


| Basic Information | |
|---|---|
| Family ID | F025817 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.42 % |
| % of genes near scaffold ends (potentially truncated) | 24.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.00 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 12.50 |
| PF06035 | Peptidase_C93 | 9.00 |
| PF08734 | GYD | 2.50 |
| PF00311 | PEPcase | 2.50 |
| PF00536 | SAM_1 | 1.50 |
| PF00149 | Metallophos | 1.00 |
| PF12680 | SnoaL_2 | 1.00 |
| PF00239 | Resolvase | 1.00 |
| PF01479 | S4 | 1.00 |
| PF00881 | Nitroreductase | 1.00 |
| PF13356 | Arm-DNA-bind_3 | 0.50 |
| PF07729 | FCD | 0.50 |
| PF02866 | Ldh_1_C | 0.50 |
| PF00108 | Thiolase_N | 0.50 |
| PF01035 | DNA_binding_1 | 0.50 |
| PF00375 | SDF | 0.50 |
| PF13586 | DDE_Tnp_1_2 | 0.50 |
| PF01966 | HD | 0.50 |
| PF07045 | DUF1330 | 0.50 |
| PF02371 | Transposase_20 | 0.50 |
| PF03992 | ABM | 0.50 |
| PF01300 | Sua5_yciO_yrdC | 0.50 |
| PF07110 | EthD | 0.50 |
| PF13414 | TPR_11 | 0.50 |
| PF02653 | BPD_transp_2 | 0.50 |
| PF13463 | HTH_27 | 0.50 |
| PF07478 | Dala_Dala_lig_C | 0.50 |
| PF13964 | Kelch_6 | 0.50 |
| PF13374 | TPR_10 | 0.50 |
| PF01548 | DEDD_Tnp_IS110 | 0.50 |
| PF13505 | OMP_b-brl | 0.50 |
| PF11867 | DUF3387 | 0.50 |
| PF07690 | MFS_1 | 0.50 |
| PF00202 | Aminotran_3 | 0.50 |
| PF01047 | MarR | 0.50 |
| PF04545 | Sigma70_r4 | 0.50 |
| PF00126 | HTH_1 | 0.50 |
| PF03466 | LysR_substrate | 0.50 |
| PF03734 | YkuD | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 12.50 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 9.00 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 2.50 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 2.50 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.00 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.50 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.50 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.50 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.50 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.50 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.50 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.00 % |
| Unclassified | root | N/A | 19.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig543058 | Not Available | 562 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig80486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1015141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1014736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1254 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10068726 | Not Available | 899 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1038146 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300000956|JGI10216J12902_103302118 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300001545|JGI12630J15595_10079632 | Not Available | 644 | Open in IMG/M |
| 3300001867|JGI12627J18819_10047653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1790 | Open in IMG/M |
| 3300002906|JGI25614J43888_10214128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300002917|JGI25616J43925_10278231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 625 | Open in IMG/M |
| 3300004633|Ga0066395_10377720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 793 | Open in IMG/M |
| 3300005468|Ga0070707_100516258 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005554|Ga0066661_10047259 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
| 3300005559|Ga0066700_10733071 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005576|Ga0066708_10246425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
| 3300005713|Ga0066905_100055393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2456 | Open in IMG/M |
| 3300005713|Ga0066905_100138982 | Not Available | 1729 | Open in IMG/M |
| 3300005713|Ga0066905_100178355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1564 | Open in IMG/M |
| 3300005713|Ga0066905_100180704 | Not Available | 1556 | Open in IMG/M |
| 3300005713|Ga0066905_100417517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1093 | Open in IMG/M |
| 3300005713|Ga0066905_100551909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300005713|Ga0066905_100589371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 939 | Open in IMG/M |
| 3300005713|Ga0066905_100882305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 781 | Open in IMG/M |
| 3300005713|Ga0066905_101607976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300005719|Ga0068861_101227496 | Not Available | 726 | Open in IMG/M |
| 3300005764|Ga0066903_100064968 | All Organisms → cellular organisms → Bacteria | 4605 | Open in IMG/M |
| 3300005764|Ga0066903_100373230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2325 | Open in IMG/M |
| 3300005764|Ga0066903_100690373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1796 | Open in IMG/M |
| 3300005764|Ga0066903_101009369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1522 | Open in IMG/M |
| 3300005764|Ga0066903_101227799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1394 | Open in IMG/M |
| 3300005764|Ga0066903_101384224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300005764|Ga0066903_101682515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1207 | Open in IMG/M |
| 3300005764|Ga0066903_101905999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300005764|Ga0066903_102378792 | Not Available | 1024 | Open in IMG/M |
| 3300005764|Ga0066903_103040138 | Not Available | 908 | Open in IMG/M |
| 3300005764|Ga0066903_103087897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
| 3300005764|Ga0066903_103728636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 819 | Open in IMG/M |
| 3300005764|Ga0066903_104139989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300005764|Ga0066903_104632281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300005764|Ga0066903_104922148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300005764|Ga0066903_105120893 | Not Available | 694 | Open in IMG/M |
| 3300005764|Ga0066903_105245393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 685 | Open in IMG/M |
| 3300005764|Ga0066903_105612749 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005764|Ga0066903_105738222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300005764|Ga0066903_106155868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300005764|Ga0066903_106341648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 617 | Open in IMG/M |
| 3300005764|Ga0066903_106395603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 614 | Open in IMG/M |
| 3300005764|Ga0066903_106435947 | Not Available | 612 | Open in IMG/M |
| 3300005764|Ga0066903_106454699 | Not Available | 611 | Open in IMG/M |
| 3300005764|Ga0066903_106493093 | Not Available | 609 | Open in IMG/M |
| 3300005764|Ga0066903_106714667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300005764|Ga0066903_108154653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005764|Ga0066903_108417592 | Not Available | 526 | Open in IMG/M |
| 3300005983|Ga0081540_1029632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3045 | Open in IMG/M |
| 3300006028|Ga0070717_10840338 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006028|Ga0070717_11793883 | Not Available | 554 | Open in IMG/M |
| 3300006034|Ga0066656_10167647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1383 | Open in IMG/M |
| 3300006049|Ga0075417_10353855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300006058|Ga0075432_10584214 | Not Available | 509 | Open in IMG/M |
| 3300006173|Ga0070716_100433418 | Not Available | 954 | Open in IMG/M |
| 3300006173|Ga0070716_101501898 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006175|Ga0070712_101337916 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006573|Ga0074055_11172875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300006804|Ga0079221_11188023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 591 | Open in IMG/M |
| 3300006844|Ga0075428_100178429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2300 | Open in IMG/M |
| 3300007076|Ga0075435_100031185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4197 | Open in IMG/M |
| 3300007255|Ga0099791_10641703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300007258|Ga0099793_10058701 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300009038|Ga0099829_10145499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1887 | Open in IMG/M |
| 3300009100|Ga0075418_10082861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3411 | Open in IMG/M |
| 3300009137|Ga0066709_100052909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4604 | Open in IMG/M |
| 3300009143|Ga0099792_10109809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300009143|Ga0099792_10277103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300009147|Ga0114129_10386305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1847 | Open in IMG/M |
| 3300009162|Ga0075423_11616970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300009792|Ga0126374_10250336 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300010043|Ga0126380_10059653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2109 | Open in IMG/M |
| 3300010043|Ga0126380_10086716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1833 | Open in IMG/M |
| 3300010043|Ga0126380_10142894 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300010043|Ga0126380_10177924 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300010043|Ga0126380_10477627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 950 | Open in IMG/M |
| 3300010043|Ga0126380_11640905 | Not Available | 575 | Open in IMG/M |
| 3300010046|Ga0126384_10403578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1155 | Open in IMG/M |
| 3300010046|Ga0126384_10452235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1097 | Open in IMG/M |
| 3300010046|Ga0126384_10710011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300010046|Ga0126384_10853131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300010047|Ga0126382_10144555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1618 | Open in IMG/M |
| 3300010048|Ga0126373_10141446 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300010048|Ga0126373_10419079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1367 | Open in IMG/M |
| 3300010321|Ga0134067_10492531 | Not Available | 507 | Open in IMG/M |
| 3300010335|Ga0134063_10724940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300010337|Ga0134062_10122174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1136 | Open in IMG/M |
| 3300010358|Ga0126370_11464564 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010358|Ga0126370_11927861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300010358|Ga0126370_12165040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 547 | Open in IMG/M |
| 3300010359|Ga0126376_10433084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300010360|Ga0126372_12298658 | Not Available | 589 | Open in IMG/M |
| 3300010361|Ga0126378_11987719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300010362|Ga0126377_10259929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1695 | Open in IMG/M |
| 3300010362|Ga0126377_10432485 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300010362|Ga0126377_10925732 | Not Available | 935 | Open in IMG/M |
| 3300010362|Ga0126377_12938124 | Not Available | 550 | Open in IMG/M |
| 3300010366|Ga0126379_10254924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1731 | Open in IMG/M |
| 3300010366|Ga0126379_13782565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010376|Ga0126381_100431093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1844 | Open in IMG/M |
| 3300010376|Ga0126381_101005679 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300010397|Ga0134124_12397810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300010398|Ga0126383_10308268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1585 | Open in IMG/M |
| 3300010999|Ga0138505_100056111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300012199|Ga0137383_10667347 | Not Available | 760 | Open in IMG/M |
| 3300012205|Ga0137362_10077452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2766 | Open in IMG/M |
| 3300012205|Ga0137362_10151080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1986 | Open in IMG/M |
| 3300012208|Ga0137376_11693268 | Not Available | 523 | Open in IMG/M |
| 3300012211|Ga0137377_10097817 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300012285|Ga0137370_10060649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2052 | Open in IMG/M |
| 3300012355|Ga0137369_10101673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2358 | Open in IMG/M |
| 3300012357|Ga0137384_10887735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300012359|Ga0137385_10364494 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300012359|Ga0137385_10458674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300012361|Ga0137360_10646292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300012362|Ga0137361_10437716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1201 | Open in IMG/M |
| 3300012582|Ga0137358_10073170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2303 | Open in IMG/M |
| 3300012917|Ga0137395_10026600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3441 | Open in IMG/M |
| 3300012929|Ga0137404_10240086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1551 | Open in IMG/M |
| 3300012929|Ga0137404_10878723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300012948|Ga0126375_10193653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1328 | Open in IMG/M |
| 3300012971|Ga0126369_10792753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1029 | Open in IMG/M |
| 3300012971|Ga0126369_12389327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 615 | Open in IMG/M |
| 3300012985|Ga0164308_10185516 | Not Available | 1571 | Open in IMG/M |
| 3300012989|Ga0164305_11060161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300013307|Ga0157372_12871918 | Not Available | 552 | Open in IMG/M |
| 3300016294|Ga0182041_10035665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3238 | Open in IMG/M |
| 3300016319|Ga0182033_10028672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3522 | Open in IMG/M |
| 3300016341|Ga0182035_11671004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300016404|Ga0182037_11281936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300016445|Ga0182038_12056601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300018433|Ga0066667_12260324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300018468|Ga0066662_11338287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300018482|Ga0066669_11313152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300020581|Ga0210399_11440823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300020583|Ga0210401_11349775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300021168|Ga0210406_11289381 | Not Available | 527 | Open in IMG/M |
| 3300021170|Ga0210400_10904043 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021361|Ga0213872_10154287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300021372|Ga0213877_10015094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2020 | Open in IMG/M |
| 3300021405|Ga0210387_10115529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2261 | Open in IMG/M |
| 3300021478|Ga0210402_11431151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300021560|Ga0126371_10616595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1234 | Open in IMG/M |
| 3300021560|Ga0126371_10787081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1098 | Open in IMG/M |
| 3300021560|Ga0126371_11525803 | Not Available | 796 | Open in IMG/M |
| 3300021560|Ga0126371_11641265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300021560|Ga0126371_11907587 | Not Available | 713 | Open in IMG/M |
| 3300024288|Ga0179589_10126915 | Not Available | 1069 | Open in IMG/M |
| 3300025922|Ga0207646_10976123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300026304|Ga0209240_1001018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11180 | Open in IMG/M |
| 3300026304|Ga0209240_1198111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300026319|Ga0209647_1017504 | Not Available | 4534 | Open in IMG/M |
| 3300026319|Ga0209647_1049431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2275 | Open in IMG/M |
| 3300026359|Ga0257163_1071456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300026514|Ga0257168_1047433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 939 | Open in IMG/M |
| 3300026551|Ga0209648_10497827 | Not Available | 710 | Open in IMG/M |
| 3300026552|Ga0209577_10344356 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300026846|Ga0208273_103053 | Not Available | 578 | Open in IMG/M |
| 3300027061|Ga0209729_1011612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300027502|Ga0209622_1053265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 735 | Open in IMG/M |
| 3300027646|Ga0209466_1006693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2436 | Open in IMG/M |
| 3300028047|Ga0209526_10026653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4055 | Open in IMG/M |
| 3300028047|Ga0209526_10027000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4027 | Open in IMG/M |
| 3300028784|Ga0307282_10025232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2532 | Open in IMG/M |
| 3300028878|Ga0307278_10544214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031543|Ga0318516_10003324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6913 | Open in IMG/M |
| 3300031543|Ga0318516_10026834 | All Organisms → cellular organisms → Bacteria | 3006 | Open in IMG/M |
| 3300031543|Ga0318516_10090889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1714 | Open in IMG/M |
| 3300031543|Ga0318516_10270763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 982 | Open in IMG/M |
| 3300031543|Ga0318516_10453425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300031561|Ga0318528_10129054 | Not Available | 1339 | Open in IMG/M |
| 3300031561|Ga0318528_10297507 | Not Available | 866 | Open in IMG/M |
| 3300031561|Ga0318528_10642648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300031572|Ga0318515_10055462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2004 | Open in IMG/M |
| 3300031572|Ga0318515_10563524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300031680|Ga0318574_10124691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1448 | Open in IMG/M |
| 3300031680|Ga0318574_10866723 | Not Available | 529 | Open in IMG/M |
| 3300031713|Ga0318496_10855062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300031719|Ga0306917_10074484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2364 | Open in IMG/M |
| 3300031719|Ga0306917_10873580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300031770|Ga0318521_10800271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300031820|Ga0307473_10760998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300031845|Ga0318511_10363589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300031860|Ga0318495_10078002 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300031910|Ga0306923_10268969 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300031941|Ga0310912_10920458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300031946|Ga0310910_10730967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300031959|Ga0318530_10127645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1024 | Open in IMG/M |
| 3300032025|Ga0318507_10011910 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300032039|Ga0318559_10175008 | Not Available | 981 | Open in IMG/M |
| 3300032180|Ga0307471_100891568 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300032205|Ga0307472_100314553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1266 | Open in IMG/M |
| 3300033290|Ga0318519_10792772 | Not Available | 582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026846 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_06452440 | 2124908045 | Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLVVMLLSVYVPA |
| KansclcFeb2_07297400 | 2124908045 | Soil | GPSICDRRRSIMNEHAVQERRGRGLDIAEVALYSALVLLVILLSVCIPA |
| AP72_2010_repI_A01DRAFT_10151413 | 3300000579 | Forest Soil | EDRSTMNRQAAQEPRRRGLNIAEAAFYSVLVLVIMLLWVYVPA* |
| AF_2010_repII_A01DRAFT_10147361 | 3300000580 | Forest Soil | MGQQAVQVWRRRGLDIAEVAFYSVLVVVITLVSVYVPA* |
| AF_2010_repII_A1DRAFT_100687262 | 3300000597 | Forest Soil | MDQQAVQVWRRRGLNIAEVAFYSILVVVITLVSVYVPA* |
| AF_2010_repII_A100DRAFT_10381462 | 3300000655 | Forest Soil | GRRRSTMNEQAVQERRRRDLNIAEVAFYSVLVLLVMLLSVYVPA* |
| JGI10216J12902_1033021183 | 3300000956 | Soil | SVYDRRRSTMNQQAAQERRRWGLNIAEVAFYSVLVLVVMLLSFYIPA* |
| JGI12630J15595_100796322 | 3300001545 | Forest Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLVVMLLSVY |
| JGI12627J18819_100476532 | 3300001867 | Forest Soil | MNQQAVQERRRRGLNIAEVAFYSGLVLVIMLLSVYVPA* |
| JGI25614J43888_102141282 | 3300002906 | Grasslands Soil | DRRRSTMNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSVYVPA* |
| JGI25616J43925_102782311 | 3300002917 | Grasslands Soil | RRSTMNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA* |
| Ga0066395_103777203 | 3300004633 | Tropical Forest Soil | RRRSNMNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0070707_1005162582 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRSTMNQQAVQERRRQGLNIAEVAFYSVLVLVIMLLSFYIPA* |
| Ga0066661_100472592 | 3300005554 | Soil | MNQQAAQERRRWGLNIAEVAFYSVLVLVVMLLSFYIPA* |
| Ga0066700_107330712 | 3300005559 | Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLVVMLLSVYVPA* |
| Ga0066708_102464252 | 3300005576 | Soil | MNQQAVQEWRRRGLNIAEVVFYSVVVLVIVILSIYVPA* |
| Ga0066905_1000553932 | 3300005713 | Tropical Forest Soil | MNQQAVQEWRRRGLNVAEVAFYSILVLVIMLVSVYVPA* |
| Ga0066905_1001389822 | 3300005713 | Tropical Forest Soil | MDQQAVQERRRRGLNIAEVAFYSVLVFVITLLSVYVPA* |
| Ga0066905_1001783553 | 3300005713 | Tropical Forest Soil | MNEQTVPERRGLNIAEVAFYSALVLVILLLSVYVPA* |
| Ga0066905_1001807041 | 3300005713 | Tropical Forest Soil | MNEQAVHERRGRGLTIAEVAFYSALALVVMLLSVYVPA* |
| Ga0066905_1004175173 | 3300005713 | Tropical Forest Soil | MNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0066905_1005519092 | 3300005713 | Tropical Forest Soil | RRRSTMNEQAVEERRGRGLNVAEVAFYSVLALLIMLLSVYVPA* |
| Ga0066905_1005893712 | 3300005713 | Tropical Forest Soil | MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSVYVPA* |
| Ga0066905_1008823053 | 3300005713 | Tropical Forest Soil | MNEQAVQEQRGRGFNIAEVAFYSVLVLLILLLSVYVPA* |
| Ga0066905_1016079762 | 3300005713 | Tropical Forest Soil | MNEQAVEERRSRGLNIAEVAFYSILVLLIMLLSVYVPA* |
| Ga0068861_1012274961 | 3300005719 | Switchgrass Rhizosphere | MNQQAVQEWRRRGLNIAEVAFYSGLVLVIMLLSVYVPA* |
| Ga0066903_1000649685 | 3300005764 | Tropical Forest Soil | MNQQAVQEWRRRGLDIAEVAFYSVLVLVIMLVSVYVPA* |
| Ga0066903_1003732304 | 3300005764 | Tropical Forest Soil | MNEQAVQQPRGQGLNIAEVAFYSVLVVVIMLLSVYVPA* |
| Ga0066903_1006903733 | 3300005764 | Tropical Forest Soil | MDQQAVQVWRRRGLNLAEVAFYSVVVVVITLASVYVPA* |
| Ga0066903_1010093693 | 3300005764 | Tropical Forest Soil | MNEQAVQQWRGRGLNIAEVAFYSVLVLVIMLLSVYVPA* |
| Ga0066903_1012277992 | 3300005764 | Tropical Forest Soil | MNEQAVQDRRGPGLNIAEVAFYSVLVLIVTLLSVYVPA* |
| Ga0066903_1013842241 | 3300005764 | Tropical Forest Soil | MNEETVQERRGRDLNIAEIAFYSVLVFVIMLLSVYVPA* |
| Ga0066903_1016825153 | 3300005764 | Tropical Forest Soil | MDQQAVQVWRRRSLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0066903_1019059992 | 3300005764 | Tropical Forest Soil | MNQQALHEWRRRGLDIAEVAFYSVLVLVIMLLSVYIPA* |
| Ga0066903_1023787922 | 3300005764 | Tropical Forest Soil | MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA* |
| Ga0066903_1030401382 | 3300005764 | Tropical Forest Soil | MNEQAVQQRRGQGLNIAEVTFYSVLVLVIMLLSVYVPA* |
| Ga0066903_1030878972 | 3300005764 | Tropical Forest Soil | MGQQAVQVWRRRGLDIAKVAFYSVLVVVITLVSVYVPA* |
| Ga0066903_1037286362 | 3300005764 | Tropical Forest Soil | MNEQAVQQPRGRGLNIAEVALYSVLVLVIMFLSVYVPA* |
| Ga0066903_1041399892 | 3300005764 | Tropical Forest Soil | MNEQTVQEPRGRGLNIAEVVFYSALVLVILLLSVYVPA* |
| Ga0066903_1046322812 | 3300005764 | Tropical Forest Soil | MDQQGVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0066903_1049221482 | 3300005764 | Tropical Forest Soil | MDEQAVQEGRNQGLSIAEVAFYSILVLLAMLLSMYIPA* |
| Ga0066903_1051208931 | 3300005764 | Tropical Forest Soil | MNEQAVQQPRGQGLNIAEVAFYSILVLVFMLLSVYVPA* |
| Ga0066903_1052453932 | 3300005764 | Tropical Forest Soil | MNQQAVQEWRRRGLNIAEVAFYSVVVVVITLVSVYVPA* |
| Ga0066903_1056127491 | 3300005764 | Tropical Forest Soil | MGQQAVQVWRRRGLNVAEVAFYSLLVVVITLVSVYVPA* |
| Ga0066903_1057382222 | 3300005764 | Tropical Forest Soil | MDQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0066903_1061558683 | 3300005764 | Tropical Forest Soil | MNEQTVQERRGRGLNIAEVAFYSALVLLILLLSVYVPA* |
| Ga0066903_1063416481 | 3300005764 | Tropical Forest Soil | NMNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0066903_1063956032 | 3300005764 | Tropical Forest Soil | VYDRRRSTMDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYVPA* |
| Ga0066903_1064359472 | 3300005764 | Tropical Forest Soil | MDQQAVRVWRRRGLNLAELAFYSVVAVVITLVSVYVPA* |
| Ga0066903_1064546991 | 3300005764 | Tropical Forest Soil | MNEQAVQERRRRDLNIAEVAFYSVLVLLVMLLSVYVPA* |
| Ga0066903_1064930932 | 3300005764 | Tropical Forest Soil | MNEQAVQEPRGRGLNIAEVAFYSVLVFLVMLLSVVLE* |
| Ga0066903_1067146673 | 3300005764 | Tropical Forest Soil | MNQQAVQERRRRGLNIAEVAFYSVLVVVITLVSVYAPA* |
| Ga0066903_1081546531 | 3300005764 | Tropical Forest Soil | MDQQAVQVWRRRGLNIAEVALYSVLVVVITLVSVYVPA* |
| Ga0066903_1084175921 | 3300005764 | Tropical Forest Soil | YHRRRSNMNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSIYVPA* |
| Ga0081540_10296323 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSLYVPA* |
| Ga0070717_108403382 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGQAIQERRGRGLNIPEVAFYSVLVLVVMLLSVYVPA* |
| Ga0070717_117938832 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEQAVQERRGRGLNIGEVAFYSVLVLLVMLLSVCVPA* |
| Ga0066656_101676472 | 3300006034 | Soil | MNQQAAEEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA* |
| Ga0075417_103538551 | 3300006049 | Populus Rhizosphere | MDQQAVQERRRWGLNIAEVAFYSVLVVVITLLSFYVPA |
| Ga0075432_105842142 | 3300006058 | Populus Rhizosphere | MNEQAVQEGRGRGLGIAEVAVYSVLVLLVMLLSVYVPA* |
| Ga0070716_1004334182 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEQTVQERKGRGLNIAEIAFYSALVVVVMLLSVYVPA* |
| Ga0070716_1015018981 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEQAVQERRGRGLNIPEVAFYSVLVLVVMLLSVYVPA* |
| Ga0070712_1013379162 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEQAVQEQRGRGLNIAEVAFYSVLVLVVMLLSVYVPA* |
| Ga0074055_111728752 | 3300006573 | Soil | DRRRSTMNEQAVQERRGPGLNIGEVAFYSVLVLVVMLLSVYVPA* |
| Ga0079221_111880231 | 3300006804 | Agricultural Soil | QAVQEGRGRGLGIAEVAVYSVLVLLVMLLSVYVPA* |
| Ga0075428_1001784294 | 3300006844 | Populus Rhizosphere | MDQQAVQERRRWGLNIAEVAFYSVLVVVITLLSFYVPA* |
| Ga0075435_1000311852 | 3300007076 | Populus Rhizosphere | MDQQAAQGRRRRGLNIAEVAFYSGLVLVITLLSLYVPA* |
| Ga0099791_106417031 | 3300007255 | Vadose Zone Soil | MNEQAVQERRGRSLNIAEVAVYSVLVLLVMLLSVYVPA* |
| Ga0099793_100587012 | 3300007258 | Vadose Zone Soil | MNEQAVQERRGRGLNIGEVAFYLVLVLLIMLLSVCVPA* |
| Ga0066710_1001388905 | 3300009012 | Grasslands Soil | MNEQAVQERRASDVAAVAFYSVLFLLVMFLSVYVPA |
| Ga0099829_101454991 | 3300009038 | Vadose Zone Soil | MNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSVYVPA* |
| Ga0075418_100828615 | 3300009100 | Populus Rhizosphere | MDQQAVQEWRRWGLNIAEVAFYSVLVVVITLLSFYVPA* |
| Ga0066709_10005290910 | 3300009137 | Grasslands Soil | MNQQAVQERRCRGLNIAEAAFYSDLVLVIMLLSVYVPA* |
| Ga0099792_101098093 | 3300009143 | Vadose Zone Soil | MNEQAVQERRGRNLNIAEVAVYSVLVLLVMLLSVYVPA* |
| Ga0099792_102771032 | 3300009143 | Vadose Zone Soil | MNEQAVQERRGPGLNIAEVAFYSVVVLVIMLLSVYVPA* |
| Ga0114129_103863053 | 3300009147 | Populus Rhizosphere | MNEQAVHERPGRSLNIAEVAFYSVLVLLVMLLLVCVPA* |
| Ga0075423_116169701 | 3300009162 | Populus Rhizosphere | RRSTMNQQAVQEPRHRGLKIAEVVFYSVVVLVITLLSVYVPA* |
| Ga0126374_102503362 | 3300009792 | Tropical Forest Soil | MNEQAVQQRRGQGLNIAEVTFYSVLVLVIMFLSVYVPA* |
| Ga0126380_100596531 | 3300010043 | Tropical Forest Soil | RRSTMNEQAVEERRGRGLNVAEVAFYSVLALLIMLLSVYVPA* |
| Ga0126380_100867162 | 3300010043 | Tropical Forest Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSAYVPA* |
| Ga0126380_101428941 | 3300010043 | Tropical Forest Soil | MNEQAVQERRGRGLDIAEVAFYSVLVLLILLLSVYVPA* |
| Ga0126380_101779242 | 3300010043 | Tropical Forest Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA* |
| Ga0126380_104776273 | 3300010043 | Tropical Forest Soil | SQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA* |
| Ga0126380_116409051 | 3300010043 | Tropical Forest Soil | MDQQAVQVWRRRGLNIAELAVYSVLVVVITLVSVYVPA* |
| Ga0126384_104035782 | 3300010046 | Tropical Forest Soil | MNQQAVQNWRRRSLNIAEVAFYSVMVLAITLLSVYVPA* |
| Ga0126384_104522353 | 3300010046 | Tropical Forest Soil | MNQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA* |
| Ga0126384_107100111 | 3300010046 | Tropical Forest Soil | RSTINEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSIYVPA* |
| Ga0126384_108531312 | 3300010046 | Tropical Forest Soil | MNQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0126382_101445553 | 3300010047 | Tropical Forest Soil | MIQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA* |
| Ga0126373_101414463 | 3300010048 | Tropical Forest Soil | MNEQAVQQWRGRGLNIAEVAFYSVLILVIILLSVYVPA* |
| Ga0126373_104190793 | 3300010048 | Tropical Forest Soil | MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSIYVPA* |
| Ga0134067_104925311 | 3300010321 | Grasslands Soil | MNQQAAEEWRRRGLNIAEVVFYSVVVLVIVILSIYVPA* |
| Ga0134063_107249401 | 3300010335 | Grasslands Soil | MNQQAAQERRRWGLNIAEVAFYSALVLVILLLSLYIPA* |
| Ga0134062_101221743 | 3300010337 | Grasslands Soil | MNQQAAQERWRGLNIAEVAFYSVLVLVVMLLSFYIPA* |
| Ga0126370_114645641 | 3300010358 | Tropical Forest Soil | SVYDRRKATMNEQAVQQWRGRGLNIAEVAFYSVLILVIILLSVYVPA* |
| Ga0126370_119278611 | 3300010358 | Tropical Forest Soil | MNQQAVQERRRRGFNIAEVAVYSVVVLVITLLCVYVPA* |
| Ga0126370_121650401 | 3300010358 | Tropical Forest Soil | MNEQAVRERGRGLNIAEVAVYSALVLALMLLSVYVPA* |
| Ga0126376_104330841 | 3300010359 | Tropical Forest Soil | MNEQAVQERRRRDLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0126372_122986581 | 3300010360 | Tropical Forest Soil | MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0126378_119877191 | 3300010361 | Tropical Forest Soil | MSQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA* |
| Ga0126377_102599293 | 3300010362 | Tropical Forest Soil | MNEQTVPERRGLNIAEVAFYSALVLVILLLSVCVPA* |
| Ga0126377_104324851 | 3300010362 | Tropical Forest Soil | RKSTMNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA* |
| Ga0126377_109257322 | 3300010362 | Tropical Forest Soil | MNEQAVQERRGRGLNIAEVAFYSVLALLIMLLSVYVPA* |
| Ga0126377_129381241 | 3300010362 | Tropical Forest Soil | MNEQAVQERRGRGFDVTEVAFYSILVVVILLLSVYVPA* |
| Ga0126379_102549243 | 3300010366 | Tropical Forest Soil | MNQQAVQEWRRRGFNIAEVAFYSVLVVVIRLVSVYVPA* |
| Ga0126379_137825651 | 3300010366 | Tropical Forest Soil | MDQQGVQEWRRRGLNIAEVAFYSVLVVVITLVSVY |
| Ga0126381_1004310932 | 3300010376 | Tropical Forest Soil | MNEQAVQERRGRGFDVTEVAFYSIVVVVILLLLVYVPA* |
| Ga0126381_1010056792 | 3300010376 | Tropical Forest Soil | MNEQAVQQRRGQGLHIAEVTFYSVLVLVIMLLSVYVPA* |
| Ga0134124_123978101 | 3300010397 | Terrestrial Soil | RSTMNQQAVQEWRRRGLNIAEVAFYSGLVLVIMLLSVYVPA* |
| Ga0126383_103082681 | 3300010398 | Tropical Forest Soil | AVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA* |
| Ga0138505_1000561111 | 3300010999 | Soil | MNERTVQERKGRGLNIAEIAFYSALVVVVMLLSVYVPA* |
| Ga0137383_106673472 | 3300012199 | Vadose Zone Soil | MNGQAVEERWRRGLNIAEVAFYPVLVLVIMLLSVYVPA* |
| Ga0137362_100774522 | 3300012205 | Vadose Zone Soil | MDQQAAQGRRHRGLNIAEVAFYSGLVLVIALLSVYVPA* |
| Ga0137362_101510803 | 3300012205 | Vadose Zone Soil | MNEQAVQERRGRGLNIAEVAFYLVLVLLIMLLSVYVPA* |
| Ga0137376_116932682 | 3300012208 | Vadose Zone Soil | MNQRAVRERGLNLAEVALYSVLVLGIMLLSFYVPA* |
| Ga0137377_100978172 | 3300012211 | Vadose Zone Soil | MNQQAVQERRRQGLNIAEVAFYSVLVLVIMLLSFYIPA* |
| Ga0137370_100606491 | 3300012285 | Vadose Zone Soil | MNQQAVQEWRRRGLNIAEVVFYSVVVLVIVILTIYVPA* |
| Ga0137369_101016731 | 3300012355 | Vadose Zone Soil | MNEHAVQERRGRGLDIAEVALYSALVLLVILLSVCIPA* |
| Ga0137384_108877351 | 3300012357 | Vadose Zone Soil | IMNEHAVQERRGRGLDIAEVALYSALVLLVILLSVCIPA* |
| Ga0137385_103644942 | 3300012359 | Vadose Zone Soil | MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSFYIPA* |
| Ga0137385_104586741 | 3300012359 | Vadose Zone Soil | MNEQAVQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA* |
| Ga0137360_106462921 | 3300012361 | Vadose Zone Soil | MNQQAVQERRRRGLNIAEVAFYSVLVLVIMLLSFYIPA* |
| Ga0137361_104377162 | 3300012362 | Vadose Zone Soil | MNKQAVQERRGWGLNIAEVAFYSVVVLVIMLLSVYVPA* |
| Ga0137358_100731702 | 3300012582 | Vadose Zone Soil | MNEQTVQERKGRGLNIAEVAFYSALVLVVMLLSVYVPA* |
| Ga0137395_100266001 | 3300012917 | Vadose Zone Soil | MNEQAVQERRGWGRNIAEVAFYSVVVLVIMLLSVYVPA* |
| Ga0137404_102400863 | 3300012929 | Vadose Zone Soil | MNQQAAQERRRGLNIAEVAFYSVLVLVVMLLSFYIPA* |
| Ga0137404_108787232 | 3300012929 | Vadose Zone Soil | MNEQAVQERRGRGLNITEVAFYSVLVLVVMLLSVYVPA* |
| Ga0126375_101936533 | 3300012948 | Tropical Forest Soil | MDRQAVQERRRWGLNIAEVAFYSALVLVILLLSFYIPA* |
| Ga0126369_107927532 | 3300012971 | Tropical Forest Soil | MNQQAVQVWQRRGLNIAEVAFYSVVVVVITLVSVYVPA* |
| Ga0126369_123893271 | 3300012971 | Tropical Forest Soil | MDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYVPA* |
| Ga0164308_101855162 | 3300012985 | Soil | MNQQAVQEWRRRGLNIAEVAFYSILVLVIMLLSVYVPA* |
| Ga0164305_110601611 | 3300012989 | Soil | MNGQAIQERRGRGLNIAEVAFYSVLVLVVMLLSVYVPA* |
| Ga0157372_128719182 | 3300013307 | Corn Rhizosphere | SVYDRRRSTMNQQAVQEWRRRGLNIAEVAFYSGLVLVIMLLSVYVPA* |
| Ga0182041_100356651 | 3300016294 | Soil | MNEQAVQQRRGQGLNIAEVTFYSVLVLAIMLLSVYVPA |
| Ga0182033_100286721 | 3300016319 | Soil | RRRSTMNEQAVQERRGRGLNIAEVAFYSVLLLVVMLLSVYVPA |
| Ga0182035_116710041 | 3300016341 | Soil | MNQQAVQVWRRRGLNIAEVAFYSVVVVVITLVSVYVPA |
| Ga0182037_112819362 | 3300016404 | Soil | MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVY |
| Ga0182038_120566011 | 3300016445 | Soil | MDEQAVQEGRGQGLSIAEVAFYSVLVLLVMLLSIYIPA |
| Ga0066667_122603241 | 3300018433 | Grasslands Soil | MNQQAAQERRRWGLNIAEVAFYSVLVLVVMLLSFYIPA |
| Ga0066662_113382871 | 3300018468 | Grasslands Soil | MNQQAVQEWRRRGLNIAEVVFYSVVVLVIVILSIYVPA |
| Ga0066669_113131521 | 3300018482 | Grasslands Soil | MNQQAVQEWRRRGLKIAEVVFYSVVVLVILSLSIYVPAC |
| Ga0210399_114408231 | 3300020581 | Soil | MNEQAVHERPGRSLNIAEVAFYSVLVLLVMLLLVCVPA |
| Ga0210401_113497751 | 3300020583 | Soil | RRSTMNEQAVQEQRGRGLNIAEVAFYSVLVLVVMLLSVYVPA |
| Ga0210406_112893811 | 3300021168 | Soil | MNEQAVQEQRGRGLNIAEVAFYSVLVLVVMLLSVYVPA |
| Ga0210400_109040433 | 3300021170 | Soil | STMNQQAAEEWRRRGLNIAEVAFYSVLVFVIMLLSVYVPA |
| Ga0213872_101542873 | 3300021361 | Rhizosphere | MNQQAVQEPRRRGLNIAEAAFYSLLVLVIMLLWVYVPA |
| Ga0213877_100150942 | 3300021372 | Bulk Soil | MDQQAVQMWRRRGLNIAEVAFYSVLVVVITLMSVYVPA |
| Ga0210387_101155291 | 3300021405 | Soil | MNEQTVQERKGRGLNIAEVAFYSALVVVVMLLSVYVPA |
| Ga0210402_114311511 | 3300021478 | Soil | MNQQAAEEWRRRGLNIAEVAFYSVLVFVIMLLSVYVPA |
| Ga0126371_106165952 | 3300021560 | Tropical Forest Soil | MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSIYVPA |
| Ga0126371_107870813 | 3300021560 | Tropical Forest Soil | MNQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0126371_115258032 | 3300021560 | Tropical Forest Soil | MDEQAVQEGRNQGLSIAEVAFYSILVLLAMLLSMYIPA |
| Ga0126371_116412652 | 3300021560 | Tropical Forest Soil | MNEQAVQERRGRGFDVTEVAFYSILVVVILLLSVYVPA |
| Ga0126371_119075872 | 3300021560 | Tropical Forest Soil | MNQQAVQERRRRGLNIAEVAFYSVLVVVITLVSVYAPA |
| Ga0179589_101269151 | 3300024288 | Vadose Zone Soil | MNEQTVQERKGRGLNIAEVAFYSALVLVVMLLSVYVPA |
| Ga0207646_109761232 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQQAVQERRRQGLNIAEVAFYSVLVLVIMLLSFYIPA |
| Ga0209240_100101810 | 3300026304 | Grasslands Soil | MNEQAVQERRGPGLNIAEVAFYSVVVLVIMLLSVYVPA |
| Ga0209240_11981112 | 3300026304 | Grasslands Soil | MNEQAVQERRGRGLNIAEVAFYLVLVLLIMLLSVYVPA |
| Ga0209647_10175045 | 3300026319 | Grasslands Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLLIMLLSVYVPA |
| Ga0209647_10494311 | 3300026319 | Grasslands Soil | MNEQAVQQRRGRGLDIAEVAFYSVLVLIIMLLSVYVPA |
| Ga0257163_10714562 | 3300026359 | Soil | MNEQAVQERRGRSLNIAEVAVYSVLVLLVMLLSVYVPA |
| Ga0257168_10474331 | 3300026514 | Soil | MNEQAVQERRGRGLNIPEVAFYSVLVLVVMLLSVYVPA |
| Ga0209648_104978272 | 3300026551 | Grasslands Soil | MNEQGVQERGRGLNIAEVAFYSVLVLVVMLLSVYVPA |
| Ga0209577_103443562 | 3300026552 | Soil | QQAAQEWRRRGLNIAEVAFYSVLVLVIMLLSVYVPA |
| Ga0208273_1030531 | 3300026846 | Soil | MNEQAVQERRGPGLNIGEVAFYSVLVLVVMLLSVYVP |
| Ga0209729_10116122 | 3300027061 | Forest Soil | MDQQAAQGRRRRGLNIAEVAFYSGLVLVITLLSVY |
| Ga0209622_10532651 | 3300027502 | Forest Soil | MNEQAAQERRGRGLNIAEVAFYSVLVLLVMLLSVYVPA |
| Ga0209466_10066933 | 3300027646 | Tropical Forest Soil | MDQQAVQVWRRRGLNIAELAVYSVLVVVITLVSVYVPA |
| Ga0209526_100266536 | 3300028047 | Forest Soil | MNEQAVQERGRGLNIAEVAFYSVLVLVVMLLSVYVPA |
| Ga0209526_100270003 | 3300028047 | Forest Soil | MNQQAVQKWRRRGLNIAEVAFYSVTVFAITLLSVYVPA |
| Ga0307282_100252321 | 3300028784 | Soil | MNQQAVQEWRRRGLNIAEVAFYSVLVLVIMFLSVYVPA |
| Ga0307278_105442142 | 3300028878 | Soil | MDQQAVQEWRRRGLNIAEVAFYSVLIVVITLLSVYVPA |
| Ga0318516_1000332410 | 3300031543 | Soil | MDQQGVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0318516_100268341 | 3300031543 | Soil | MDQQAVRVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0318516_100908892 | 3300031543 | Soil | MNEQAVQQPRGQGLNIAEVALYSVLVLVIMLLSVYVPA |
| Ga0318516_102707633 | 3300031543 | Soil | MNEQAVQERRGRGLNIAEVAFYSVLVLLILLLSVYVPA |
| Ga0318516_104534252 | 3300031543 | Soil | MNEQAVQERRGRGLNIAEVAFYSVLLLVVMLLSVYVPA |
| Ga0318528_101290542 | 3300031561 | Soil | MDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYVPA |
| Ga0318528_102975071 | 3300031561 | Soil | MDQQAAQGRRRRGLNIAEVAFYSGLVLVITLLSVYVPA |
| Ga0318528_106426481 | 3300031561 | Soil | MDQQAVRVWRRRGLNIAEVAFYSVLVVVITLVSVYV |
| Ga0318515_100554624 | 3300031572 | Soil | MDQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0318515_105635241 | 3300031572 | Soil | MNQQAVQVWQRRGLNIAEVAFYSVVVVVITLVSVYVPA |
| Ga0318574_101246912 | 3300031680 | Soil | MNQQAVQEWRRRGLNIAELAFYLVLVFVITLVSVYVPA |
| Ga0318574_108667232 | 3300031680 | Soil | MDQQAVHVWRLRGFNLAEVAFYSVVVVVITLVSVYV |
| Ga0318496_108550621 | 3300031713 | Soil | LLVLAIRRKSTMNEQAVQERRGRGFNIAEVAFYSVPVLVVMLLSAYVPA |
| Ga0306917_100744845 | 3300031719 | Soil | MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0306917_108735802 | 3300031719 | Soil | MNEQTVQEQPSRGLNIAEVAFYSVLVLVIMLLSVYIPA |
| Ga0318521_108002711 | 3300031770 | Soil | MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYGPA |
| Ga0307473_107609982 | 3300031820 | Hardwood Forest Soil | MNEQAVQERWGRGLNIAEVAFYSVLVLVVMLLSVYVPA |
| Ga0318511_103635891 | 3300031845 | Soil | MNEQAVQEPRGRGLNIAEVAFYSVLVFLVMLLSVYVPA |
| Ga0318495_100780021 | 3300031860 | Soil | YHRRRSTMDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0306923_102689693 | 3300031910 | Soil | MNEQTVQEQRSRGLNIAEVAFYSVLVLVIMLLSVYIPA |
| Ga0310912_109204582 | 3300031941 | Soil | MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYV |
| Ga0310910_107309672 | 3300031946 | Soil | MDQQAVQEWRRRGLNIAEVAFYSVLVVVITLVSVYVP |
| Ga0318530_101276451 | 3300031959 | Soil | MNEQAVHERRGRGLNIAEVAFYSVLVLLILLLSVYVPA |
| Ga0318507_100119103 | 3300032025 | Soil | MDQQAVRVWRRRGLNIAEVAFYSVLVVVITLVSVY |
| Ga0318559_101750081 | 3300032039 | Soil | SNMDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVPA |
| Ga0307471_1008915681 | 3300032180 | Hardwood Forest Soil | MNKQAVEERRGWGLNIAEVAFYSVVVLVIMLLSVYVPA |
| Ga0307472_1003145533 | 3300032205 | Hardwood Forest Soil | QQAVQGRRGQGLSIAEVAFYSALVLVILLLSLYIPA |
| Ga0318519_107927722 | 3300033290 | Soil | MDQQAVQVWRRRGLNIAEVAFYSVLVVVITLVSVYVP |
| ⦗Top⦘ |