
| PF04542 | Sigma70_r2 | 2.51 |
| PF13529 | Peptidase_C39_2 | 2.51 |
| PF12684 | DUF3799 | 2.51 |
| PF02945 | Endonuclease_7 | 1.51 |
| PF14279 | HNH_5 | 1.51 |
| PF04545 | Sigma70_r4 | 1.51 |
| PF01844 | HNH | 1.51 |
| PF10544 | T5orf172 | 1.01 |
| PF00847 | AP2 | 1.01 |
| PF13550 | Phage-tail_3 | 1.01 |
| PF00692 | dUTPase | 1.01 |
| PF13481 | AAA_25 | 0.50 |
| PF02511 | Thy1 | 0.50 |
| PF00196 | GerE | 0.50 |
| PF04851 | ResIII | 0.50 |
| PF07864 | DUF1651 | 0.50 |
| PF14250 | AbrB-like | 0.50 |
| PF05565 | Sipho_Gp157 | 0.50 |
| PF00145 | DNA_methylase | 0.50 |
| PF00959 | Phage_lysozyme | 0.50 |
| PF13385 | Laminin_G_3 | 0.50 |
| PF00436 | SSB | 0.50 |
| PF13384 | HTH_23 | 0.50 |
| PF02796 | HTH_7 | 0.50 |
| PF12762 | DDE_Tnp_IS1595 | 0.50 |
| PF08809 | DUF1799 | 0.50 |
| PF13262 | DUF4054 | 0.50 |
| PF00565 | SNase | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 199 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 20.10 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.51 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.51 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.51 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.51 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.51 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.51 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.51 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.01 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 1.01 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.50 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.50 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.50 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.79 % |
| All Organisms | root | All Organisms | 42.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084011|2225759857 | All Organisms → Viruses | 1696 | Open in IMG/M |
| 2236876023|PC6_p0520552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 942 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10072015 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300000493|MLSed_104931 | Not Available | 729 | Open in IMG/M |
| 3300001533|MLSed_10065009 | Not Available | 1884 | Open in IMG/M |
| 3300001533|MLSed_10097814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
| 3300001580|Draft_10146950 | Not Available | 1145 | Open in IMG/M |
| 3300001605|Draft_10046671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3628 | Open in IMG/M |
| 3300001970|GOS2248_10037248 | All Organisms → cellular organisms → Bacteria | 2739 | Open in IMG/M |
| 3300001970|GOS2248_10068253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1824 | Open in IMG/M |
| 3300001970|GOS2248_10068286 | Not Available | 3899 | Open in IMG/M |
| 3300002408|B570J29032_109424026 | Not Available | 754 | Open in IMG/M |
| 3300005346|Ga0074242_10035393 | Not Available | 6583 | Open in IMG/M |
| 3300005346|Ga0074242_11229872 | Not Available | 38652 | Open in IMG/M |
| 3300005613|Ga0074649_1015943 | Not Available | 4661 | Open in IMG/M |
| 3300006025|Ga0075474_10025319 | Not Available | 2120 | Open in IMG/M |
| 3300006026|Ga0075478_10006899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 3943 | Open in IMG/M |
| 3300006026|Ga0075478_10057218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS1 | 1272 | Open in IMG/M |
| 3300006637|Ga0075461_10080349 | Not Available | 1036 | Open in IMG/M |
| 3300006637|Ga0075461_10233993 | Not Available | 542 | Open in IMG/M |
| 3300006639|Ga0079301_1001521 | Not Available | 10619 | Open in IMG/M |
| 3300006639|Ga0079301_1019128 | All Organisms → Viruses | 2413 | Open in IMG/M |
| 3300006802|Ga0070749_10002838 | All Organisms → Viruses | 11617 | Open in IMG/M |
| 3300006802|Ga0070749_10074505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2032 | Open in IMG/M |
| 3300006802|Ga0070749_10103596 | Not Available | 1681 | Open in IMG/M |
| 3300006802|Ga0070749_10127689 | Not Available | 1490 | Open in IMG/M |
| 3300006802|Ga0070749_10168840 | Not Available | 1265 | Open in IMG/M |
| 3300006802|Ga0070749_10266803 | Not Available | 966 | Open in IMG/M |
| 3300006802|Ga0070749_10276660 | Not Available | 946 | Open in IMG/M |
| 3300006810|Ga0070754_10072964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1749 | Open in IMG/M |
| 3300006810|Ga0070754_10146056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300006810|Ga0070754_10249392 | Not Available | 811 | Open in IMG/M |
| 3300006810|Ga0070754_10436205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 570 | Open in IMG/M |
| 3300006870|Ga0075479_10009164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 4461 | Open in IMG/M |
| 3300006916|Ga0070750_10330661 | Not Available | 646 | Open in IMG/M |
| 3300006919|Ga0070746_10195037 | Not Available | 967 | Open in IMG/M |
| 3300006919|Ga0070746_10319229 | Not Available | 710 | Open in IMG/M |
| 3300007344|Ga0070745_1177451 | Not Available | 796 | Open in IMG/M |
| 3300007346|Ga0070753_1092635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1187 | Open in IMG/M |
| 3300007538|Ga0099851_1068683 | All Organisms → Viruses → Predicted Viral | 1375 | Open in IMG/M |
| 3300007538|Ga0099851_1074697 | Not Available | 1309 | Open in IMG/M |
| 3300007538|Ga0099851_1099582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1108 | Open in IMG/M |
| 3300007538|Ga0099851_1121421 | Not Available | 986 | Open in IMG/M |
| 3300007538|Ga0099851_1204274 | Not Available | 718 | Open in IMG/M |
| 3300007538|Ga0099851_1332333 | Not Available | 532 | Open in IMG/M |
| 3300007539|Ga0099849_1005524 | Not Available | 5780 | Open in IMG/M |
| 3300007539|Ga0099849_1014297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3505 | Open in IMG/M |
| 3300007539|Ga0099849_1052151 | Not Available | 1700 | Open in IMG/M |
| 3300007539|Ga0099849_1052688 | Not Available | 1691 | Open in IMG/M |
| 3300007539|Ga0099849_1068487 | Not Available | 1452 | Open in IMG/M |
| 3300007539|Ga0099849_1073930 | Not Available | 1387 | Open in IMG/M |
| 3300007539|Ga0099849_1122734 | Not Available | 1021 | Open in IMG/M |
| 3300007539|Ga0099849_1134933 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 963 | Open in IMG/M |
| 3300007539|Ga0099849_1158808 | Not Available | 870 | Open in IMG/M |
| 3300007539|Ga0099849_1188138 | Not Available | 782 | Open in IMG/M |
| 3300007539|Ga0099849_1190713 | Not Available | 775 | Open in IMG/M |
| 3300007539|Ga0099849_1200967 | Not Available | 750 | Open in IMG/M |
| 3300007539|Ga0099849_1203828 | Not Available | 743 | Open in IMG/M |
| 3300007539|Ga0099849_1204092 | Not Available | 743 | Open in IMG/M |
| 3300007541|Ga0099848_1053421 | Not Available | 1622 | Open in IMG/M |
| 3300007541|Ga0099848_1090916 | Not Available | 1180 | Open in IMG/M |
| 3300007541|Ga0099848_1097511 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 1131 | Open in IMG/M |
| 3300007541|Ga0099848_1162764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 819 | Open in IMG/M |
| 3300007541|Ga0099848_1240162 | Not Available | 637 | Open in IMG/M |
| 3300007559|Ga0102828_1164477 | Not Available | 560 | Open in IMG/M |
| 3300007640|Ga0070751_1035275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2276 | Open in IMG/M |
| 3300007640|Ga0070751_1130419 | Not Available | 1018 | Open in IMG/M |
| 3300007640|Ga0070751_1203962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300007960|Ga0099850_1068620 | Not Available | 1490 | Open in IMG/M |
| 3300007960|Ga0099850_1347018 | Not Available | 556 | Open in IMG/M |
| 3300009124|Ga0118687_10358370 | Not Available | 558 | Open in IMG/M |
| 3300009149|Ga0114918_10003666 | Not Available | 13496 | Open in IMG/M |
| 3300009149|Ga0114918_10545258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 617 | Open in IMG/M |
| 3300009168|Ga0105104_10298169 | Not Available | 885 | Open in IMG/M |
| 3300009450|Ga0127391_1018517 | Not Available | 1443 | Open in IMG/M |
| 3300009466|Ga0126448_1100197 | Not Available | 656 | Open in IMG/M |
| 3300009480|Ga0127405_1046168 | All Organisms → Viruses | 1109 | Open in IMG/M |
| 3300009480|Ga0127405_1068959 | Not Available | 905 | Open in IMG/M |
| 3300009504|Ga0114946_10019202 | Not Available | 4119 | Open in IMG/M |
| 3300009504|Ga0114946_10115128 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 1492 | Open in IMG/M |
| 3300009504|Ga0114946_10189102 | Not Available | 1116 | Open in IMG/M |
| 3300009504|Ga0114946_10193912 | Not Available | 1099 | Open in IMG/M |
| 3300009563|Ga0130030_1034335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 779 | Open in IMG/M |
| 3300009860|Ga0130032_1058838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300009917|Ga0132239_105754 | Not Available | 710 | Open in IMG/M |
| 3300010296|Ga0129348_1010153 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 3422 | Open in IMG/M |
| 3300010296|Ga0129348_1013808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 2935 | Open in IMG/M |
| 3300010296|Ga0129348_1018433 | Not Available | 2542 | Open in IMG/M |
| 3300010296|Ga0129348_1258031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 585 | Open in IMG/M |
| 3300010296|Ga0129348_1302689 | Not Available | 533 | Open in IMG/M |
| 3300010297|Ga0129345_1094656 | Not Available | 1110 | Open in IMG/M |
| 3300010297|Ga0129345_1096166 | Not Available | 1100 | Open in IMG/M |
| 3300010297|Ga0129345_1120148 | Not Available | 963 | Open in IMG/M |
| 3300010299|Ga0129342_1127644 | Not Available | 940 | Open in IMG/M |
| 3300010299|Ga0129342_1156930 | Not Available | 827 | Open in IMG/M |
| 3300010300|Ga0129351_1289342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300010300|Ga0129351_1306940 | Not Available | 600 | Open in IMG/M |
| 3300010300|Ga0129351_1400179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
| 3300010300|Ga0129351_1408314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 506 | Open in IMG/M |
| 3300010318|Ga0136656_1017480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2604 | Open in IMG/M |
| 3300010318|Ga0136656_1214800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 641 | Open in IMG/M |
| 3300010318|Ga0136656_1280962 | Not Available | 544 | Open in IMG/M |
| 3300010354|Ga0129333_10001096 | Not Available | 24124 | Open in IMG/M |
| 3300010354|Ga0129333_10052979 | All Organisms → Viruses | 3798 | Open in IMG/M |
| 3300010354|Ga0129333_10143063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 2197 | Open in IMG/M |
| 3300010354|Ga0129333_10199339 | Not Available | 1821 | Open in IMG/M |
| 3300010354|Ga0129333_10369142 | All Organisms → Viruses | 1274 | Open in IMG/M |
| 3300010354|Ga0129333_10547731 | Not Available | 1009 | Open in IMG/M |
| 3300010354|Ga0129333_10743316 | Not Available | 840 | Open in IMG/M |
| 3300010354|Ga0129333_10807690 | Not Available | 799 | Open in IMG/M |
| 3300010354|Ga0129333_11778887 | Not Available | 500 | Open in IMG/M |
| 3300010389|Ga0136549_10056133 | Not Available | 2008 | Open in IMG/M |
| 3300013004|Ga0164293_10041905 | Not Available | 3738 | Open in IMG/M |
| 3300013004|Ga0164293_10065008 | Not Available | 2888 | Open in IMG/M |
| 3300013004|Ga0164293_10456080 | Not Available | 851 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10016711 | Not Available | 8062 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10084516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 2772 | Open in IMG/M |
| 3300014309|Ga0075317_1099040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10105389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 1994 | Open in IMG/M |
| 3300017697|Ga0180120_10427685 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300017788|Ga0169931_10097065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Cyanophage S-2L | 2848 | Open in IMG/M |
| 3300017963|Ga0180437_10024207 | Not Available | 6424 | Open in IMG/M |
| 3300017963|Ga0180437_10210106 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 1525 | Open in IMG/M |
| 3300017963|Ga0180437_10496929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 900 | Open in IMG/M |
| 3300019756|Ga0194023_1002489 | Not Available | 3658 | Open in IMG/M |
| 3300019756|Ga0194023_1003606 | All Organisms → Viruses | 3095 | Open in IMG/M |
| 3300019756|Ga0194023_1039576 | Not Available | 951 | Open in IMG/M |
| 3300019765|Ga0194024_1048110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300019937|Ga0194022_1002962 | Not Available | 2202 | Open in IMG/M |
| 3300020514|Ga0208202_1005985 | Not Available | 1749 | Open in IMG/M |
| 3300021356|Ga0213858_10196457 | Not Available | 980 | Open in IMG/M |
| 3300021379|Ga0213864_10051095 | Not Available | 1977 | Open in IMG/M |
| 3300021379|Ga0213864_10144258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300021389|Ga0213868_10105840 | Not Available | 1806 | Open in IMG/M |
| 3300021425|Ga0213866_10087844 | Not Available | 1708 | Open in IMG/M |
| 3300021425|Ga0213866_10336150 | Not Available | 749 | Open in IMG/M |
| 3300022176|Ga0212031_1068171 | Not Available | 604 | Open in IMG/M |
| 3300022183|Ga0196891_1059956 | Not Available | 684 | Open in IMG/M |
| 3300022198|Ga0196905_1015098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2488 | Open in IMG/M |
| 3300022198|Ga0196905_1020290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 2085 | Open in IMG/M |
| 3300022198|Ga0196905_1169415 | Not Available | 556 | Open in IMG/M |
| 3300024262|Ga0210003_1024914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3499 | Open in IMG/M |
| 3300024262|Ga0210003_1050233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 2133 | Open in IMG/M |
| 3300024289|Ga0255147_1000048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 63206 | Open in IMG/M |
| 3300024502|Ga0255181_1027149 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 1076 | Open in IMG/M |
| 3300025135|Ga0209498_1000085 | Not Available | 50288 | Open in IMG/M |
| 3300025135|Ga0209498_1055083 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 1782 | Open in IMG/M |
| 3300025135|Ga0209498_1121003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
| 3300025135|Ga0209498_1298977 | Not Available | 547 | Open in IMG/M |
| 3300025135|Ga0209498_1315772 | Not Available | 526 | Open in IMG/M |
| 3300025543|Ga0208303_1029890 | All Organisms → Viruses | 1457 | Open in IMG/M |
| 3300025647|Ga0208160_1170382 | Not Available | 513 | Open in IMG/M |
| 3300025655|Ga0208795_1083490 | Not Available | 881 | Open in IMG/M |
| 3300025674|Ga0208162_1004179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 6804 | Open in IMG/M |
| 3300025674|Ga0208162_1018223 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2759 | Open in IMG/M |
| 3300025674|Ga0208162_1020154 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 2585 | Open in IMG/M |
| 3300025674|Ga0208162_1035805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1771 | Open in IMG/M |
| 3300025674|Ga0208162_1055238 | Not Available | 1314 | Open in IMG/M |
| 3300025674|Ga0208162_1066559 | All Organisms → Viruses | 1153 | Open in IMG/M |
| 3300025674|Ga0208162_1068282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Candidatus Acidulodesulfobacterales → Candidatus Acididesulfobacter → Candidatus Acididesulfobacter diazotrophicus | 1131 | Open in IMG/M |
| 3300025674|Ga0208162_1069859 | Not Available | 1114 | Open in IMG/M |
| 3300025674|Ga0208162_1083230 | Not Available | 985 | Open in IMG/M |
| 3300025687|Ga0208019_1140256 | Not Available | 693 | Open in IMG/M |
| 3300025687|Ga0208019_1206058 | Not Available | 511 | Open in IMG/M |
| 3300025769|Ga0208767_1256327 | Not Available | 542 | Open in IMG/M |
| 3300025853|Ga0208645_1075320 | All Organisms → Viruses | 1487 | Open in IMG/M |
| 3300025889|Ga0208644_1003645 | All Organisms → Viruses | 11845 | Open in IMG/M |
| 3300025889|Ga0208644_1054141 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 2204 | Open in IMG/M |
| 3300025889|Ga0208644_1247679 | Not Available | 739 | Open in IMG/M |
| 3300027114|Ga0208009_1000095 | All Organisms → cellular organisms → Bacteria | 24205 | Open in IMG/M |
| 3300027114|Ga0208009_1009167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2491 | Open in IMG/M |
| 3300027805|Ga0209229_10371561 | Not Available | 623 | Open in IMG/M |
| 3300027917|Ga0209536_100016037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10664 | Open in IMG/M |
| 3300027917|Ga0209536_100122051 | Not Available | 3304 | Open in IMG/M |
| 3300027917|Ga0209536_100264912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2152 | Open in IMG/M |
| 3300027917|Ga0209536_101559522 | Not Available | 802 | Open in IMG/M |
| 3300027917|Ga0209536_103088562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300031539|Ga0307380_10356297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 1335 | Open in IMG/M |
| 3300031539|Ga0307380_10786607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 788 | Open in IMG/M |
| 3300031565|Ga0307379_10057088 | Not Available | 4441 | Open in IMG/M |
| 3300031566|Ga0307378_10444250 | Not Available | 1178 | Open in IMG/M |
| 3300031578|Ga0307376_10878423 | Not Available | 548 | Open in IMG/M |
| 3300031673|Ga0307377_10360687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 1088 | Open in IMG/M |
| 3300031952|Ga0315294_10897217 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage | 751 | Open in IMG/M |
| 3300033557|Ga0316617_100654785 | Not Available | 984 | Open in IMG/M |
| 3300033979|Ga0334978_0499389 | Not Available | 567 | Open in IMG/M |
| 3300033980|Ga0334981_0007551 | All Organisms → cellular organisms → Bacteria | 6308 | Open in IMG/M |
| 3300033981|Ga0334982_0000716 | All Organisms → cellular organisms → Bacteria | 20466 | Open in IMG/M |
| 3300033996|Ga0334979_0050310 | Not Available | 2704 | Open in IMG/M |
| 3300034012|Ga0334986_0014854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 5448 | Open in IMG/M |
| 3300034063|Ga0335000_0156607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1505 | Open in IMG/M |
| 3300034073|Ga0310130_0000681 | Not Available | 23372 | Open in IMG/M |
| 3300034101|Ga0335027_0152512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 1694 | Open in IMG/M |
| 3300034101|Ga0335027_0158180 | Not Available | 1655 | Open in IMG/M |
| 3300034375|Ga0348336_125719 | Not Available | 810 | Open in IMG/M |
| 3300034418|Ga0348337_048664 | All Organisms → Viruses | 1731 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 40.20% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 14.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.54% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 4.52% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.02% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.51% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.51% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.01% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 2.01% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.01% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 1.51% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.51% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.51% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.51% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.00% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.50% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.50% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.50% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.50% |
| Coastal Lagoon | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon | 0.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.50% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.50% |
| Saline Water Concentrator Pond | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond | 0.50% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.50% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084011 | Coastal lagoon microbial communities from Albufera, Spain - Sample 1 | Environmental | Open in IMG/M |
| 2236876023 | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000493 | Lentic microbial communities from White Lake grasslands, BC, Canada | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001970 | Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009480 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 10m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009563 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009860 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 12m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009917 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, 8m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014309 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2225172298 | 2222084011 | Coastal Lagoon | MSRDEIQHLIDRAIRQHELRVALWSGLAGALLMAGTWHAIWLCR |
| PC6_05205524 | 2236876023 | Saline Water Concentrator Pond | MRLMTDEDITKLVNDAIRQHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSLR |
| DelMOWin2010_100720154 | 3300000117 | Marine | MDDRQIQHLIDHAIREHELRVALWSGLLGLLLLLGTWHAIWLCK* |
| MLSed_1049312 | 3300000493 | Lentic | MTDEDITKLVNDAIRHHELRVALWSGLLGAALMTGTWHAIWLCRNLTLSLR* |
| MLSed_100650093 | 3300001533 | Benthic | MSDEEIMKAIHGAIRQHELRVAFWSGLLGAALLAGT* |
| MLSed_100978144 | 3300001533 | Benthic | MSDEEIMEAIHGAIRQHELRVAFWSGLLGAALLAGT* |
| Draft_101469503 | 3300001580 | Hydrocarbon Resource Environments | MSEEEIKAFVHRSIREHELRVALWSGLLGLVLMAGTWHAILLCQKG* |
| Draft_100466719 | 3300001605 | Hydrocarbon Resource Environments | MSEEEIKAFVHRSIRDHELRVALWSGLFGAALMAGTWHAILLCR* |
| GOS2248_100372485 | 3300001970 | Hypersaline | MRLMTDEDITKLVNDAIRQHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSLR* |
| GOS2248_100682535 | 3300001970 | Hypersaline | MEDSRLMSDEDITKMVDDAIRHHELRVALWSGILGVVLTAGTWHAIWLCR* |
| GOS2248_100682862 | 3300001970 | Hypersaline | MTNEDITKLINDAIRQHELRVALWSGLLGAALMTGTWHAIWLCRNLTLSLR* |
| B570J29032_1094240262 | 3300002408 | Freshwater | MSQEGVRLMVDRAIRDHEIRVALWPGLLGALLMAGTWHAICLPATGKLP* |
| Ga0074242_100353937 | 3300005346 | Saline Water And Sediment | MTDEDITKLVDDAIRQHELRVASWSGLLGAALMAGTWLCQFWLCRDLTLSLR* |
| Ga0074242_112298724 | 3300005346 | Saline Water And Sediment | MTDEDITKLVDDAIRQHELRVASWSGLLGAALMAGTWHAIWLCRDLTLSLR* |
| Ga0074649_10159437 | 3300005613 | Saline Water And Sediment | MTDEDITKLVNDAIRQHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSLR* |
| Ga0075474_100253193 | 3300006025 | Aqueous | MRLMTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR* |
| Ga0075478_100068992 | 3300006026 | Aqueous | MTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR* |
| Ga0075478_100572181 | 3300006026 | Aqueous | MTPDEIQSAINRAIRDHEIRVAFWSGLMGAMLLFGTWHA |
| Ga0075461_100803493 | 3300006637 | Aqueous | MTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCK* |
| Ga0075461_102339931 | 3300006637 | Aqueous | MEEDKLPEAITKAIDDAIRAHELRVALWSGLLGAIIMAGTWHAIRLCY |
| Ga0079301_10015215 | 3300006639 | Deep Subsurface | VRELVAAAIREHQLRVALWSGLMGALLMAGTWHAIWMCR* |
| Ga0079301_10191281 | 3300006639 | Deep Subsurface | VSREDVQRLVAAAIREHELRVALWPGLAGALLMGGTWHAIWLCRQQFVN* |
| Ga0070749_100028382 | 3300006802 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGLLLLLGTWHAIWLCK* |
| Ga0070749_100745053 | 3300006802 | Aqueous | MEEDKLPEAITKAIDDAIRAHELRVASWSGLLGAIIMAGTWHAIRLCYVR* |
| Ga0070749_101035962 | 3300006802 | Aqueous | MTEEEMKAFVHRSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP* |
| Ga0070749_101276892 | 3300006802 | Aqueous | LMTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCR* |
| Ga0070749_101688401 | 3300006802 | Aqueous | MTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCR* |
| Ga0070749_102668032 | 3300006802 | Aqueous | MDDRRVQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWLCK* |
| Ga0070749_102766602 | 3300006802 | Aqueous | MTEEEMKAFVHRSIREHELRVALWSGLLGIALMAGTWHAIWLCRLP* |
| Ga0070754_100729642 | 3300006810 | Aqueous | MDDRQIQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWLCK* |
| Ga0070754_101460563 | 3300006810 | Aqueous | MTPEDITKAIDDAIRQHELRVALWSGLMGAVLLAGTWHAILLCK* |
| Ga0070754_102493922 | 3300006810 | Aqueous | EEEMKAFVHRSIREHELRVALWSGLLGIALMAGTWHAIWLCRLP* |
| Ga0070754_104362052 | 3300006810 | Aqueous | MDDRHVQQLIDRAIREHELRVALWSGLLGLLLMAGTWHAIWLCR* |
| Ga0075479_100091645 | 3300006870 | Aqueous | MRLMKDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR* |
| Ga0070750_103306612 | 3300006916 | Aqueous | MTEEEMKAFVHHSIREHELRVALWSGLLGAALMAGMWHAIWLCRLP* |
| Ga0070746_101950373 | 3300006919 | Aqueous | EDITKAIDDAIRQHELRVALWSGLMGAVLLAGTWHAILLCK* |
| Ga0070746_103192292 | 3300006919 | Aqueous | SIREHELRVALWSGLLGAALMAGTWHAIWLCRLP* |
| Ga0070745_11774512 | 3300007344 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGPLLMAGTWHAIWLCK* |
| Ga0070753_10926354 | 3300007346 | Aqueous | MTPDEIQSAIDRAIRDHEIRVAFWSGLMGAMLLFGTWHAIWL |
| Ga0099851_10686835 | 3300007538 | Aqueous | MEQQEIQKLIDHAIQKHELRVAVWSGLLGLLLMAGTWHAIWMCR* |
| Ga0099851_10746974 | 3300007538 | Aqueous | MDDRHVQQLIDRAIREHELRVALWSGLLGLLLMAGTWHAI* |
| Ga0099851_10995822 | 3300007538 | Aqueous | MSQQEIQALIDRAIREHELRVALWSGLLGLLLMAGTWHAIWLCR* |
| Ga0099851_11089612 | 3300007538 | Aqueous | MSDKHSPSMVDEASMVNEAIRKAIDDAIRQHELRVAFWSGLMGAILLAGTWHAILLCR* |
| Ga0099851_11214211 | 3300007538 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGLLLLLGTWHAIWMCR* |
| Ga0099851_12042742 | 3300007538 | Aqueous | MTEEQIQLMINRAIVAHELRVAFWSGVLGALLLFGTWHAIWLLR* |
| Ga0099851_13323331 | 3300007538 | Aqueous | MNREEVRDLVNGAIREHEIRVALWSGLLGAALMAGTWHAIWMCR* |
| Ga0099849_10055247 | 3300007539 | Aqueous | MSEQEITQLIDKAIHAHEVRVALWSGLLGCLLTAGTWHAIWLSSH* |
| Ga0099849_10142971 | 3300007539 | Aqueous | MSEREIEALINQAIREHELRVAIWSGLLGAILLFGTWHAIWLCR* |
| Ga0099849_10521512 | 3300007539 | Aqueous | MKDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSLR* |
| Ga0099849_10526883 | 3300007539 | Aqueous | MDDRHIQLLIDRAIREHELRVALWSGLLGLLLLCGTWHAIWMCR* |
| Ga0099849_10684872 | 3300007539 | Aqueous | MTPEDITKAIDDAIRQHELRVALWSGLMGAVLLAGTWHAILLCR* |
| Ga0099849_10739304 | 3300007539 | Aqueous | VSQEDVRELVAAAIREHELRVALWSGLLGAALMAGTWHAIWMCR* |
| Ga0099849_11227344 | 3300007539 | Aqueous | MTEEEMKAFVHHSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP* |
| Ga0099849_11349331 | 3300007539 | Aqueous | AFVHHSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP* |
| Ga0099849_11588081 | 3300007539 | Aqueous | MDDRHIQLLIDRAIREHELRVAIWSGLLGLLLLLGTWHAIWMCR* |
| Ga0099849_11881382 | 3300007539 | Aqueous | MSDKHSPSMVDEASMVNEAIRKAIDDAIRQHELRVAFWSGLMGAVLLAGTWHAILLCR* |
| Ga0099849_11907132 | 3300007539 | Aqueous | HPWMEQENIQQLIDRAIRAHEIRVALWSGLLGLIFTAGTWHAIWMCR* |
| Ga0099849_12009673 | 3300007539 | Aqueous | MEQQEIQKLIDHAIQKHELRVAAWSGLLGLLLMAGTWHAIWMCR* |
| Ga0099849_12038281 | 3300007539 | Aqueous | MTIKASSSMVDETIRKAIDDAIRQHELRVALWSGLLGAVLMAGTWHAIWLCR* |
| Ga0099849_12040921 | 3300007539 | Aqueous | MDDRHVQKLIDRAIREHELRVALWSGLLGLLLMAGTWHAIWLCR* |
| Ga0099848_10534213 | 3300007541 | Aqueous | VSREDVERLVDTAIREHELRVALWSGLLGALLMAGTWHAIWLCR* |
| Ga0099848_10909163 | 3300007541 | Aqueous | MNREEVRGLVNGAIREHEIRVALWSGLLGAVVMAGTWHAIWMCR* |
| Ga0099848_10975112 | 3300007541 | Aqueous | MTEEEMKAFVRRSIREHELRVALWSGLLGIALMAGTWHAIWLCRLP* |
| Ga0099848_11627642 | 3300007541 | Aqueous | MSQEDVRELVNGAIREHEIRVALWSGLLGAVVMAGTWHAIWLCR* |
| Ga0099848_12401623 | 3300007541 | Aqueous | MSREDVEQLVADAIRQHELRVALWASLAGALLMAGTWH |
| Ga0099846_10589205 | 3300007542 | Aqueous | MSDKHSPSMVDEASMVDEAIRKAIDDAIRQHELRVAFWSGLMGAILLAGTWHAILLCR* |
| Ga0102828_11644773 | 3300007559 | Estuarine | MSSDDVQRLVAAAIREHELRVALWSGLLGAALMGGTWHAIWLC |
| Ga0070751_10352756 | 3300007640 | Aqueous | MTPDEIQSAIDRAIRDHEIRVAFWSGLMGAMLLFGTWH |
| Ga0070751_11304195 | 3300007640 | Aqueous | MDDRQIQHLIDHAIREHELRVALWSGLLGPLLMAGTWHAIWLCK* |
| Ga0070751_12039622 | 3300007640 | Aqueous | MTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGPWHAILLCK* |
| Ga0099850_10686203 | 3300007960 | Aqueous | MDDRHIQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWMCR* |
| Ga0099850_13470181 | 3300007960 | Aqueous | MSQHEIQAMIDRAIREHELRVALWSGLLGALLMAGTWHAIWMCR* |
| Ga0118687_103583702 | 3300009124 | Sediment | VSREDVQRLVAAAIREHELRVALWSGLAGALLMGGTWHAIWLCR* |
| Ga0114918_1000366620 | 3300009149 | Deep Subsurface | MSQHEVKELIDRAIREHELRVALWSGLLGAALMAGTWHAIWISR* |
| Ga0114918_105452582 | 3300009149 | Deep Subsurface | MSRDDVRDLVAAAIREQELRVALWSGLMGAVLMAGTWHAIWLCR* |
| Ga0105104_102981691 | 3300009168 | Freshwater Sediment | MSKQEIQHLINCAIREHELRVALWSGLAGALLMAGTWHAIWLCR* |
| Ga0127391_10185171 | 3300009450 | Meromictic Pond | MTPEDITKAIDDAIRHHELRVALWGGLMGAVLLAGTWHAILLCK* |
| Ga0126448_11001971 | 3300009466 | Meromictic Pond | MTPEDITKAIDDAIRHHELRVALWGGLMGAVLLAGTWH |
| Ga0127405_10461681 | 3300009480 | Meromictic Pond | MDDRQIQHLIDHAIREHELRVALWSGLLGLLLLLGTWH |
| Ga0127405_10689592 | 3300009480 | Meromictic Pond | MTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSLR* |
| Ga0114946_100192026 | 3300009504 | Sediment | MTLRLMSEEEIQAFVHRSIREHELRVALWSGLLGAALMAGTWHAILLCR* |
| Ga0114946_101151282 | 3300009504 | Sediment | MTEQEIKALVHGAIRAHELRVAFWSGIMGAVLLAGTWHAILLCK* |
| Ga0114946_101891023 | 3300009504 | Sediment | MSEEDITRAIHDAIRQHELRVALWSGLFGAALMAGTWHAILLCR* |
| Ga0114946_101939121 | 3300009504 | Sediment | MTEQEIKALVHGAIRAHELRVAFWSGIMGAVLLAGTWHAILLCR* |
| Ga0130030_10343353 | 3300009563 | Meromictic Pond | MSHEDVRDLVAAAIRQHELRVALWSGLLGAALMGGTWHAI |
| Ga0130032_10588382 | 3300009860 | Meromictic Pond | MTPEDITKAIDDAIRHHELRVALWSGLVGAVLLAGTWHAILLCK* |
| Ga0132239_1057541 | 3300009917 | Meromictic Pond | MSKQEIQHLIDHAIREHELRVALWSGLLGLLLLLGTWHAIWMCR* |
| Ga0129348_10101532 | 3300010296 | Freshwater To Marine Saline Gradient | MEQENIQQLIDRAIRAHEIRVALWSGLLGLIFTAGTWHAIWMCR* |
| Ga0129348_10138082 | 3300010296 | Freshwater To Marine Saline Gradient | MTEEQIQLMINRAIVAHELRVAFWSGALGALLLFGTWHAIWLLR* |
| Ga0129348_10184336 | 3300010296 | Freshwater To Marine Saline Gradient | MSQEDIQQLIHNAIRQHELRVALWSGLLGAVLLFGTWHAIWLCR* |
| Ga0129348_12273032 | 3300010296 | Freshwater To Marine Saline Gradient | MSDKHSPSMVDEASMVDEASMVNEAIRKAIDDAIRQHELRVAFWSGLMGAVLLAGTWHAILLCR* |
| Ga0129348_12580311 | 3300010296 | Freshwater To Marine Saline Gradient | MEQQEIQKLIDHAIQKHELRVAAWSGLLGLLLMAGTWHA |
| Ga0129348_13026892 | 3300010296 | Freshwater To Marine Saline Gradient | VIREDVERLVAAAIREHELRVALWSGLLGAALMAGTWHAIWMCR* |
| Ga0129345_10946561 | 3300010297 | Freshwater To Marine Saline Gradient | MTEEEMKAFVHRSIREHELRVALWSGLLGITLMAGTWHAIWLCRLP* |
| Ga0129345_10961664 | 3300010297 | Freshwater To Marine Saline Gradient | MDDRHIQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWM |
| Ga0129345_11201481 | 3300010297 | Freshwater To Marine Saline Gradient | MDDRQIQLLIDRAIREHELRVALWSGLLGLLLLLGT |
| Ga0129342_11276444 | 3300010299 | Freshwater To Marine Saline Gradient | MEQQEIQKPIDHAIQKHELRVAVWSGLLGLLLMAGTWHAIWMCR* |
| Ga0129342_11569301 | 3300010299 | Freshwater To Marine Saline Gradient | IDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCK* |
| Ga0129351_12893421 | 3300010300 | Freshwater To Marine Saline Gradient | MTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGTWHAIL |
| Ga0129351_13069403 | 3300010300 | Freshwater To Marine Saline Gradient | MTPEDITKAIDDAIRQHELRVALWSGLMGAVLLAGT |
| Ga0129351_14001792 | 3300010300 | Freshwater To Marine Saline Gradient | MGQHEIQALIDRAIRAHELRVALWSGLAGLLLMAGTWHAIWLCR* |
| Ga0129351_14083143 | 3300010300 | Freshwater To Marine Saline Gradient | MRLITDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSL |
| Ga0136656_10174804 | 3300010318 | Freshwater To Marine Saline Gradient | MDRQELETIINKAIRQHELRVALISGILGAALLAGTWHAIWLCRP* |
| Ga0136656_12148003 | 3300010318 | Freshwater To Marine Saline Gradient | MSEREIEALINQAIREHELRVAIWSGLLGAMLLVGTWHA |
| Ga0136656_12809622 | 3300010318 | Freshwater To Marine Saline Gradient | MDDRQIQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWMCR* |
| Ga0129333_1000109631 | 3300010354 | Freshwater To Marine Saline Gradient | MTEEQIQLMINRAIVAHELRVAFWSGVLGATLLFGTWHAIWMLR* |
| Ga0129333_100529796 | 3300010354 | Freshwater To Marine Saline Gradient | MAMDDRRVQLLIDRAISAHELRVALSSGLLGLLLMAGTWHAIWMCR* |
| Ga0129333_101430634 | 3300010354 | Freshwater To Marine Saline Gradient | MSREDVQQLVAAAIREHELRVALWSGLLGAALMAGTWHAIWLCR* |
| Ga0129333_101993392 | 3300010354 | Freshwater To Marine Saline Gradient | MTEEEMKAFVHRSIREHELRVALWSGLLGAALLAGTWHAIRLCYLH* |
| Ga0129333_103691422 | 3300010354 | Freshwater To Marine Saline Gradient | MSREDVERLVADAIRQHELRVALWSGLAGALLMAGTWHAIWLCR* |
| Ga0129333_105477312 | 3300010354 | Freshwater To Marine Saline Gradient | MSREDVQQLVAAAIRDHELRVALWSGLLGAALMAGTWHAIWLCR* |
| Ga0129333_107433161 | 3300010354 | Freshwater To Marine Saline Gradient | MDEQQVRDIVNAAIRDHEIRVAVMSAVMGVVLLIGTWHAIWLLR* |
| Ga0129333_108076902 | 3300010354 | Freshwater To Marine Saline Gradient | MNREEVRDLVNGAIREHEIRVALWSGLLGAVVMAGTWHAIWMCR* |
| Ga0129333_117788871 | 3300010354 | Freshwater To Marine Saline Gradient | VSREDVQRLVAAAIREHELRVALWSGLAGALVMGGTWHAIWMCR* |
| Ga0136549_100561332 | 3300010389 | Marine Methane Seep Sediment | MKAFVHRSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP* |
| Ga0164293_1004190511 | 3300013004 | Freshwater | VSREDVQRLVAAAIREHELRVALWSGLLGAALMAGTWHAIWLCR* |
| Ga0164293_100650083 | 3300013004 | Freshwater | MSEEEIKAFVHRSIREHELRVALWSGLLGAALMAGTWHAIRLCYIS* |
| Ga0164293_104560802 | 3300013004 | Freshwater | VSREDVRELVAAAIREHELRVALWSGMAGALLMAGTWHAIWLCR* |
| (restricted) Ga0172373_1001671111 | 3300013131 | Freshwater | MSRDEVQHLIDRAIRQHELRVAWWSGLAGALLMAGTWHAIWLCR* |
| (restricted) Ga0172372_100845162 | 3300013132 | Freshwater | MSQQEVQLLINRAIREHELRVALWSGLAGAALMAGTWHAIWLCR* |
| Ga0075317_10990403 | 3300014309 | Natural And Restored Wetlands | MGEEEIKAFVHRSIRQHELRVALWSGLFGAALMAGTWHAILLCR* |
| (restricted) Ga0172376_101053893 | 3300014720 | Freshwater | MSQQEVQLLINRAIREHVLRVALWSGLAGAALMAGTWHAIWLCR* |
| Ga0180120_104276852 | 3300017697 | Freshwater To Marine Saline Gradient | MDDRQIQHLIDHAIREHELRVALWSGLLGLLLLLGTWHAIWMCR |
| Ga0169931_100970655 | 3300017788 | Freshwater | MNREDVRNLVNGAIREHEIRVALWSGLLGAALMAGTWHAIWMCR |
| Ga0180437_100242073 | 3300017963 | Hypersaline Lake Sediment | MRLMTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCRNLTLSLR |
| Ga0180437_102101062 | 3300017963 | Hypersaline Lake Sediment | MTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCK |
| Ga0180437_104969293 | 3300017963 | Hypersaline Lake Sediment | MRLMEDSRLMNDEDITKMVDDAIRHHELRVALWSGILGAVLTAGTWHAIWLCR |
| Ga0194023_10024895 | 3300019756 | Freshwater | MTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR |
| Ga0194023_10036066 | 3300019756 | Freshwater | MSQEDIQQLIHNAIRQHELRVALWSGLLGAVLLFGTWHAIWLCR |
| Ga0194023_10395762 | 3300019756 | Freshwater | MTEEEMKAFVYRSIREHELRVALWSGLLGIALMAGTWHAIWLCRLP |
| Ga0194024_10481102 | 3300019765 | Freshwater | MKDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR |
| Ga0194022_10029623 | 3300019937 | Freshwater | MRLMTDEDITKLVNDAIRHHELRVALWSGLLGAALMAGTWHAIWLCR |
| Ga0208202_10059854 | 3300020514 | Freshwater | VSREDVQRLVAAAIREHELRVALWSGLLGAALMAGTWHAIWLCR |
| Ga0213858_101964573 | 3300021356 | Seawater | MSEQEITQLIDKAIHAHEVRVALWSGLLGCLLTAGTWHAIWLSSH |
| Ga0213864_100510952 | 3300021379 | Seawater | MGTRVAGVVMSQEDIQQLIHNAIRQHELRVALWSGLLGAVLLFGTWHAIWLCR |
| Ga0213864_101442581 | 3300021379 | Seawater | MRLMKDEDITKLVNDAIRHHELRVALWSGLLGAALIAGTWHAIWLCRNLTLSLR |
| Ga0213868_101058403 | 3300021389 | Seawater | IDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCK |
| Ga0213866_100878443 | 3300021425 | Seawater | MTPEDITKAINDAIRQHELRVALWSGLMGAVLLAGTWHAILLCR |
| Ga0213866_103361502 | 3300021425 | Seawater | MTPEDITKAIDDAIRHHELRVALWSGLMGAVLLAGTWHAILLCR |
| Ga0212031_10681712 | 3300022176 | Aqueous | MTEEEMKSFVHRSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP |
| Ga0196891_10599562 | 3300022183 | Aqueous | MDDRQIQHLIDHAIREHELRVALWSGLLGLLLLLGTWHAIWLCK |
| Ga0196905_10150981 | 3300022198 | Aqueous | MDDRHVQQLIDRAIREHELRVALWSGLLGLLLMAGTWHAI |
| Ga0196905_10202903 | 3300022198 | Aqueous | MTEEQIQLMINRAIVAHELRVAFWSGVLGALLLFGTWHAIWLLR |
| Ga0196905_11694151 | 3300022198 | Aqueous | MDDRHVQQLIDRAIREHELRVALWSGLLGLLLMAGTWHAIWLCR |
| Ga0210003_10249144 | 3300024262 | Deep Subsurface | MSQHEVKELIDRAIREHELRVALWSGLLGAALMAGTWHAIWISR |
| Ga0210003_10502331 | 3300024262 | Deep Subsurface | GARMAPEDIQHLIDRAIRDHEMRVALWSGLLGALLMAGTWHAIWLCR |
| Ga0255147_100004861 | 3300024289 | Freshwater | MTEEEMKAFVHRSIREHELRVALWSGLLGAALLAGTWHAIRLCYLH |
| Ga0255181_10271492 | 3300024502 | Freshwater | LMTEEEMKAFVHRSIREHELRVALWSGLLGAALLAGTWHAIRLCYLH |
| Ga0209498_10000851 | 3300025135 | Sediment | QEIQQLINRAIREHELRVAFWSGLLGAALMAGTWHAIWLCR |
| Ga0209498_10550831 | 3300025135 | Sediment | MTEQEIKALVHGAIRAHELRVAFWSGIMGAVLLAGTWHAILLCK |
| Ga0209498_11210031 | 3300025135 | Sediment | MTPEDIRKAIDGAIRAHELRVAFWSGIMGAVLLAGTWHAILL |
| Ga0209498_12989771 | 3300025135 | Sediment | EEIQAFVHRSIREHELRVALWSGLLGAALMAGTWHAILLCR |
| Ga0209498_13157722 | 3300025135 | Sediment | MTEQEIKALVHGAIRAHELRVAFWSGIMGAVLLAGTWHAILLCR |
| Ga0208303_10298905 | 3300025543 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGLLLLLGTWHAIWMCR |
| Ga0208160_11703821 | 3300025647 | Aqueous | MNREEVRDLVNGAIREHEIRVALWSGLLGAALMAGTWHAIWMCR |
| Ga0208795_10834901 | 3300025655 | Aqueous | SCYHPWMEQENIQQLIDRAIRAHEIRVALWSGLLGLIFTAGTWHAIWMCR |
| Ga0208162_100417911 | 3300025674 | Aqueous | MEQQEIQKLIDHAIQKHELRVAAWSGLLGLLLMAGTWHAIWMCR |
| Ga0208162_10182235 | 3300025674 | Aqueous | MTEEEMKAFVHHSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP |
| Ga0208162_10201545 | 3300025674 | Aqueous | MVDEASMVNEAIRKAIDDAIRQHELRVAFWSGLMGAVLLAGTWHAILLCR |
| Ga0208162_10358052 | 3300025674 | Aqueous | MTEEQIQLMINRAIVAHELRVAFWSGALGALLLFGTWHAIWLLR |
| Ga0208162_10552382 | 3300025674 | Aqueous | MDDRHIQLLIDRAIREHELRVALWSGLLGLLLLCGTWHAIWMCR |
| Ga0208162_10665595 | 3300025674 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGLLLLLGTWHAIW |
| Ga0208162_10682824 | 3300025674 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGLLLLLG |
| Ga0208162_10698593 | 3300025674 | Aqueous | MTPEDITKAIDDAIRQHELRVALWSGLMGAVLLAGTWHAILLCR |
| Ga0208162_10832304 | 3300025674 | Aqueous | MSQQEIQALIDRAIREHELRVALWSGLLGLLLMAGTWHAIWLCR |
| Ga0208019_11402562 | 3300025687 | Aqueous | MDDRHIQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWMCR |
| Ga0208019_12060582 | 3300025687 | Aqueous | KAFVHHSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP |
| Ga0208767_12563271 | 3300025769 | Aqueous | MDDRQIQHLIDHAIREHELRVALWSGLLGLLLLLGTW |
| Ga0208645_10753201 | 3300025853 | Aqueous | MDDRQIQLLIDRAIREHELRVALWSGLLGLLLLLGTWHAIWLCK |
| Ga0208644_100364524 | 3300025889 | Aqueous | MDDRQIQHLINHAIREHELRVALWSGLLGLLLLLGTWHAIWLCK |
| Ga0208644_10541412 | 3300025889 | Aqueous | MEEDKLPEAITKAIDDAIRAHELRVASWSGLLGAIIMAGTWHAIRLCYVR |
| Ga0208644_12476792 | 3300025889 | Aqueous | MKAFVHRSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP |
| Ga0208009_100009511 | 3300027114 | Deep Subsurface | VRELVAAAIREHQLRVALWSGLMGALLMAGTWHAIWMCR |
| Ga0208009_10091675 | 3300027114 | Deep Subsurface | VSREDVQRLVAAAIREHELRVALWPGLAGALLMGGTWHAIWLCRQQFVN |
| Ga0209229_103715611 | 3300027805 | Freshwater And Sediment | TMVDEAITKAIHNAIRQHELRVALWSGIMGALLLAGTWHAILLCR |
| Ga0209536_10001603714 | 3300027917 | Marine Sediment | MDHQELETIINKAIRQHELRVALISGILGAALLAGTWHAIWLCRR |
| Ga0209536_1001220512 | 3300027917 | Marine Sediment | MTEEEMKAFVHRSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP |
| Ga0209536_1002649122 | 3300027917 | Marine Sediment | MVDESIKKAIDEAIRQHELRVALWSGLLGAMLMAGTWHAIWLCR |
| Ga0209536_1015595222 | 3300027917 | Marine Sediment | MEEDKLPEAITKAIDDAIRAHELRVALWSGLLGAIIMAGTWHAIRLCYVR |
| Ga0209536_1030885622 | 3300027917 | Marine Sediment | MSDKHSPSMVDEAIKKAIDDAIRQHELRVAFWSGLMGAILLAGTWHAILLCR |
| Ga0307380_103562972 | 3300031539 | Soil | MSRDDVRDLVAAAIREHELRVALWSGLMGAVLMAGTWHAIWLCR |
| Ga0307380_107866073 | 3300031539 | Soil | MNRDDVRDLVAAAIREHELRVALWSGLMGAVLMAGTWHAIWLCRP |
| Ga0307379_100570886 | 3300031565 | Soil | QHLIDRAIRDHEMRVALWSGLLGALLMAGTWHAIWLCR |
| Ga0307378_104442504 | 3300031566 | Soil | MAPEDIQHLIDRAIRDHEMRVALWSGLLGALLMTGTWHAIWLCR |
| Ga0307376_108784231 | 3300031578 | Soil | RGYCARMAPEDIQHLIDRAIRDHEMRVALWSGLLGALLMAGTWHAIWLCR |
| Ga0307377_103606873 | 3300031673 | Soil | MSRDDVRDLVAAAIREHELRVALWSGLMGAVLMAGTWHAIWLCRP |
| Ga0315294_108972172 | 3300031952 | Sediment | MTPEDIRKAIDDAIRQHELRVALWSGLMGAVLLAGTWHAILLCK |
| Ga0316617_1006547852 | 3300033557 | Soil | MTEEEIKAFVHRSIREHELRVALWSGLLGAALMAGTWHAIWLCRLP |
| Ga0334978_0499389_1_117 | 3300033979 | Freshwater | MSREDVQRLVAAAIREHELRVALWSGLLGAALMAGTWHA |
| Ga0334981_0007551_2240_2374 | 3300033980 | Freshwater | MSQEDVRLMVDRAIRDHEIRVALWSGLLGALLMAGTWHAIWLCR |
| Ga0334982_0000716_18502_18636 | 3300033981 | Freshwater | VSREDVQRLVAAAIREHELRVALWSGLAGALLMGGTWHAIWMCR |
| Ga0334979_0050310_2195_2329 | 3300033996 | Freshwater | VSREDVQRLVAAAIREHELRVALWSGLAGALLMAGTWHAIWLCR |
| Ga0334986_0014854_1_108 | 3300034012 | Freshwater | VAAAIREHELRVALWSGLLGAALMAGTWHAIWLCR |
| Ga0335000_0156607_1380_1505 | 3300034063 | Freshwater | MSREDVQRLVAAAIREHELRVALWSGLAGALLMAGTWHAIWL |
| Ga0310130_0000681_19555_19689 | 3300034073 | Fracking Water | MSQEDVRELVAAAIREHEIRVALWSGLLGALLMAGTWHAIWLCR |
| Ga0335027_0152512_97_246 | 3300034101 | Freshwater | MSQEGVRLMVDRAIRDHEIRVALWPGLLGALLMAGTWHAICLPATGKLP |
| Ga0335027_0158180_3_113 | 3300034101 | Freshwater | LVAAAIREHELRVALWSGLLGAALMAGTWHAIWLCR |
| Ga0348336_125719_195_320 | 3300034375 | Aqueous | MKAFVHRSIREHELRVALWSGLLGIALMAGTWHAIWLCRLP |
| Ga0348337_048664_1190_1324 | 3300034418 | Aqueous | MDDRQIQHLIDHAIREHELRVALWSGLLGPLLMAGTWHAIWLCK |
| ⦗Top⦘ |