


| Basic Information | |
|---|---|
| Family ID | F025923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 199 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EQSKRSGLKNVAESTAGIIPGDRGKVGGSWCRPPLQTALAV |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 199 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.256 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (17.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.588 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (31.156 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.90% Coil/Unstructured: 97.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.76 % |
| Unclassified | root | N/A | 48.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000305|bgg_mtDRAFT_1021468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 657 | Open in IMG/M |
| 3300002863|Ga0006769J43182_100133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
| 3300002865|Ga0006761J43178_100718 | Not Available | 587 | Open in IMG/M |
| 3300003290|Ga0007414J48917_100955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 607 | Open in IMG/M |
| 3300003291|Ga0007421J48921_100062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
| 3300004590|Ga0066508_1013145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 760 | Open in IMG/M |
| 3300004798|Ga0058859_10069550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 823 | Open in IMG/M |
| 3300004798|Ga0058859_10095448 | Not Available | 708 | Open in IMG/M |
| 3300004799|Ga0058863_10005200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 743 | Open in IMG/M |
| 3300004800|Ga0058861_10160937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 799 | Open in IMG/M |
| 3300004801|Ga0058860_10217111 | Not Available | 701 | Open in IMG/M |
| 3300004801|Ga0058860_10220120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 645 | Open in IMG/M |
| 3300004803|Ga0058862_10136003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 722 | Open in IMG/M |
| 3300004803|Ga0058862_10146250 | Not Available | 777 | Open in IMG/M |
| 3300004803|Ga0058862_10287983 | Not Available | 655 | Open in IMG/M |
| 3300007004|Ga0079218_11046860 | Not Available | 824 | Open in IMG/M |
| 3300007159|Ga0075020_125649 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 590 | Open in IMG/M |
| 3300009165|Ga0105102_10795835 | Not Available | 538 | Open in IMG/M |
| 3300009261|Ga0103870_1027323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 701 | Open in IMG/M |
| 3300009581|Ga0115600_1089254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 506 | Open in IMG/M |
| 3300009587|Ga0115602_1097385 | Not Available | 503 | Open in IMG/M |
| 3300010061|Ga0127462_159780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 586 | Open in IMG/M |
| 3300010061|Ga0127462_194300 | Not Available | 771 | Open in IMG/M |
| 3300010064|Ga0127433_141030 | Not Available | 684 | Open in IMG/M |
| 3300010066|Ga0127427_125762 | Not Available | 538 | Open in IMG/M |
| 3300010067|Ga0127432_137369 | Not Available | 547 | Open in IMG/M |
| 3300010070|Ga0127441_115008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 554 | Open in IMG/M |
| 3300010075|Ga0127434_107989 | Not Available | 773 | Open in IMG/M |
| 3300010080|Ga0127448_177738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 675 | Open in IMG/M |
| 3300010083|Ga0127478_1066132 | Not Available | 805 | Open in IMG/M |
| 3300010086|Ga0127496_1057879 | Not Available | 815 | Open in IMG/M |
| 3300010086|Ga0127496_1092590 | Not Available | 569 | Open in IMG/M |
| 3300010090|Ga0127471_1108926 | Not Available | 779 | Open in IMG/M |
| 3300010091|Ga0127485_1105782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 665 | Open in IMG/M |
| 3300010104|Ga0127446_1122627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 670 | Open in IMG/M |
| 3300010110|Ga0126316_1017051 | Not Available | 791 | Open in IMG/M |
| 3300010110|Ga0126316_1019765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 759 | Open in IMG/M |
| 3300010110|Ga0126316_1068476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 783 | Open in IMG/M |
| 3300010110|Ga0126316_1070282 | Not Available | 611 | Open in IMG/M |
| 3300010119|Ga0127452_1070799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 662 | Open in IMG/M |
| 3300010128|Ga0127486_1078333 | Not Available | 742 | Open in IMG/M |
| 3300010133|Ga0127459_1165909 | Not Available | 729 | Open in IMG/M |
| 3300010136|Ga0127447_1004855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 556 | Open in IMG/M |
| 3300010137|Ga0126323_1098547 | Not Available | 640 | Open in IMG/M |
| 3300010140|Ga0127456_1056137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 785 | Open in IMG/M |
| 3300010141|Ga0127499_1186203 | Not Available | 564 | Open in IMG/M |
| 3300010145|Ga0126321_1142508 | Not Available | 763 | Open in IMG/M |
| 3300010145|Ga0126321_1391922 | Not Available | 745 | Open in IMG/M |
| 3300010145|Ga0126321_1435662 | Not Available | 709 | Open in IMG/M |
| 3300010146|Ga0126320_1047300 | Not Available | 534 | Open in IMG/M |
| 3300010147|Ga0126319_1344868 | Not Available | 675 | Open in IMG/M |
| 3300010147|Ga0126319_1351648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 510 | Open in IMG/M |
| 3300010147|Ga0126319_1577282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 516 | Open in IMG/M |
| 3300010154|Ga0127503_10801531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 641 | Open in IMG/M |
| 3300010857|Ga0126354_1098203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 792 | Open in IMG/M |
| 3300010877|Ga0126356_10454486 | Not Available | 750 | Open in IMG/M |
| 3300011045|Ga0138598_160444 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 705 | Open in IMG/M |
| 3300011282|Ga0138293_112333 | Not Available | 798 | Open in IMG/M |
| 3300011282|Ga0138293_140353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 771 | Open in IMG/M |
| 3300011332|Ga0126317_10246027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 685 | Open in IMG/M |
| 3300011332|Ga0126317_10424901 | Not Available | 763 | Open in IMG/M |
| 3300011333|Ga0127502_10675303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 685 | Open in IMG/M |
| 3300011333|Ga0127502_10685719 | Not Available | 543 | Open in IMG/M |
| 3300011333|Ga0127502_10686224 | Not Available | 522 | Open in IMG/M |
| 3300011333|Ga0127502_11326319 | Not Available | 606 | Open in IMG/M |
| 3300011340|Ga0151652_10607949 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 575 | Open in IMG/M |
| 3300012212|Ga0150985_103216090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 597 | Open in IMG/M |
| 3300012212|Ga0150985_103386461 | Not Available | 593 | Open in IMG/M |
| 3300012212|Ga0150985_114578240 | Not Available | 717 | Open in IMG/M |
| 3300012212|Ga0150985_115075627 | Not Available | 815 | Open in IMG/M |
| 3300012212|Ga0150985_116400934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 678 | Open in IMG/M |
| 3300012371|Ga0134022_1110782 | Not Available | 780 | Open in IMG/M |
| 3300012372|Ga0134037_1146763 | Not Available | 531 | Open in IMG/M |
| 3300012373|Ga0134042_1015443 | Not Available | 698 | Open in IMG/M |
| 3300012374|Ga0134039_1207214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 672 | Open in IMG/M |
| 3300012377|Ga0134029_1106712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 648 | Open in IMG/M |
| 3300012379|Ga0134058_1172350 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 500 | Open in IMG/M |
| 3300012379|Ga0134058_1263992 | Not Available | 511 | Open in IMG/M |
| 3300012384|Ga0134036_1273325 | Not Available | 782 | Open in IMG/M |
| 3300012388|Ga0134031_1026085 | Not Available | 518 | Open in IMG/M |
| 3300012388|Ga0134031_1279017 | Not Available | 777 | Open in IMG/M |
| 3300012388|Ga0134031_1303628 | Not Available | 535 | Open in IMG/M |
| 3300012399|Ga0134061_1154392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 677 | Open in IMG/M |
| 3300012402|Ga0134059_1418283 | Not Available | 565 | Open in IMG/M |
| 3300012403|Ga0134049_1030426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 648 | Open in IMG/M |
| 3300012406|Ga0134053_1003041 | Not Available | 588 | Open in IMG/M |
| 3300012469|Ga0150984_102287187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 656 | Open in IMG/M |
| 3300012469|Ga0150984_114030649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 510 | Open in IMG/M |
| 3300012469|Ga0150984_114713195 | Not Available | 697 | Open in IMG/M |
| 3300012522|Ga0129326_1234871 | Not Available | 635 | Open in IMG/M |
| 3300012770|Ga0138291_1189938 | Not Available | 500 | Open in IMG/M |
| 3300012781|Ga0138286_1066449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300013052|Ga0154014_109288 | Not Available | 645 | Open in IMG/M |
| 3300013078|Ga0153914_1144179 | Not Available | 586 | Open in IMG/M |
| 3300019199|Ga0187789_1185532 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 704 | Open in IMG/M |
| 3300019208|Ga0180110_1256579 | Not Available | 684 | Open in IMG/M |
| 3300019232|Ga0180114_1137395 | Not Available | 769 | Open in IMG/M |
| 3300019233|Ga0184645_1020653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 786 | Open in IMG/M |
| 3300019233|Ga0184645_1147307 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 573 | Open in IMG/M |
| 3300019238|Ga0180112_1027314 | Not Available | 656 | Open in IMG/M |
| 3300019241|Ga0187793_1153197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 817 | Open in IMG/M |
| 3300019244|Ga0180111_1050133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 684 | Open in IMG/M |
| 3300019244|Ga0180111_1063846 | Not Available | 542 | Open in IMG/M |
| 3300019250|Ga0187790_1253000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 702 | Open in IMG/M |
| 3300019254|Ga0184641_1159222 | Not Available | 698 | Open in IMG/M |
| 3300019255|Ga0184643_1166811 | Not Available | 666 | Open in IMG/M |
| 3300019258|Ga0181504_1112062 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha | 1117 | Open in IMG/M |
| 3300019259|Ga0184646_1409836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 666 | Open in IMG/M |
| 3300019263|Ga0184647_1016579 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300019263|Ga0184647_1454987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 645 | Open in IMG/M |
| 3300019265|Ga0187792_1124993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 709 | Open in IMG/M |
| 3300019269|Ga0184644_1205973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 758 | Open in IMG/M |
| 3300019269|Ga0184644_1263211 | Not Available | 504 | Open in IMG/M |
| 3300019279|Ga0184642_1223338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300020063|Ga0180118_1034772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 574 | Open in IMG/M |
| 3300020063|Ga0180118_1390646 | Not Available | 626 | Open in IMG/M |
| 3300020067|Ga0180109_1120778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 757 | Open in IMG/M |
| 3300020067|Ga0180109_1433838 | Not Available | 640 | Open in IMG/M |
| 3300020077|Ga0206351_10018701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 501 | Open in IMG/M |
| 3300020077|Ga0206351_10097105 | Not Available | 720 | Open in IMG/M |
| 3300020078|Ga0206352_10884831 | Not Available | 552 | Open in IMG/M |
| 3300020080|Ga0206350_10082567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 673 | Open in IMG/M |
| 3300020080|Ga0206350_10232049 | Not Available | 770 | Open in IMG/M |
| 3300020081|Ga0206354_11179054 | Not Available | 775 | Open in IMG/M |
| 3300020081|Ga0206354_11392310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 583 | Open in IMG/M |
| 3300020610|Ga0154015_1292692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 750 | Open in IMG/M |
| 3300021151|Ga0179584_1461162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 653 | Open in IMG/M |
| 3300021286|Ga0179583_1036445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 818 | Open in IMG/M |
| 3300021312|Ga0210306_1118220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 608 | Open in IMG/M |
| 3300021315|Ga0179958_1171756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 711 | Open in IMG/M |
| 3300021857|Ga0213849_1230724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 702 | Open in IMG/M |
| 3300021857|Ga0213849_1239094 | Not Available | 795 | Open in IMG/M |
| 3300021857|Ga0213849_1277544 | Not Available | 539 | Open in IMG/M |
| 3300021947|Ga0213856_1066773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 749 | Open in IMG/M |
| 3300021947|Ga0213856_1233968 | Not Available | 778 | Open in IMG/M |
| 3300021947|Ga0213856_1249724 | Not Available | 582 | Open in IMG/M |
| 3300021951|Ga0222624_1167841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
| 3300021951|Ga0222624_1169377 | Not Available | 780 | Open in IMG/M |
| 3300021951|Ga0222624_1221050 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 759 | Open in IMG/M |
| 3300021951|Ga0222624_1366119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 672 | Open in IMG/M |
| 3300022156|Ga0213934_1034580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 686 | Open in IMG/M |
| 3300022195|Ga0222625_1071933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 691 | Open in IMG/M |
| 3300022385|Ga0210376_1028300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300026405|Ga0256296_1022019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 761 | Open in IMG/M |
| 3300026573|Ga0255269_1057175 | Not Available | 1082 | Open in IMG/M |
| 3300028080|Ga0256324_1040853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 695 | Open in IMG/M |
| 3300028081|Ga0255260_1037041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 757 | Open in IMG/M |
| 3300030584|Ga0247658_1018735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 865 | Open in IMG/M |
| 3300030608|Ga0247651_10048207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 902 | Open in IMG/M |
| 3300030730|Ga0307482_1100156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 791 | Open in IMG/M |
| 3300030829|Ga0308203_1025508 | Not Available | 796 | Open in IMG/M |
| 3300030830|Ga0308205_1017189 | Not Available | 800 | Open in IMG/M |
| 3300030902|Ga0308202_1094252 | Not Available | 610 | Open in IMG/M |
| 3300030902|Ga0308202_1106180 | Not Available | 586 | Open in IMG/M |
| 3300030905|Ga0308200_1044425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300030973|Ga0075395_10025914 | Not Available | 670 | Open in IMG/M |
| 3300030987|Ga0308155_1008248 | Not Available | 804 | Open in IMG/M |
| 3300030989|Ga0308196_1016565 | Not Available | 823 | Open in IMG/M |
| 3300030990|Ga0308178_1041592 | Not Available | 827 | Open in IMG/M |
| 3300030993|Ga0308190_1091979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 653 | Open in IMG/M |
| 3300030993|Ga0308190_1102110 | Not Available | 630 | Open in IMG/M |
| 3300030993|Ga0308190_1112316 | Not Available | 610 | Open in IMG/M |
| 3300030997|Ga0073997_10117584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 661 | Open in IMG/M |
| 3300031082|Ga0308192_1060472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 586 | Open in IMG/M |
| 3300031092|Ga0308204_10095593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
| 3300031092|Ga0308204_10273703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 556 | Open in IMG/M |
| 3300031092|Ga0308204_10355203 | Not Available | 505 | Open in IMG/M |
| 3300031094|Ga0308199_1086650 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 670 | Open in IMG/M |
| 3300031095|Ga0308184_1024130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 673 | Open in IMG/M |
| 3300031098|Ga0308191_1012324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 788 | Open in IMG/M |
| 3300031098|Ga0308191_1028482 | Not Available | 585 | Open in IMG/M |
| 3300031099|Ga0308181_1059663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 745 | Open in IMG/M |
| 3300031100|Ga0308180_1018094 | Not Available | 668 | Open in IMG/M |
| 3300031114|Ga0308187_10170950 | Not Available | 740 | Open in IMG/M |
| 3300031123|Ga0308195_1021837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
| 3300031123|Ga0308195_1028486 | Not Available | 725 | Open in IMG/M |
| 3300031421|Ga0308194_10119386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 781 | Open in IMG/M |
| 3300031423|Ga0308177_1019497 | Not Available | 589 | Open in IMG/M |
| 3300031476|Ga0314827_112363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 673 | Open in IMG/M |
| 3300031481|Ga0314816_1023740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 768 | Open in IMG/M |
| 3300031677|Ga0307480_1017952 | Not Available | 553 | Open in IMG/M |
| 3300034479|Ga0314785_016193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 581 | Open in IMG/M |
| 3300034644|Ga0370548_077440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 639 | Open in IMG/M |
| 3300034660|Ga0314781_069720 | Not Available | 663 | Open in IMG/M |
| 3300034661|Ga0314782_067603 | Not Available | 749 | Open in IMG/M |
| 3300034661|Ga0314782_167850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 549 | Open in IMG/M |
| 3300034663|Ga0314784_149037 | Not Available | 528 | Open in IMG/M |
| 3300034664|Ga0314786_104970 | Not Available | 613 | Open in IMG/M |
| 3300034664|Ga0314786_116747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 591 | Open in IMG/M |
| 3300034666|Ga0314788_079752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 703 | Open in IMG/M |
| 3300034666|Ga0314788_107000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 636 | Open in IMG/M |
| 3300034666|Ga0314788_134715 | Not Available | 589 | Open in IMG/M |
| 3300034667|Ga0314792_093661 | Not Available | 737 | Open in IMG/M |
| 3300034668|Ga0314793_056110 | Not Available | 735 | Open in IMG/M |
| 3300034671|Ga0314796_053528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 777 | Open in IMG/M |
| 3300034673|Ga0314798_045110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
| 3300034673|Ga0314798_069241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 697 | Open in IMG/M |
| 3300034676|Ga0314801_076664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 711 | Open in IMG/M |
| 3300034678|Ga0314803_031089 | Not Available | 848 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.57% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 12.06% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 10.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.54% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 5.03% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 4.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.51% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.01% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.51% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.50% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.50% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.50% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Host-Associated | Open in IMG/M |
| 3300002863 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003290 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_30 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003291 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004590 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 28_LOW6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007159 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009261 | Microbial communities of water from Amazon river, Brazil - RCM23 | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010064 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010066 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010067 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010070 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010083 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010137 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011045 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011282 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012781 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022385 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026405 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028080 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028081 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030584 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030608 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031476 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| bgg_mtDRAFT_10214681 | 3300000305 | Host-Associated | RSGLKDVAESAAGIIPGDRGKGGDNWCRPPLPMAKA* |
| Ga0006769J43182_1001331 | 3300002863 | Avena Fatua Rhizosphere | IEQSQRGGLKKIAESTTEIIPGDRGKGDGSWCRCPLQTASAV* |
| Ga0006761J43178_1007181 | 3300002865 | Avena Fatua Rhizosphere | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQTALAV* |
| Ga0007414J48917_1009551 | 3300003290 | Avena Fatua Rhizosphere | SQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQTALAV* |
| Ga0007421J48921_1000621 | 3300003291 | Avena Fatua Rhizosphere | EQSQRGGLKKIAESTTEIIPGDRGKGDGSWCRCPLQTASAV* |
| Ga0066508_10131451 | 3300004590 | Freshwater Sediment | SKRSGLKDVAESTAGIIPGDRGMAGGSWCRPPLQAAKAE* |
| Ga0058859_100695501 | 3300004798 | Host-Associated | IEQSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQIALAV* |
| Ga0058859_100954482 | 3300004798 | Host-Associated | QSKRSGLKDVAESTAGIIPGDRGMAGGNWCRPPLQTALAE* |
| Ga0058863_100052001 | 3300004799 | Host-Associated | QSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLATAKAG* |
| Ga0058861_101609371 | 3300004800 | Host-Associated | EQSKRSGLKDVAESTAGMIPGDRGKGGDNWCRSPLPLAKAS* |
| Ga0058860_102171111 | 3300004801 | Host-Associated | EQSQRSGLKDVAESTAGIIPGDRGMAGGSWCRPPLQTALAE* |
| Ga0058860_102201201 | 3300004801 | Host-Associated | EQSKRSGLKNVTESTAGIIPGDRGKAGDNWCRPPLPMAKAK* |
| Ga0058862_101360031 | 3300004803 | Host-Associated | EQSKRSGLKDVAESTAGIIPGDRGKDGDNWCRPPLPLAKAR* |
| Ga0058862_101462501 | 3300004803 | Host-Associated | SKRSGLKDVAESTAGIIPGDRGMAGGNWCRPPLQTALAE* |
| Ga0058862_102879831 | 3300004803 | Host-Associated | EQSQRGGLKQVDASTTGIIPGDRGKAGGSWCRPPLQTALAV* |
| Ga0079218_110468603 | 3300007004 | Agricultural Soil | MRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMA |
| Ga0075020_1256491 | 3300007159 | Watersheds | QSQRGGLKKIAKSTAGIIPGDRGKGDGSWCRFPLQTALAV* |
| Ga0105102_107958351 | 3300009165 | Freshwater Sediment | PCSLIEQSQRGGLKNVAESTAGIIPGDRGKVDDSWCCPPLQAA* |
| Ga0103870_10273231 | 3300009261 | River Water | TDDLKNVAVSTAGIIPGDRGKADGSWCRPPLQIASAV* |
| Ga0115600_10892541 | 3300009581 | Wetland | QSRCSGLKGASESTTGIIPGDRGKADDSWCRPPLQAA* |
| Ga0115602_10973851 | 3300009587 | Wetland | RGLKNVIESMVGIILGDWGMVGGSWCRPPLQIVLVEW* |
| Ga0127462_1597801 | 3300010061 | Grasslands Soil | EQSQHGGLKNVAVSTAGIIPGDRGKVDGSWCRPPLQIAYAV* |
| Ga0127462_1943001 | 3300010061 | Grasslands Soil | SQRRDLKNVTESTTGIIPGDRGKVGGSWCRPPLQTALAV* |
| Ga0127433_1410301 | 3300010064 | Grasslands Soil | EQSKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAK* |
| Ga0127427_1257621 | 3300010066 | Grasslands Soil | SKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAK* |
| Ga0127432_1373691 | 3300010067 | Grasslands Soil | GLKDVAESTAGIIPGDRGKAGGNWCRPPLQTALAV* |
| Ga0127441_1150081 | 3300010070 | Grasslands Soil | GGLKNIAESTTGIIPGDRGKGDGSWCRLPLHIALVM* |
| Ga0127434_1079891 | 3300010075 | Grasslands Soil | QSQRRDLKNVTESTTGIIPGDRGKVGGSWCRPPLQTALAV* |
| Ga0127448_1777381 | 3300010080 | Grasslands Soil | EQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRLPLPMAKAR* |
| Ga0127478_10661321 | 3300010083 | Grasslands Soil | KRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAK* |
| Ga0127496_10578791 | 3300010086 | Grasslands Soil | LIEQSKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAK* |
| Ga0127496_10925901 | 3300010086 | Grasslands Soil | SQRGGLKKVVASTAGIIPGDRGKAGGNWCRPPLHIALAV* |
| Ga0127471_11089261 | 3300010090 | Grasslands Soil | EQSQRRDLKNVTESTTGIIPGDRGKVGGSWCRPPLQTALAV* |
| Ga0127485_11057821 | 3300010091 | Grasslands Soil | RSGLKDVAESTAGIIPGDRGKAGDNWCRLPLPMAKAR* |
| Ga0127446_11226271 | 3300010104 | Grasslands Soil | SKRSGLKDVAESTAGIIPGDRGKAGDNWCRLPLPMAKAR* |
| Ga0126316_10170511 | 3300010110 | Soil | EQSKRSGLKDVAESTAGIIPGDRGKAGGDWCRPPLPVAKAK* |
| Ga0126316_10197651 | 3300010110 | Soil | EQSKRSGLKNVAESTTGIIPGDRGKVGGSWCRLPLQTAIAG* |
| Ga0126316_10684761 | 3300010110 | Soil | EQSQRRDLKNVTESTAGIIPGDRGMVGGSWCHSPLQTAIAE* |
| Ga0126316_10702821 | 3300010110 | Soil | QSQRGGLKYVDASTAGIIPGDRGMAGGNWCRPPLQTAKAV* |
| Ga0127452_10707991 | 3300010119 | Grasslands Soil | SQRGGLKKVVASTAGIIPGDRGKAGGNWCRPPLQIALAV* |
| Ga0127486_10783331 | 3300010128 | Grasslands Soil | RRDLKNVTESTTGIIPGDRGKVGGSWCRPPLQTALAV* |
| Ga0127459_11659091 | 3300010133 | Grasslands Soil | SLIEQSQRSGLKNVAESTAGIIPGDRGMAGGSWCRPPLQTALAE* |
| Ga0127447_10048551 | 3300010136 | Grasslands Soil | LKDVAESTAGIIPGDRGKAGGNWCRPPLLAALAVW* |
| Ga0126323_10985471 | 3300010137 | Soil | QSKRSGLKNVAESTAGIIPGDRGKVGGSWCHLPLQAALAA* |
| Ga0127456_10561371 | 3300010140 | Grasslands Soil | RGGLKKIAESTTGIIPGDRGKGDGSWCRLPLHIALVM* |
| Ga0127499_11862031 | 3300010141 | Grasslands Soil | RSGLKNVAESTAGIIPGDRGMAGGSWCRPPLQTALAE* |
| Ga0126321_11425081 | 3300010145 | Soil | EQSKRSGLKNVAESTTGIIPGDRGKVGGSWCRLPLQTAIAV* |
| Ga0126321_13919221 | 3300010145 | Soil | EQSQRSGLKNVAESTAGIIPGDRGKVGGSWCRLPLQTALAV* |
| Ga0126321_14356621 | 3300010145 | Soil | QSKRSGLKNVAESTTGIIPGDRGKVGGSWCRLPLQAALAV* |
| Ga0126320_10473001 | 3300010146 | Soil | QSKRSGLKNVTESTAGIIPGDRGKGCDNWCRDPLPMAKAR* |
| Ga0126319_13448681 | 3300010147 | Soil | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQIALAI* |
| Ga0126319_13516481 | 3300010147 | Soil | RSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQIALAV* |
| Ga0126319_15772821 | 3300010147 | Soil | QSKRSGLKDVAESTAGIIPGDRGKVGGNWCRRPLPVAKAS* |
| Ga0127503_108015311 | 3300010154 | Soil | EQSKRSGLKNVAESTAGIIPGDRGKGGDNWCRSPLPLAKAR* |
| Ga0126354_10982031 | 3300010857 | Boreal Forest Soil | EQSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQTAFAV* |
| Ga0126356_104544861 | 3300010877 | Boreal Forest Soil | QSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQTALAV* |
| Ga0138598_1604441 | 3300011045 | Peatlands Soil | QSQRGGLKKIAESTTEIIPGDRGKGDGSWCRCPLQTASAV* |
| Ga0138293_1123331 | 3300011282 | Watersheds | RSGLKNVAESTAGIIPGDRGKVGGSWCRLPLQTALAV* |
| Ga0138293_1403531 | 3300011282 | Watersheds | EQSQRGGLKKVAESTTGIIPGDRGKAGDSWCRPPLQIALAV* |
| Ga0126317_102460271 | 3300011332 | Soil | EQSKRSGLKDVAESTTGIIPGDRGKAGDNWCRPPLPMAKVD* |
| Ga0126317_104249011 | 3300011332 | Soil | SKRSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQTALAV* |
| Ga0127502_106753031 | 3300011333 | Soil | QSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAS* |
| Ga0127502_106857191 | 3300011333 | Soil | QRGGLKQVDASTAGIIPGDRGKGGGSWCRSPLMKAKAI* |
| Ga0127502_106862241 | 3300011333 | Soil | QRGGLKQVDASTAGIIPGDRGKGGGSWCRSPLMKAKAV* |
| Ga0127502_113263191 | 3300011333 | Soil | QSQRSGLKNVAESTAGIIPGDRGKVGDSWCRPPLQTA* |
| Ga0151652_106079491 | 3300011340 | Wetland | EQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPVAKAR* |
| Ga0150985_1032160901 | 3300012212 | Avena Fatua Rhizosphere | SKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAI* |
| Ga0150985_1033864611 | 3300012212 | Avena Fatua Rhizosphere | RSGLKNVAESTTGIIPGDRGKVGGSWCRLPLQIA* |
| Ga0150985_1145782401 | 3300012212 | Avena Fatua Rhizosphere | EQSKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAS* |
| Ga0150985_1150756271 | 3300012212 | Avena Fatua Rhizosphere | LFRSQSKRSGLKNVAESTAGIIPGDRGKVGGSWCRLPLQTAIAV* |
| Ga0150985_1164009341 | 3300012212 | Avena Fatua Rhizosphere | SEQSKRSALKDVAESTTGIIPGDRGKAGDSWCRPPLPMVKAS* |
| Ga0134022_11107822 | 3300012371 | Grasslands Soil | EQSQRGGLKNATESTTEIIPGDRGMVDGSWCRPPLQNTSVF* |
| Ga0134037_11467631 | 3300012372 | Grasslands Soil | QSQRGGLKKVVASTAGIIPGDRGKAGGNWCRPPLQTALAV* |
| Ga0134042_10154431 | 3300012373 | Grasslands Soil | EQSQHGGLKNVVVSTAGIIPGDRGKVDGSWCRPPLQIAYAV* |
| Ga0134039_12072141 | 3300012374 | Grasslands Soil | QSQRGGLKKIAESTTGIIPGDRGKGDGSWCRLPLHIALVM* |
| Ga0134029_11067121 | 3300012377 | Grasslands Soil | SKRGGLKDVAESTTGIIPGDRGKAGDNWCRLPLPMAKAS* |
| Ga0134058_11723501 | 3300012379 | Grasslands Soil | EQSQRGGLKKIAESTTGIIPGDRGKGDGSWCRLPLHIALVM* |
| Ga0134058_12639921 | 3300012379 | Grasslands Soil | RSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQTALAV* |
| Ga0134036_12733251 | 3300012384 | Grasslands Soil | QSQRSGLKNIAESTTGIIPGDRGKVGGSWCHPPLQIAQAV* |
| Ga0134031_10260851 | 3300012388 | Grasslands Soil | QSKRSGLKDVAESTAGIIPGDRGKAGDNWCRLPLPMAKAS* |
| Ga0134031_12790171 | 3300012388 | Grasslands Soil | GLKNATESTTGIIPGDRGKADDNWCRPSLPMAKAT* |
| Ga0134031_13036281 | 3300012388 | Grasslands Soil | EQSQRSGLKNATESTTGIIPGDRGKVGDSWCRSPLEIA* |
| Ga0134061_11543921 | 3300012399 | Grasslands Soil | EQSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQTALAV* |
| Ga0134059_14182831 | 3300012402 | Grasslands Soil | EQSKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPVAKAN* |
| Ga0134049_10304261 | 3300012403 | Grasslands Soil | EQSQRSGLKNATESTTGIIPGDRGKADDNWCRPSLPMAKAT* |
| Ga0134053_10030411 | 3300012406 | Grasslands Soil | GLKNVAESTAGIIPGDRGKVGGSWCRLPLQTALAV* |
| Ga0150984_1022871871 | 3300012469 | Avena Fatua Rhizosphere | LKDVAESTTGIIPGDRGKAGDSWCRPPLPMVKAS* |
| Ga0150984_1140306491 | 3300012469 | Avena Fatua Rhizosphere | EQSQRGGLKKIAESTTGIIPGDRGKGGGSWCRLPLQIALAM* |
| Ga0150984_1147131951 | 3300012469 | Avena Fatua Rhizosphere | EQSKRSGLKNVAESTAGIIPGDRGKVGGSWCRLPLQTAIAV* |
| Ga0129326_12348711 | 3300012522 | Aqueous | SKRSGLKNVVESTAGIIPGDRGMAGGNWCRHPLQAAKAE* |
| Ga0138291_11899381 | 3300012770 | Freshwater Lake | QSKRSGLKDVAESTAGIIPGDRGMVGDSWCCPPLQTA* |
| Ga0138286_10664491 | 3300012781 | Freshwater Lake | SKRSDLKNVAESTAGIIPGDRGMVGDSWCCPPLQTA* |
| Ga0154014_1092881 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHSPLQTA* |
| Ga0153914_11441792 | 3300013078 | Freshwater Wetlands | RSGLKDVAESTAGIIPGDRGMAGGSWCRPPLQAAKAE* |
| Ga0187789_11855321 | 3300019199 | Peatland | IEQSQRGGLKQVDASTAGIIPGDRGMAGGNWCRPPLLTALAAR |
| Ga0180110_12565791 | 3300019208 | Groundwater Sediment | QSQRGGLKHAEASTAGIIPGDRGMAGGSWCRPPLQTAKAE |
| Ga0180114_11373951 | 3300019232 | Groundwater Sediment | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0184645_10206531 | 3300019233 | Groundwater Sediment | QSQRDGLKYAAESTTGIIPGDRGKVGGSWCPPPLHGALAT |
| Ga0184645_11473071 | 3300019233 | Groundwater Sediment | EQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPVAKAS |
| Ga0180112_10273141 | 3300019238 | Groundwater Sediment | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQAALAV |
| Ga0187793_11531971 | 3300019241 | Peatland | QSQRGGLKQVDASTAGIIPGDRGMADGSWCRLPLQTAKAG |
| Ga0180111_10501331 | 3300019244 | Groundwater Sediment | IEQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAR |
| Ga0180111_10638461 | 3300019244 | Groundwater Sediment | QSKRSGLKDVVESTAGIIPGDRGKGGGSWCRPPLPMAKAI |
| Ga0187790_12530001 | 3300019250 | Peatland | EQSQRGGLKQVDASTAGIIPGDRGMAGGNWCRPPLLTALAAR |
| Ga0184641_11592221 | 3300019254 | Groundwater Sediment | RSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0184643_11668111 | 3300019255 | Groundwater Sediment | EQSKRSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0181504_11120621 | 3300019258 | Peatland | VAQFGGLKSIAESTAGIIPGDRGKVGGSWCRPPLQ |
| Ga0184646_14098361 | 3300019259 | Groundwater Sediment | EQSKRSGLKDVAESTAGMIPGDRGKAGGSWCRPPLPMAKAG |
| Ga0184647_10165791 | 3300019263 | Groundwater Sediment | EQSQRGGLKQVDASTAGIIPGDRGKAGGNWCRPPLQNA |
| Ga0184647_14549871 | 3300019263 | Groundwater Sediment | EQSKRGGLKQVDVSTAGIIPGDRGKGGGSWFRPPLQSAKV |
| Ga0187792_11249931 | 3300019265 | Peatland | LIEQSQRGGLKQVDASTAGIIPGDRGMAGGNWCRPPLLTALAAR |
| Ga0184644_12059731 | 3300019269 | Groundwater Sediment | EQSQRDGLKYAAESTTGIIPGDRGKVGGSWCPPPLHGALAT |
| Ga0184644_12632112 | 3300019269 | Groundwater Sediment | KRSGLKDVAVSTAGIIPGDRGKAGGNWCRLPLLMA |
| Ga0184642_12233381 | 3300019279 | Groundwater Sediment | RSGLKDVAESTTGIIPGDRGKAGDNWCRPPLPMAKVS |
| Ga0180118_10347721 | 3300020063 | Groundwater Sediment | QSQFSGLKYVAESAAGILPGDRGMAGGNWCRLPLAAA |
| Ga0180118_13906461 | 3300020063 | Groundwater Sediment | EQSQRGGLKHVDASTAGIIPGDRGMAGGNWCRPPLQTAKAV |
| Ga0180109_11207781 | 3300020067 | Groundwater Sediment | EQSQFSGLKYVAESAAGILPGDRGMAGGNWCRLPLAAA |
| Ga0180109_14338381 | 3300020067 | Groundwater Sediment | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHLPLQTALAV |
| Ga0206351_100187011 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | GLKNATESTTGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0206351_100971051 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | DLKNVTESTTGIIPGDRGKVGGSWCRLPLQTALAV |
| Ga0206352_108848311 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | QSQRGGLKKVVASTAGIIPGDRGKAGGNWCRPPLQIALAV |
| Ga0206350_100825671 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQTALVV |
| Ga0206350_102320492 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHSPLQTA |
| Ga0206354_111790542 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | EQSKRSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQAALAV |
| Ga0206354_113923101 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | RSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPVAKAS |
| Ga0154015_12926921 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | EQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAR |
| Ga0179584_14611621 | 3300021151 | Vadose Zone Soil | EQSQRGGLKKVVASTAGIIPGDRGMAGGNWCRPPLQIALAAW |
| Ga0179583_10364451 | 3300021286 | Vadose Zone Soil | EQSKRSGLKDVAESTAGIIPGDRGKVDGNWCRHPLPVAKAS |
| Ga0210306_11182201 | 3300021312 | Estuarine | QSKRSGLKDVAESTAGIIPGDRGMAGGSWCRPPLQAAKAE |
| Ga0179958_11717561 | 3300021315 | Vadose Zone Soil | IEQSQHGGLKNVAVSTAGIIPGDRGKVDGSWCRPPLQIAQAV |
| Ga0213849_12307241 | 3300021857 | Watersheds | EQSKRSGLKDVAESTAGIIPGDRGMDGGSWCCHSLPLAKAG |
| Ga0213849_12390941 | 3300021857 | Watersheds | EQSKRSGLKNVAESTAGIIPGDRGKVGGSWCRPPLQTALAV |
| Ga0213849_12775441 | 3300021857 | Watersheds | EQSKRSGLKDVVESTAGIIPGDRGKGGGSWCRPPLPMAKAI |
| Ga0213856_10667731 | 3300021947 | Watersheds | EQSQRGGLKEVDASTAGIIPGDRGKVGGSWCRWPLQTAFAE |
| Ga0213856_12339681 | 3300021947 | Watersheds | EQSQRSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0213856_12497241 | 3300021947 | Watersheds | EQSQRGGLKQVDASTAGIIPGDRGMAGGNWCRPPLQTA |
| Ga0222624_11678411 | 3300021951 | Groundwater Sediment | EQSQRGGLKKVDASTAGIIPGDRGKAGGSWCRPPLQIAFAI |
| Ga0222624_11693771 | 3300021951 | Groundwater Sediment | EQSQRRDLKNVTESTTGIIPGDRGKVGGSWCRLPLQTALAV |
| Ga0222624_12210501 | 3300021951 | Groundwater Sediment | SGLKDVAESTTGIIPGDRGKAGDNWCRPPLPMAKVS |
| Ga0222624_13661191 | 3300021951 | Groundwater Sediment | EQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRLPLPMAKAR |
| Ga0213934_10345802 | 3300022156 | Freshwater | SKRSGLKDVAVSTAGIIPGDRGMVGGNWCRPPLLTA |
| Ga0222625_10719331 | 3300022195 | Groundwater Sediment | EQSKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLPMAKAV |
| Ga0210376_10283001 | 3300022385 | Estuarine | EQSMRSSLKRFAESATGIIPGDRGKVGDSWCRPPLLVR |
| Ga0256296_10220191 | 3300026405 | Freshwater | EQSKRSDLKNVAESTAGIIPGDRGMVGDSWCCPPLQTA |
| Ga0255269_10571751 | 3300026573 | Freshwater | LKNVAEGAAEIIPGDRGTEGGSWCRPPLPTAKADLLSLSIY |
| Ga0256324_10408531 | 3300028080 | Freshwater | SHKRSGLKNAAEGTAGIIPGDRGMVDGNWCRPSLLRAKAA |
| Ga0255260_10370411 | 3300028081 | Freshwater | RSGLKNAAEGTAGIIPGDRGMVDGNWCRPSLLRAKAA |
| Ga0247658_10187351 | 3300030584 | Soil | QSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAR |
| Ga0247651_100482071 | 3300030608 | Soil | KRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAR |
| Ga0307482_11001561 | 3300030730 | Hardwood Forest Soil | EQSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQIAFAI |
| Ga0308203_10255081 | 3300030829 | Soil | QSQRGGLKKIAESTTGIIPGDRGKGDGSWCRLPLQTALAV |
| Ga0308205_10171891 | 3300030830 | Soil | QSKRSGLKDVAESTAGIIPGDRGMAGDNWCRPPLPMAKAI |
| Ga0308202_10942521 | 3300030902 | Soil | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQAALVV |
| Ga0308202_11061801 | 3300030902 | Soil | QSKRSGLKDVAESTAGIIPGDRGKVGGSWCRPPLQTAQAV |
| Ga0308200_10444251 | 3300030905 | Soil | KRSGLKDVAESTTGIIPGDRGKAGDNWCRPPLPMAKVS |
| Ga0075395_100259141 | 3300030973 | Soil | QSQRSGLKDVAESTAGIIPGDRGMAGGNWCRPPLQTALAE |
| Ga0308155_10082481 | 3300030987 | Soil | QSKRSGLKNVAESTAGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0308196_10165651 | 3300030989 | Soil | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCRLPLQTALAV |
| Ga0308178_10415921 | 3300030990 | Soil | QSQRRDLKNVTESTTGIIPGDRGKVGGSWCRLPLQTALAV |
| Ga0308190_10919791 | 3300030993 | Soil | QSKRSGLKDVAESTAGIIPGDRGKAGGNWCRPPLQTA |
| Ga0308190_11021101 | 3300030993 | Soil | EQSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQIALAI |
| Ga0308190_11123161 | 3300030993 | Soil | QSQRGGLKKVDASTAGIIPGDRGKAGGSWCRPPLQTA |
| Ga0073997_101175841 | 3300030997 | Soil | QSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAG |
| Ga0308192_10604721 | 3300031082 | Soil | EQSQRGGLKKIAESTAGIIPGDRGKGDGSWCRCPLQIALAV |
| Ga0308204_100955931 | 3300031092 | Soil | QSKRSGLKDVAESTAGMIPGDRGKGGDNWCRPPLPVAKAS |
| Ga0308204_102737031 | 3300031092 | Soil | SQRGGLKKVDASTAGIIPGDRGKVGGSWFRPPLHFAIAS |
| Ga0308204_103552031 | 3300031092 | Soil | EQSQRGGLKKVVASTAGIIPGDRGKAGGNWCRSPLQTALAV |
| Ga0308199_10866501 | 3300031094 | Soil | QSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0308184_10241302 | 3300031095 | Soil | EQSKRSGLKDVAESAAGIIPGDRGKSGDNWCRPSLLIGES |
| Ga0308191_10123241 | 3300031098 | Soil | QSQRGGLKKIAESTTGIIPGDRGKGDGSWCRLPLQIALAM |
| Ga0308191_10284821 | 3300031098 | Soil | RDLKDVTESTAGIIPGDRGMVGGSWCHPPLQTATAE |
| Ga0308181_10596631 | 3300031099 | Soil | EQSQRGGLKKVDASTAGIIPGDRGKAGGSWCRPPLQTA |
| Ga0308180_10180941 | 3300031100 | Soil | SQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQTALAV |
| Ga0308187_101709501 | 3300031114 | Soil | SKRSGLKDVAESTAGIIPGDRGMAGGSWCHPPLQTALAE |
| Ga0308195_10218371 | 3300031123 | Soil | EQSKRSGLKDVAESTTGIIPGDRGKAGDNWCRPPLPMAKVS |
| Ga0308195_10284861 | 3300031123 | Soil | EQSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQTAFAV |
| Ga0308194_101193862 | 3300031421 | Soil | EQSQRGGLKKIAESTTGIIPGDRGKGDGSWCRLPLQIALAM |
| Ga0308177_10194971 | 3300031423 | Soil | EQSQRGGLKKVVASTAGIIPGDRGKAGGNWCRPPLQTALAV |
| Ga0314827_1123631 | 3300031476 | Soil | KRSGLKDDAESTAGIIPGDRGKAGDNWCRPPLPMAKAR |
| Ga0314816_10237401 | 3300031481 | Soil | SKRSGLKNVAESTAGIIPGDRGKAGDNWCRPPLPMAKAR |
| Ga0307480_10179521 | 3300031677 | Hardwood Forest Soil | EQSQRGGLKKVDASTAGIIPGDRGKAGGNWCRPPLQTALAV |
| Ga0314785_016193_1_123 | 3300034479 | Soil | QSQRRGLKNATESTTGIIPGDRGKVGGSWCHPPLQAALAV |
| Ga0370548_077440_3_116 | 3300034644 | Soil | QSQRSGLKNAAESTTGIIPGDRGKVGDSWCRSPLEIA |
| Ga0314781_069720_1_126 | 3300034660 | Soil | EQSQRGGLKQVDASTAGIIPGDRGMAGGNWCRPPLQTAKAV |
| Ga0314782_067603_1_123 | 3300034661 | Soil | QSQRGGLKQVDASTAGIIPGDRGMAGGNWCRPPLQTAKVV |
| Ga0314782_167850_429_548 | 3300034661 | Soil | SKRSGLKDVAESTAGIIPGDRGKVGDNWCRPPLPVAKAS |
| Ga0314784_149037_3_110 | 3300034663 | Soil | QSKRSGLKDVAEITAGMIPGDRGQGGDNWCRSPLP |
| Ga0314786_104970_2_127 | 3300034664 | Soil | EQSQRGGLKHAEASTAGIIPGDRGMAGGNWCRPPLQTAKAV |
| Ga0314786_116747_3_125 | 3300034664 | Soil | GRMHSGLKDVAESTAGIIPGDRGKAGDNWCRLPLPMARAR |
| Ga0314788_079752_1_126 | 3300034666 | Soil | DQSKRSGLKDVAESTAGIIPGDRGKGGDNWCRPPLPMAKAR |
| Ga0314788_107000_3_122 | 3300034666 | Soil | SKRSGLKDVAESTTGIIPGDRGKAGDNWCRPPLPMAQAR |
| Ga0314788_134715_3_125 | 3300034666 | Soil | QSKRSGLKDVADSTAGKIPVDRGKGGDNCCLSPLPLAKAS |
| Ga0314792_093661_612_737 | 3300034667 | Soil | EQSKRSGLKDVAESTAGIIPGDRGMAGGNWCRPPLQAAKAE |
| Ga0314793_056110_2_124 | 3300034668 | Soil | QSKRSGLKDVAESTAGIIPGDRGMAGGNWCRPPLQAAKAE |
| Ga0314796_053528_1_117 | 3300034671 | Soil | KRSGLKDVAESTAGMIPGDRGKGGDNWCRSPLPLVKAS |
| Ga0314798_045110_3_125 | 3300034673 | Soil | QPQRRGLKNATESTAEIIPGDRGKVGGSWCHPPLQAALAV |
| Ga0314798_069241_2_127 | 3300034673 | Soil | EQSQRGGLKKVVASTAGIIPGDRGKAGGNWCRPPLQIALAV |
| Ga0314801_076664_1_126 | 3300034676 | Soil | EQSKRSGLKDVAESTAGIIPGDRGKAGDNWCRPPLPMAKAS |
| Ga0314803_031089_1_126 | 3300034678 | Soil | EQSKRSGLKDVAESTAGMIPGDRGKGGDNWCRSPLPLAKAS |
| ⦗Top⦘ |