


| Basic Information | |
|---|---|
| Family ID | F025768 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MINFIKKILGIDNLEYKIRLLERKNYWREKYKHG |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.00 % |
| % of genes near scaffold ends (potentially truncated) | 21.00 % |
| % of genes from short scaffolds (< 2000 bps) | 74.00 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (31.500 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.55% β-sheet: 0.00% Coil/Unstructured: 56.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 3.50 |
| PF01832 | Glucosaminidase | 3.00 |
| PF00166 | Cpn10 | 2.50 |
| PF03237 | Terminase_6N | 2.00 |
| PF08291 | Peptidase_M15_3 | 1.50 |
| PF01327 | Pep_deformylase | 1.50 |
| PF00149 | Metallophos | 1.50 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.50 |
| PF12322 | T4_baseplate | 1.00 |
| PF16778 | Phage_tail_APC | 0.50 |
| PF08007 | JmjC_2 | 0.50 |
| PF03889 | ArfA | 0.50 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.50 |
| PF01510 | Amidase_2 | 0.50 |
| PF11651 | P22_CoatProtein | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.50 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 1.50 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG3036 | Stalled ribosome alternative rescue factor ArfA | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.00 % |
| Unclassified | root | N/A | 31.50 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10070501 | Not Available | 1262 | Open in IMG/M |
| 3300001450|JGI24006J15134_10104282 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300001460|JGI24003J15210_10058412 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300001945|GOS2241_1031316 | Not Available | 1530 | Open in IMG/M |
| 3300001945|GOS2241_1034246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1457 | Open in IMG/M |
| 3300001949|GOS2238_1050644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1625 | Open in IMG/M |
| 3300001954|GOS2235_1044843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1447 | Open in IMG/M |
| 3300001965|GOS2243_1054974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1327 | Open in IMG/M |
| 3300001974|GOS2246_10089500 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300002231|KVRMV2_100442356 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300002231|KVRMV2_100512610 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
| 3300002231|KVRMV2_100532214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1483 | Open in IMG/M |
| 3300002231|KVRMV2_100606943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 899 | Open in IMG/M |
| 3300002231|KVRMV2_100817562 | Not Available | 624 | Open in IMG/M |
| 3300002242|KVWGV2_10411057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 532 | Open in IMG/M |
| 3300002242|KVWGV2_10562572 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300002482|JGI25127J35165_1000325 | All Organisms → cellular organisms → Bacteria | 14613 | Open in IMG/M |
| 3300002482|JGI25127J35165_1015292 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
| 3300005946|Ga0066378_10241080 | Not Available | 564 | Open in IMG/M |
| 3300006026|Ga0075478_10120439 | Not Available | 829 | Open in IMG/M |
| 3300006027|Ga0075462_10006925 | Not Available | 3678 | Open in IMG/M |
| 3300006305|Ga0068468_1085125 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300006305|Ga0068468_1140839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1249 | Open in IMG/M |
| 3300006332|Ga0068500_1555499 | All Organisms → Viruses → environmental samples → uncultured virus | 609 | Open in IMG/M |
| 3300006334|Ga0099675_1050536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2158 | Open in IMG/M |
| 3300006345|Ga0099693_1088644 | All Organisms → Viruses → environmental samples → uncultured virus | 522 | Open in IMG/M |
| 3300006350|Ga0099954_1546811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 545 | Open in IMG/M |
| 3300006735|Ga0098038_1006643 | All Organisms → Viruses → Predicted Viral | 4679 | Open in IMG/M |
| 3300006735|Ga0098038_1053355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1455 | Open in IMG/M |
| 3300006737|Ga0098037_1006673 | All Organisms → Viruses → Predicted Viral | 4668 | Open in IMG/M |
| 3300006737|Ga0098037_1141676 | Not Available | 811 | Open in IMG/M |
| 3300006737|Ga0098037_1183456 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300006737|Ga0098037_1245925 | All Organisms → Viruses → environmental samples → uncultured virus | 575 | Open in IMG/M |
| 3300006749|Ga0098042_1000702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 12981 | Open in IMG/M |
| 3300006749|Ga0098042_1125562 | All Organisms → Viruses → environmental samples → uncultured virus | 638 | Open in IMG/M |
| 3300006749|Ga0098042_1170602 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 527 | Open in IMG/M |
| 3300006789|Ga0098054_1172375 | Not Available | 794 | Open in IMG/M |
| 3300006790|Ga0098074_1028650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1635 | Open in IMG/M |
| 3300006790|Ga0098074_1110183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 724 | Open in IMG/M |
| 3300006810|Ga0070754_10507894 | Not Available | 518 | Open in IMG/M |
| 3300006916|Ga0070750_10022568 | Not Available | 3184 | Open in IMG/M |
| 3300006916|Ga0070750_10114936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1238 | Open in IMG/M |
| 3300006919|Ga0070746_10548238 | Not Available | 502 | Open in IMG/M |
| 3300006921|Ga0098060_1003744 | Not Available | 5504 | Open in IMG/M |
| 3300006921|Ga0098060_1161517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 619 | Open in IMG/M |
| 3300006922|Ga0098045_1006580 | All Organisms → Viruses → Predicted Viral | 3469 | Open in IMG/M |
| 3300006928|Ga0098041_1278507 | All Organisms → Viruses → environmental samples → uncultured virus | 532 | Open in IMG/M |
| 3300006929|Ga0098036_1011117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2905 | Open in IMG/M |
| 3300006929|Ga0098036_1019961 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
| 3300006929|Ga0098036_1077596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1024 | Open in IMG/M |
| 3300006929|Ga0098036_1142265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 734 | Open in IMG/M |
| 3300007608|Ga0102800_1172808 | Not Available | 681 | Open in IMG/M |
| 3300007963|Ga0110931_1048105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1287 | Open in IMG/M |
| 3300008218|Ga0114904_1080001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 814 | Open in IMG/M |
| 3300008220|Ga0114910_1191560 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 567 | Open in IMG/M |
| 3300009071|Ga0115566_10727055 | Not Available | 549 | Open in IMG/M |
| 3300009418|Ga0114908_1182789 | Not Available | 658 | Open in IMG/M |
| 3300009426|Ga0115547_1075155 | Not Available | 1144 | Open in IMG/M |
| 3300009443|Ga0115557_1028463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2698 | Open in IMG/M |
| 3300009481|Ga0114932_10166496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1350 | Open in IMG/M |
| 3300009481|Ga0114932_10379737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 840 | Open in IMG/M |
| 3300009481|Ga0114932_10747236 | Not Available | 568 | Open in IMG/M |
| 3300009481|Ga0114932_10896213 | Not Available | 512 | Open in IMG/M |
| 3300009488|Ga0114925_11035574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300009703|Ga0114933_10593454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 714 | Open in IMG/M |
| 3300010148|Ga0098043_1096817 | Not Available | 864 | Open in IMG/M |
| 3300010149|Ga0098049_1167582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 677 | Open in IMG/M |
| 3300010153|Ga0098059_1223107 | Not Available | 730 | Open in IMG/M |
| 3300011253|Ga0151671_1005827 | Not Available | 1037 | Open in IMG/M |
| 3300012920|Ga0160423_10004964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 10896 | Open in IMG/M |
| 3300012920|Ga0160423_10040876 | Not Available | 3400 | Open in IMG/M |
| 3300012920|Ga0160423_10157115 | Not Available | 1594 | Open in IMG/M |
| 3300012920|Ga0160423_10358300 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300012920|Ga0160423_10566500 | unclassified Hyphomonas → Hyphomonas sp. | 770 | Open in IMG/M |
| 3300012920|Ga0160423_10751210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 657 | Open in IMG/M |
| 3300012920|Ga0160423_10934187 | Not Available | 582 | Open in IMG/M |
| 3300012952|Ga0163180_10184577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1413 | Open in IMG/M |
| 3300012952|Ga0163180_10479086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 926 | Open in IMG/M |
| 3300017708|Ga0181369_1024254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1456 | Open in IMG/M |
| 3300017708|Ga0181369_1036523 | Not Available | 1139 | Open in IMG/M |
| 3300017708|Ga0181369_1119908 | Not Available | 535 | Open in IMG/M |
| 3300017719|Ga0181390_1104809 | Not Available | 752 | Open in IMG/M |
| 3300017721|Ga0181373_1032171 | Not Available | 968 | Open in IMG/M |
| 3300017721|Ga0181373_1051174 | Not Available | 750 | Open in IMG/M |
| 3300017724|Ga0181388_1012509 | All Organisms → Viruses → environmental samples → uncultured virus | 2179 | Open in IMG/M |
| 3300017731|Ga0181416_1052057 | Not Available | 966 | Open in IMG/M |
| 3300017732|Ga0181415_1012461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2011 | Open in IMG/M |
| 3300017732|Ga0181415_1055357 | All Organisms → Viruses | 901 | Open in IMG/M |
| 3300017738|Ga0181428_1078863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 768 | Open in IMG/M |
| 3300017745|Ga0181427_1017786 | All Organisms → Viruses | 1780 | Open in IMG/M |
| 3300017753|Ga0181407_1066282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 931 | Open in IMG/M |
| 3300017759|Ga0181414_1063709 | Not Available | 981 | Open in IMG/M |
| 3300017760|Ga0181408_1068436 | Not Available | 937 | Open in IMG/M |
| 3300017763|Ga0181410_1155619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 641 | Open in IMG/M |
| 3300017764|Ga0181385_1102126 | Not Available | 878 | Open in IMG/M |
| 3300017773|Ga0181386_1084567 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300017779|Ga0181395_1065471 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300017786|Ga0181424_10303919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 662 | Open in IMG/M |
| 3300017951|Ga0181577_10080796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 2271 | Open in IMG/M |
| 3300018416|Ga0181553_10099053 | Not Available | 1804 | Open in IMG/M |
| 3300018618|Ga0193204_1013520 | All Organisms → Viruses → environmental samples → uncultured virus | 621 | Open in IMG/M |
| 3300020274|Ga0211658_1071029 | Not Available | 704 | Open in IMG/M |
| 3300020281|Ga0211483_10163805 | Not Available | 738 | Open in IMG/M |
| 3300020314|Ga0211522_1042177 | Not Available | 807 | Open in IMG/M |
| 3300020365|Ga0211506_1044509 | Not Available | 1261 | Open in IMG/M |
| 3300020367|Ga0211703_10195494 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 530 | Open in IMG/M |
| 3300020374|Ga0211477_10030100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 2296 | Open in IMG/M |
| 3300020374|Ga0211477_10099365 | Not Available | 1075 | Open in IMG/M |
| 3300020380|Ga0211498_10029268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2033 | Open in IMG/M |
| 3300020388|Ga0211678_10049909 | All Organisms → Viruses → Predicted Viral | 1973 | Open in IMG/M |
| 3300020406|Ga0211668_10012420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4362 | Open in IMG/M |
| 3300020408|Ga0211651_10391271 | Not Available | 513 | Open in IMG/M |
| 3300020410|Ga0211699_10070254 | All Organisms → Viruses | 1295 | Open in IMG/M |
| 3300020410|Ga0211699_10072752 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300020414|Ga0211523_10292431 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 668 | Open in IMG/M |
| 3300020416|Ga0211644_10456412 | All Organisms → Viruses → environmental samples → uncultured virus | 528 | Open in IMG/M |
| 3300020430|Ga0211622_10270733 | Not Available | 727 | Open in IMG/M |
| 3300020436|Ga0211708_10059704 | Not Available | 1472 | Open in IMG/M |
| 3300020436|Ga0211708_10266496 | Not Available | 694 | Open in IMG/M |
| 3300020436|Ga0211708_10352202 | Not Available | 602 | Open in IMG/M |
| 3300020436|Ga0211708_10370242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 586 | Open in IMG/M |
| 3300020439|Ga0211558_10040554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2343 | Open in IMG/M |
| 3300020448|Ga0211638_10481486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 584 | Open in IMG/M |
| 3300020455|Ga0211664_10039512 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
| 3300020456|Ga0211551_10415259 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 642 | Open in IMG/M |
| 3300020461|Ga0211535_10003774 | Not Available | 6076 | Open in IMG/M |
| 3300020462|Ga0211546_10191573 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1014 | Open in IMG/M |
| 3300020462|Ga0211546_10289634 | Not Available | 818 | Open in IMG/M |
| 3300020465|Ga0211640_10126202 | Not Available | 1463 | Open in IMG/M |
| 3300020471|Ga0211614_10470216 | Not Available | 557 | Open in IMG/M |
| 3300020472|Ga0211579_10145094 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300022053|Ga0212030_1003914 | Not Available | 1605 | Open in IMG/M |
| 3300022074|Ga0224906_1007422 | All Organisms → Viruses | 4441 | Open in IMG/M |
| 3300022074|Ga0224906_1011600 | Not Available | 3382 | Open in IMG/M |
| 3300022074|Ga0224906_1087765 | Not Available | 934 | Open in IMG/M |
| 3300022074|Ga0224906_1089904 | All Organisms → Viruses | 919 | Open in IMG/M |
| 3300022178|Ga0196887_1008825 | All Organisms → Viruses | 3343 | Open in IMG/M |
| 3300024344|Ga0209992_10026946 | All Organisms → Viruses | 2983 | Open in IMG/M |
| 3300024344|Ga0209992_10040964 | All Organisms → Viruses | 2274 | Open in IMG/M |
| 3300024433|Ga0209986_10013010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 6087 | Open in IMG/M |
| 3300025084|Ga0208298_1077861 | All Organisms → Viruses | 618 | Open in IMG/M |
| 3300025086|Ga0208157_1014561 | All Organisms → Viruses | 2510 | Open in IMG/M |
| 3300025086|Ga0208157_1054115 | All Organisms → Viruses | 1068 | Open in IMG/M |
| 3300025086|Ga0208157_1140223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 542 | Open in IMG/M |
| 3300025099|Ga0208669_1032949 | All Organisms → Viruses | 1255 | Open in IMG/M |
| 3300025099|Ga0208669_1097271 | All Organisms → Viruses | 617 | Open in IMG/M |
| 3300025102|Ga0208666_1054014 | All Organisms → Viruses | 1112 | Open in IMG/M |
| 3300025102|Ga0208666_1140187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 551 | Open in IMG/M |
| 3300025103|Ga0208013_1033676 | All Organisms → Viruses | 1452 | Open in IMG/M |
| 3300025110|Ga0208158_1088722 | Not Available | 732 | Open in IMG/M |
| 3300025127|Ga0209348_1000070 | Not Available | 61238 | Open in IMG/M |
| 3300025127|Ga0209348_1000229 | All Organisms → Viruses | 31075 | Open in IMG/M |
| 3300025127|Ga0209348_1001513 | All Organisms → Viruses | 11273 | Open in IMG/M |
| 3300025127|Ga0209348_1004707 | All Organisms → Viruses | 5976 | Open in IMG/M |
| 3300025127|Ga0209348_1006322 | All Organisms → Viruses | 5014 | Open in IMG/M |
| 3300025127|Ga0209348_1015624 | All Organisms → Viruses | 2927 | Open in IMG/M |
| 3300025127|Ga0209348_1024341 | All Organisms → Viruses | 2229 | Open in IMG/M |
| 3300025127|Ga0209348_1032442 | All Organisms → Viruses → Predicted Viral | 1863 | Open in IMG/M |
| 3300025127|Ga0209348_1041465 | All Organisms → Viruses | 1595 | Open in IMG/M |
| 3300025127|Ga0209348_1085257 | Not Available | 1002 | Open in IMG/M |
| 3300025127|Ga0209348_1087236 | All Organisms → Viruses | 987 | Open in IMG/M |
| 3300025127|Ga0209348_1115158 | All Organisms → Viruses | 821 | Open in IMG/M |
| 3300025132|Ga0209232_1097092 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 999 | Open in IMG/M |
| 3300025132|Ga0209232_1181909 | All Organisms → Viruses | 652 | Open in IMG/M |
| 3300025138|Ga0209634_1058588 | All Organisms → Viruses | 1863 | Open in IMG/M |
| 3300025151|Ga0209645_1013857 | All Organisms → Viruses | 3178 | Open in IMG/M |
| 3300025151|Ga0209645_1102458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 926 | Open in IMG/M |
| 3300025151|Ga0209645_1193409 | All Organisms → Viruses | 605 | Open in IMG/M |
| 3300025151|Ga0209645_1235643 | All Organisms → Viruses | 519 | Open in IMG/M |
| 3300025151|Ga0209645_1247122 | Not Available | 501 | Open in IMG/M |
| 3300025251|Ga0208182_1064914 | All Organisms → Viruses | 719 | Open in IMG/M |
| 3300025270|Ga0208813_1050692 | All Organisms → Viruses | 916 | Open in IMG/M |
| 3300025759|Ga0208899_1082502 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300025828|Ga0208547_1026694 | All Organisms → Viruses | 2247 | Open in IMG/M |
| 3300025874|Ga0209533_1237903 | Not Available | 739 | Open in IMG/M |
| 3300026138|Ga0209951_1063758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 779 | Open in IMG/M |
| 3300027859|Ga0209503_10042813 | All Organisms → Viruses → Predicted Viral | 2057 | Open in IMG/M |
| 3300027859|Ga0209503_10236234 | All Organisms → Viruses | 883 | Open in IMG/M |
| 3300028022|Ga0256382_1064997 | All Organisms → Viruses | 861 | Open in IMG/M |
| 3300029309|Ga0183683_1001783 | All Organisms → Viruses | 8404 | Open in IMG/M |
| 3300029309|Ga0183683_1037945 | Not Available | 776 | Open in IMG/M |
| 3300029319|Ga0183748_1000966 | All Organisms → Viruses | 18302 | Open in IMG/M |
| 3300029319|Ga0183748_1001572 | All Organisms → Viruses | 13568 | Open in IMG/M |
| 3300029319|Ga0183748_1002862 | All Organisms → Viruses | 9249 | Open in IMG/M |
| 3300029319|Ga0183748_1011917 | Not Available | 3529 | Open in IMG/M |
| 3300029319|Ga0183748_1015524 | All Organisms → Viruses | 2901 | Open in IMG/M |
| 3300029319|Ga0183748_1024194 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2082 | Open in IMG/M |
| 3300029319|Ga0183748_1129732 | Not Available | 530 | Open in IMG/M |
| 3300029448|Ga0183755_1004981 | All Organisms → Viruses | 6253 | Open in IMG/M |
| 3300029448|Ga0183755_1076934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 725 | Open in IMG/M |
| 3300029787|Ga0183757_1002924 | All Organisms → Viruses | 6448 | Open in IMG/M |
| 3300029787|Ga0183757_1003759 | Not Available | 5476 | Open in IMG/M |
| 3300029787|Ga0183757_1006563 | All Organisms → Viruses → Predicted Viral | 3713 | Open in IMG/M |
| 3300029787|Ga0183757_1029894 | All Organisms → Viruses | 1158 | Open in IMG/M |
| 3300029787|Ga0183757_1036511 | All Organisms → Viruses | 970 | Open in IMG/M |
| 3300029787|Ga0183757_1048836 | Not Available | 743 | Open in IMG/M |
| 3300029787|Ga0183757_1060100 | All Organisms → Viruses | 612 | Open in IMG/M |
| 3300031774|Ga0315331_11103337 | Not Available | 534 | Open in IMG/M |
| 3300032212|Ga0316207_10291273 | Not Available | 615 | Open in IMG/M |
| 3300033742|Ga0314858_078490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 826 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 24.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.00% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.50% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.50% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.50% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.50% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.50% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.00% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.50% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.50% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.50% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.50% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.50% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.50% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001949 | Marine microbial communities from Panama City, Panama - GS022 | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007608 | Marine microbial communities from the Southern Atlantic ocean - KN S19 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018618 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032212 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyrite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100705016 | 3300000115 | Marine | MINFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKSA* |
| JGI24006J15134_101042823 | 3300001450 | Marine | MIAFIKKVLGISNLEYKIRLLERKNYWREKYKHG* |
| JGI24003J15210_100584123 | 3300001460 | Marine | MIAFIKKVLGISDLEYKIRLLERKNYWREKYRHG* |
| GOS2241_10313163 | 3300001945 | Marine | MLNFIKKILGIDNLEYKIRLLERKNYWREKYNGSKGINN* |
| GOS2241_10342466 | 3300001945 | Marine | MITFIKKILGIDNLEYKIRLLERKNYWRDKYKTWLRK* |
| GOS2238_10506443 | 3300001949 | Marine | MINFIKKILGISDLEYKVRLLQRQNYWRDKYKHG* |
| GOS2235_10448431 | 3300001954 | Marine | MITLIKKILGITDLEYKVRLLQRKNYWRDKYKHG* |
| GOS2243_10549742 | 3300001965 | Marine | MIAFIKKILGISDLEYQVRLLQRQNYWRGKYKVRT* |
| GOS2246_100895003 | 3300001974 | Marine | MISFIKKILGIDNLEYKIRLLERKNYWREKYNGSKSINN* |
| KVRMV2_1004423562 | 3300002231 | Marine Sediment | MIAFIKKILGIDAIEYNIRLLQRKNYWKEKYGTRKKST* |
| KVRMV2_1005126102 | 3300002231 | Marine Sediment | VITFIKKLLGIDDLERRTRLLERKNYWKEKYGTNKKST* |
| KVRMV2_1005322143 | 3300002231 | Marine Sediment | MLNFIKKILGINTLEYKIRLLERKNYWREKYKHG* |
| KVRMV2_1006069433 | 3300002231 | Marine Sediment | MIXFIKKXLGXDXIEYNIRLLQRKNYWRDKYRHGQEN* |
| KVRMV2_1008175621 | 3300002231 | Marine Sediment | MVDFIKKVLGISKLEYQVRQLHRKNYWRDKYSGSKSRNY* |
| KVWGV2_104110571 | 3300002242 | Marine Sediment | MLNFIKKLLGINTLEYKIRLLERKNYWKEKYKHG* |
| KVWGV2_105625724 | 3300002242 | Marine Sediment | MIDFIKKVLGISNLEYKIRLLERKNYWREKYKHG* |
| JGI25127J35165_100032512 | 3300002482 | Marine | MEMLKEFIKKLLGIDKLEFKIRLLERKNYWREKYGVKDIRRS* |
| JGI25127J35165_10152921 | 3300002482 | Marine | MLKFIRKILGIDNLEYKIRLLERKNYWREKYNGSKSINN* |
| Ga0066378_102410801 | 3300005946 | Marine | MITFIKKILGITDLEYKVRLLQRQNYWRDKYKHG* |
| Ga0075478_101204394 | 3300006026 | Aqueous | QIVINFIKKVLGISDLEYKIRLLERKNYWREKYRHG* |
| Ga0075462_100069255 | 3300006027 | Aqueous | MINFIKKVLGINNLEYKIRLLERKNYWREKYGTRKKSA* |
| Ga0068468_10851254 | 3300006305 | Marine | MISFIKKLLGITDLEYKVRLLQRQNYWRDKYKHG* |
| Ga0068468_11408393 | 3300006305 | Marine | MLVFIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN* |
| Ga0068500_15554992 | 3300006332 | Marine | MISLIKKLLGISDLEYKVRLLERKNYWREKYKHG* |
| Ga0099675_10505365 | 3300006334 | Marine | MLNFIKKILGILDLEKRTRIIERKNYWREKYRVR* |
| Ga0099693_10886442 | 3300006345 | Marine | MITFIKNLLGITDLEYKVRLLQRQNYWRDKYKHG* |
| Ga0099954_15468113 | 3300006350 | Marine | MIAFIKKLLGIDTIEYNIRLLQRKNYWRDKYRHGKEN* |
| Ga0098038_10066439 | 3300006735 | Marine | MINFIKKILGIDVIEYNIRLLQRKNYWKEKYGTNKKST* |
| Ga0098038_10533553 | 3300006735 | Marine | MIAFIKKILGISDLEYQVRLLQRQNYWKGKYKVRT* |
| Ga0098037_10066732 | 3300006737 | Marine | MINFLKKLLGITELEYKVRLLQRQNYWRDKYKHAR* |
| Ga0098037_11416762 | 3300006737 | Marine | MINFIKKILGITDLEYQLRLIHRKNYWRGKYKK*KKQKQK* |
| Ga0098037_11834563 | 3300006737 | Marine | MLNFIKKILGINTLEYKIRLLERKNYWRGKYKHG* |
| Ga0098037_12459253 | 3300006737 | Marine | MINYIKKILGITDLEYQLRLIQRKNYWRDKYKK*KKQKQK* |
| Ga0098042_100070212 | 3300006749 | Marine | MLDLLKKLLGIDKLEYKIRLLERKNYWREKYRDR* |
| Ga0098042_11255623 | 3300006749 | Marine | MISFIKKILGITNIEYQIRLLQRQSYWRGKYKK*KKQEQK* |
| Ga0098042_11706022 | 3300006749 | Marine | MLINFFKKLFGYDKLDKRIRLLERKNYWREKYKHGL |
| Ga0098054_11723753 | 3300006789 | Marine | MISFIKKILGITNLEYQIRIIQRQNYWRGKYKK*KKQKQK* |
| Ga0098074_10286502 | 3300006790 | Marine | MIAFIKKLLGISDLEYKVRLLERKNYWREKYKNG* |
| Ga0098074_11101832 | 3300006790 | Marine | MINFIKKILGINDLEYKVRLLQRAQYWREKYGKKIK* |
| Ga0070754_105078942 | 3300006810 | Aqueous | MIDFIKKVLGISDLEYKIRLLERKNYWREKYKHG* |
| Ga0070750_1002256811 | 3300006916 | Aqueous | MVAFIKKLLGISNLEYKIRLLERKNYWREKYGTRKKSA* |
| Ga0070750_101149367 | 3300006916 | Aqueous | MINFIKKILGISDLEYKVRLIQRQNYWRDKYNRWLRK* |
| Ga0070746_105482382 | 3300006919 | Aqueous | MLELLKKLLGIDKLEYKIRLLERKNYWREKYRDRQNSL* |
| Ga0098060_10037449 | 3300006921 | Marine | MINFIKKVLGIDNLEYKIRLLERKNYWREKYGTRKKSA* |
| Ga0098060_11615173 | 3300006921 | Marine | MINFIKKILGITDLEYQLRLIQRKNYWRDKYKK*KNQKQ |
| Ga0098045_10065801 | 3300006922 | Marine | AFIKKILGIDAIEYKIRLLQRKNYWKEKYGTRKKST* |
| Ga0098041_12785073 | 3300006928 | Marine | MLDFIKKILGISNLEYKIRLLERKNYWREKYNGSKGINN* |
| Ga0098036_10111171 | 3300006929 | Marine | RWRIQVMINFIKKILGITDLEYQLRLIHRKNYWRGKYKK* |
| Ga0098036_10199614 | 3300006929 | Marine | VITFIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN* |
| Ga0098036_10775963 | 3300006929 | Marine | MINFIKKILGIADLEYQLRLIHRKNYWRDKYKK*KKQKQK* |
| Ga0098036_11422653 | 3300006929 | Marine | MISLIKKILGISDLEYQVRLLQRQNYWRGKYKVRT*KKQKQK* |
| Ga0102800_11728082 | 3300007608 | Marine | MITFIKKILGITDLEYKVRLLQRKNYWRDKYKHG* |
| Ga0110931_10481051 | 3300007963 | Marine | MEMLINFFKKLCGFEELEYRVRLLERKNYWREKYK |
| Ga0114904_10800013 | 3300008218 | Deep Ocean | MIAFIKKILGIDNLEYKIRLLERKNYWREKYGTSK |
| Ga0114910_11915603 | 3300008220 | Deep Ocean | VQIMISLIKKLLGISDLEYKVRLLERKNYWREKYKHG* |
| Ga0115566_107270553 | 3300009071 | Pelagic Marine | MINFIKKILGIDNLEYKIRLLERKNYWREKYKWR* |
| Ga0114908_11827891 | 3300009418 | Deep Ocean | VVAFIKKILGISKLEYQVRQLNRKNYWRDKYSGSKS |
| Ga0115547_10751551 | 3300009426 | Pelagic Marine | WLYIMINFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKSA* |
| Ga0115557_10284631 | 3300009443 | Pelagic Marine | MINFIKKVLGISDLEYKIRLLERKNYWREKYRHG* |
| Ga0114932_101664963 | 3300009481 | Deep Subsurface | MINFIKKILGIDNLEYKIRLLERKNYWREKYKHG* |
| Ga0114932_103797371 | 3300009481 | Deep Subsurface | MIAFIKKILGIDNLEYKIRLLERKNYWREKYGTSKKST* |
| Ga0114932_107472363 | 3300009481 | Deep Subsurface | MIIFIKKILGIDDLERRTRLLERKNYWKEKYKHG* |
| Ga0114932_108962133 | 3300009481 | Deep Subsurface | MIAFIKKVLGISDLEYKIRLLERKNYWREKYKHG* |
| Ga0114925_110355743 | 3300009488 | Deep Subsurface | MINFIKKILGICDLEYKVRLLQRAKYWREKYGKKTQ* |
| Ga0114933_105934543 | 3300009703 | Deep Subsurface | MLNFNKKILGINTLEYKNRLLKRKNYWKEKYKHGKDKR* |
| Ga0098043_10968172 | 3300010148 | Marine | MEMLDWFKKILGIDKLEYKIRLLERKNYWREKYRGR* |
| Ga0098049_11675821 | 3300010149 | Marine | QVMINFIKKILGITDLEYQLRLIQRKNYWRGKYKK* |
| Ga0098059_12231071 | 3300010153 | Marine | MLINFFKKLFGYDRLDKRIRLLERKNYWREKYKHGIS |
| Ga0151671_10058272 | 3300011253 | Marine | MIAYIKKVLGISDLEYKLRLLERKNYRREKYKHG* |
| Ga0160423_1000496415 | 3300012920 | Surface Seawater | MEMLNLFKKLLGIDKLEYKIRLLERKNYWREKYNVRQNNL* |
| Ga0160423_100408767 | 3300012920 | Surface Seawater | MIYLIKKLFGIDKLEKRIRLLERKNYWRDKYKNGIS* |
| Ga0160423_101571155 | 3300012920 | Surface Seawater | MITFIKKLLGISDLEYKVRLLQRQNYWKNKYVKRS* |
| Ga0160423_103583003 | 3300012920 | Surface Seawater | MINFIKKILGISDLEYKVRLLQRQNYWRDKYRVRT* |
| Ga0160423_105665003 | 3300012920 | Surface Seawater | MINFLKKILGIDTLEYRIRILERKNYWKYKYKHAEDHYS* |
| Ga0160423_107512101 | 3300012920 | Surface Seawater | MEMLNWLKKILGIQNLEYKIRLLERKNYWREKYKHGLS |
| Ga0160423_109341873 | 3300012920 | Surface Seawater | MIAFIKRILGISDLEYKVRLLQRQNYWRGKYKVRT* |
| Ga0163180_101845773 | 3300012952 | Seawater | MLIFIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN* |
| Ga0163180_104790864 | 3300012952 | Seawater | MIAFIKKILGISDLEYKVRLLQRQNYWKGKYKVRT* |
| Ga0181369_10242545 | 3300017708 | Marine | MEMLNLFKKLLGIDKLEYKIRLLERKNYWREKYNVRQNNL |
| Ga0181369_10365233 | 3300017708 | Marine | MINFIKKILGITNIEYQIRLLQRQSYWRGKYKKXKKQEQK |
| Ga0181369_11199082 | 3300017708 | Marine | MLNFIKKILGIDNLEYKIRLLERKNYWREKYKXKKQKLK |
| Ga0181390_11048091 | 3300017719 | Seawater | MIAFIKKILGIDAIEYKIRLLERKNYWREKYGTSKKST |
| Ga0181373_10321714 | 3300017721 | Marine | NLFKKLLGIDKLEYKIRLLERKNYWREKYNVRQNNL |
| Ga0181373_10511743 | 3300017721 | Marine | MLDFIKKILGISNLEYKIRLLERKNYWREKYNGSKGINN |
| Ga0181388_101250911 | 3300017724 | Seawater | WWVQIVINFIKKVLGISDLEYKIRLLERKNYWREKYKHG |
| Ga0181416_10520575 | 3300017731 | Seawater | FIKKILGIDVIEYNIRLLQRKNYWKEKYGTNKKST |
| Ga0181415_10124617 | 3300017732 | Seawater | MEMLNYLKKILGIDKLEYKIRLLERKNYWREKYKHG |
| Ga0181415_10553575 | 3300017732 | Seawater | LYIMINFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0181428_10788634 | 3300017738 | Seawater | MLSFIKKILGIDNLEYKIRLLERKNYWREKYKXKKQKVK |
| Ga0181427_10177869 | 3300017745 | Seawater | QVMLSFIKKILGINNLEYKIRLLERKNYWREKYKHG |
| Ga0181407_10662823 | 3300017753 | Seawater | MVAFIKKILGISDLEYKVRLLQRQNYWRGKYKVRTXKKQKQKLKK |
| Ga0181414_10637091 | 3300017759 | Seawater | MLSFIKKILGINNLEYKIRLLERKNYWREKYKXKKQK |
| Ga0181408_10684364 | 3300017760 | Seawater | FIKKILGIDNLEYKIRLLERKNYWREKYGTSKKST |
| Ga0181410_11556191 | 3300017763 | Seawater | KSWRWIQVMVAFIKKILGISDLEYKVRLLQRQNYWRGKYKVRT |
| Ga0181385_11021263 | 3300017764 | Seawater | MIAFIKKILGINAIEYKIRLLQRKNYWKEKYGTRKKST |
| Ga0181386_10845672 | 3300017773 | Seawater | VIIFIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN |
| Ga0181395_10654711 | 3300017779 | Seawater | KMINFLKKLLGITELEYKVRLLQRQNYWRDKYKHAR |
| Ga0181424_103039194 | 3300017786 | Seawater | LQVMLNFIKKLLGINTLEYKIRLLERKNYWKEKYRHG |
| Ga0181577_100807965 | 3300017951 | Salt Marsh | MEMLELFKKLLGIDKLEYKIRLLERKNYWREKYRDRQNSL |
| Ga0181553_100990531 | 3300018416 | Salt Marsh | MLELFKKLLGIDKLEYKIRLLERKNYWREKYRDRQNSL |
| Ga0193204_10135203 | 3300018618 | Marine | MISFIKKILGIDNLEYKIRLLERKNYWREKYNGSKSINN |
| Ga0211658_10710293 | 3300020274 | Marine | MLNFIKKILGITNLEYQMRLIQRQNYWRGKYKKXKKQKQK |
| Ga0211483_101638052 | 3300020281 | Marine | MIAFIKKLLGIDTIEYNIRLLQRKNYWRDKYRHGKEN |
| Ga0211522_10421773 | 3300020314 | Marine | MINFIKKILGISDLEYKVRLLQRQNYWRDKYKVXKKQKQK |
| Ga0211506_10445094 | 3300020365 | Marine | MIAFIKKILGISDLEYKVRLLQRQNYWRGKYKVRT |
| Ga0211703_101954941 | 3300020367 | Marine | LKFIRKILGIDNLEYKIRLLERKNYWREKYNGSKSINN |
| Ga0211477_100301003 | 3300020374 | Marine | MINFLKKLLGITELEYKVRLLQRQNYWRDKYKHAR |
| Ga0211477_100993654 | 3300020374 | Marine | MITFIKKILGIDVIEYNIRLLQRKNYWKEKYGTSKKST |
| Ga0211498_100292681 | 3300020380 | Marine | MINFIKKILGIDTLEYEIRLLKRKNYWREKYKRXTYK |
| Ga0211678_100499094 | 3300020388 | Marine | MINFLKKILGITDLEYKVRLIQRQNYWRDKYKHAR |
| Ga0211668_100124203 | 3300020406 | Marine | MIKLIKKILGIDNLEYKIRLLERKNYWREKYKEKK |
| Ga0211651_103912713 | 3300020408 | Marine | MINFLKKLLGITELEYKVRLLQRQNYWRDKYKVXKKQKQK |
| Ga0211699_100702542 | 3300020410 | Marine | MINFIKKILGISDLEYKVRLLQRQNYWRDKYKVXKKQKLR |
| Ga0211699_100727523 | 3300020410 | Marine | MITFIKKILGIDNLEYKIRLLERKNYWRDKYKVWLRK |
| Ga0211523_102924313 | 3300020414 | Marine | MINFIKKILGISDLEYKVRLLQRQNYWRDKYKVXKRQKQK |
| Ga0211644_104564123 | 3300020416 | Marine | MLNFIKKILGITDLEYQLRLIQRKNYWRDKYKKXKKQKQK |
| Ga0211622_102707332 | 3300020430 | Marine | MINLIKKILGMLDLETRVRLLERKNYWKEKYKHEK |
| Ga0211708_100597044 | 3300020436 | Marine | MISLIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN |
| Ga0211708_102664962 | 3300020436 | Marine | MITFIKKILGIDVIEYNIRLLQRKNYWKEKYGISKKST |
| Ga0211708_103522023 | 3300020436 | Marine | MISFIKKILGINNLEYKIRLLERKNYWREKYNGSKSIN |
| Ga0211708_103702423 | 3300020436 | Marine | MITFIKKILGINNLEYKIRLLERKNYWRDKYKTWLRK |
| Ga0211558_100405548 | 3300020439 | Marine | MLAFIKKILGIDKLEYQVRQLQRKNYWREKYNGSKSRNY |
| Ga0211638_104814862 | 3300020448 | Marine | MLIFIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN |
| Ga0211664_100395123 | 3300020455 | Marine | MINFIKKILGIDNLEYKIRLLERKNYWREKYGTIKKST |
| Ga0211551_104152592 | 3300020456 | Marine | MINFIKKILGIDVIEYNIRLLQRKNYWKEKYGTNKKST |
| Ga0211535_100037744 | 3300020461 | Marine | MINFIKRILGIDTLEYEIRLLKRKNYWREKYKRXTYK |
| Ga0211546_101915731 | 3300020462 | Marine | RIQVMLNFIKKILGINTLEYKIRLLERKNYWREKYKHG |
| Ga0211546_102896343 | 3300020462 | Marine | MINFIKKILGINDLEYKVRLLQRKNYWRDKYKIXKKQKQK |
| Ga0211640_101262023 | 3300020465 | Marine | MIAFIKKILGIDNLEYKIRLLERKNYWREKYGTSKKST |
| Ga0211614_104702163 | 3300020471 | Marine | MINFLKKILGIETLEERVRRLERAKYWREKYKVRGGETANV |
| Ga0211579_101450944 | 3300020472 | Marine | MISFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKST |
| Ga0212030_10039141 | 3300022053 | Aqueous | FIKKVLGINNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0224906_100742210 | 3300022074 | Seawater | MIAFIKKILGISDLEYQVRLLQRKNYWKGKYKVRTXKKQKQK |
| Ga0224906_10116003 | 3300022074 | Seawater | MISLIKKILGINKLEYQVRQLQRKNYWREKYNGSKSRNY |
| Ga0224906_10877653 | 3300022074 | Seawater | MVAFIKKILGISDLEYKVRLLQRQNYWRGKYKVRT |
| Ga0224906_10899042 | 3300022074 | Seawater | MLSFIKKILGINNLEYKIRLLERKNYWREKYKXKKQKLK |
| Ga0196887_10088255 | 3300022178 | Aqueous | MINFIKKVLGINNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0209992_1002694612 | 3300024344 | Deep Subsurface | MLSFIKKILGIDNLEYKIRLLERKNYWREKYKXKKQKLK |
| Ga0209992_100409649 | 3300024344 | Deep Subsurface | AFIKKILGIDNLEYKIRLLERKNYWREKYGTSKKST |
| Ga0209986_100130103 | 3300024433 | Deep Subsurface | MLNLFKKLLGIDKLEYKIRLLERKNYWREKYNVRQNNL |
| Ga0208298_10778613 | 3300025084 | Marine | MINFIKKILGITDLEYQLRLIHRKNYWRGKYKKXKKQKQK |
| Ga0208157_10145616 | 3300025086 | Marine | MINFIKKVLGIDNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0208157_10541153 | 3300025086 | Marine | MLNFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0208157_11402233 | 3300025086 | Marine | MISFIKKILGITNLEYQIRLIQRQNYWRGKYKKXKKQKQK |
| Ga0208669_10329494 | 3300025099 | Marine | MINFIKKILGITDLEYQLRLIHRKNYWRGKYKKXKKQ |
| Ga0208669_10972713 | 3300025099 | Marine | MINFIKKILGITDLEYQLRLIQRKNYWRDKYKKXKNQK |
| Ga0208666_10540143 | 3300025102 | Marine | MIAFIKKILGISDLEYQVRLLQRQNYWKGKYKVRT |
| Ga0208666_11401873 | 3300025102 | Marine | WWLQVMINFIKKILGITDLEYQLRLIQRKNYWRGKYKK |
| Ga0208013_10336763 | 3300025103 | Marine | MINFIKKILGITDLEYQLRLIQRKNYWRDKYKKXKKQKQK |
| Ga0208158_10887223 | 3300025110 | Marine | MLNFIKKILGINNLEYKIRLLERKNYWREKYNGSKGINN |
| Ga0209348_100007073 | 3300025127 | Marine | MLKEFIKKLLGIDKLEFKIRLLERKNYWREKYGVKDIRRS |
| Ga0209348_10002292 | 3300025127 | Marine | MISFIKKILGISDLEYKVRLLQRQNYWRDKYKVRIXKKQKQK |
| Ga0209348_100151323 | 3300025127 | Marine | IMISLIKKLLGISDLEYKVRLLERKNYWREKYKHG |
| Ga0209348_100470718 | 3300025127 | Marine | MLVFIKKLLGIDDLERRTRLLERKNYWKEKYKHGQEN |
| Ga0209348_100632210 | 3300025127 | Marine | MISFIKKLLGISDLELRIRLMERKNYWRDKYKVWLRK |
| Ga0209348_101562411 | 3300025127 | Marine | MISLIKKILGISDLEYQVRLLQRQNYWRGKYKVRT |
| Ga0209348_10243413 | 3300025127 | Marine | MITIIKKILGIDTLEYKIRLLERKNYWKEKYKNEK |
| Ga0209348_10324424 | 3300025127 | Marine | MLKFIRKILGIDNLEYKIRLLERKNYWREKYNGSKSINN |
| Ga0209348_10414656 | 3300025127 | Marine | MINFIKKILGISDLEYKVRLLQRAKYWKEKYEKSKS |
| Ga0209348_10852572 | 3300025127 | Marine | MIAFIKKILGISDLEYQVRLLQRKNYWKGKYKVRT |
| Ga0209348_10872364 | 3300025127 | Marine | MLSFIKKILGINNLEYKIRLLERKNYWREKYKXKKQKPK |
| Ga0209348_11151582 | 3300025127 | Marine | MIAFIKKLLGISDLEYKVRLLQRQNYWRNKYAKRS |
| Ga0209232_10970925 | 3300025132 | Marine | MEMLVNFFKKIFGIESLEKRIRFLERKNYWREKYNEKK |
| Ga0209232_11819093 | 3300025132 | Marine | MLNFIKKILGINNLEYKIRLLERKNYWREKYKXKKQKLK |
| Ga0209634_10585885 | 3300025138 | Marine | MINFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0209645_10138573 | 3300025151 | Marine | MIEFIKKLLGISDLEYKVRLLQRQKYWREKYKVRT |
| Ga0209645_11024581 | 3300025151 | Marine | MLNWFKKLLGIDKLEYKIRLLERKEYWRTKYKHGIPQ |
| Ga0209645_11934091 | 3300025151 | Marine | MISFIKKILGITNIEYQIRLLQRQNYWRGKYKKXKKQEQK |
| Ga0209645_12356432 | 3300025151 | Marine | MITFIKNILGISDLEYKVRLLQRQKYWREKYKVRAXKNQKQK |
| Ga0209645_12471223 | 3300025151 | Marine | MISFIKKILGISDLEYKVRLLQRQNYWKNKYKVRT |
| Ga0208182_10649143 | 3300025251 | Deep Ocean | MIDFIKKVLGISDLEYKIRLLERKNYWREKYGISKKSKIA |
| Ga0208813_10506923 | 3300025270 | Deep Ocean | MINFIKKVLGISDLEYKIRLLERKNYWREKYGISK |
| Ga0208899_10825023 | 3300025759 | Aqueous | MVAFIKKLLGISNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0208547_102669411 | 3300025828 | Aqueous | IVINFIKKVLGISDLEYKIRLLERKNYWREKYRHG |
| Ga0209533_12379034 | 3300025874 | Pelagic Marine | WWIQIVINFIKKVLGISDLEYKIRLLERKNYWREKYRHG |
| Ga0209951_10637583 | 3300026138 | Pond Water | MLNWLKKLLGIDKLEYKIRLLERKNYWREKYKHGLSQF |
| Ga0209503_100428133 | 3300027859 | Marine | MLSFIKKILGIDNLEYKIRLLERKNYWREKYNEKSKS |
| Ga0209503_102362343 | 3300027859 | Marine | MVAFIKKILGISDLEYKVRLLQRQNYWRGKYKVRTXKKQKQK |
| Ga0256382_10649974 | 3300028022 | Seawater | MIAFIKKILGIDAIEYNIRLLQRKNYWKEKYGTRKKST |
| Ga0183683_100178313 | 3300029309 | Marine | MLNFIKKILGIDNLEYKIRLLERKNYWREKYNGSKGINN |
| Ga0183683_10379452 | 3300029309 | Marine | MVNFIKKILGITDLEYQIRLIQRKNYWRGKYKKXKKQKQK |
| Ga0183748_100096615 | 3300029319 | Marine | MVNFIKKILGISDLEYQVRLLQRQNYWRGKYKVRT |
| Ga0183748_100157235 | 3300029319 | Marine | MISFIKKILGINNLEYKIRLLERKNYWQEKYNGSKSINN |
| Ga0183748_10028627 | 3300029319 | Marine | MIEFIKKLLGIDNLEYKIRLLERKNYWRDKYKTWLRK |
| Ga0183748_101191710 | 3300029319 | Marine | MLKNFFKKILGIDKLEYKIRLLERKNYWKEKYHGSKSINDKR |
| Ga0183748_10155243 | 3300029319 | Marine | MINFIKKILGINDLEYKVRLLQRAQYWREKYDKKKKSY |
| Ga0183748_10241948 | 3300029319 | Marine | MLAFIKKILGIDRLEYQVRQLQRKNYWREKYNGSKSRNY |
| Ga0183748_11297322 | 3300029319 | Marine | MLELLKKLLGIDKLEYKIRLLERKNYWREKYRVRQNNL |
| Ga0183755_10049814 | 3300029448 | Marine | MITFIKKILGIDNLEYKIRLLERKNYWRDKYKTWLRK |
| Ga0183755_10769342 | 3300029448 | Marine | MLNFIKRILGIDNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0183757_10029242 | 3300029787 | Marine | MLSFIKKILGIDNLEYKIRLLERKNYWREKYGTRKKSA |
| Ga0183757_10037593 | 3300029787 | Marine | MLNFIKRILGIDNLEYKIRLLERKNYWREKYKEKSKS |
| Ga0183757_10065634 | 3300029787 | Marine | MIALIKKILGINKLEYQVRQLQRKNYWREKYNGSKSRNY |
| Ga0183757_10298943 | 3300029787 | Marine | MIAFIKKILGISDLEYKVRLLQRQNYWKGKYKVRT |
| Ga0183757_10365113 | 3300029787 | Marine | MITIIKKILGIDTLEYKIRLLERKNYWKEKYGTSKKST |
| Ga0183757_10488363 | 3300029787 | Marine | MIIFIKKILGIDDLERRTRLLERKNYWKEKYKNEK |
| Ga0183757_10601002 | 3300029787 | Marine | MIAFIKKILGIDAIEYKIRLLQRKNYWKEKYGTRKKST |
| Ga0315331_111033374 | 3300031774 | Seawater | IVINFIKKVLGISDLEYKIRLLERKNYWREKYKHG |
| Ga0316207_102912731 | 3300032212 | Microbial Mat | MLINFLKKLFGYDTLDKRIRVLERKNYWREKYNHG |
| Ga0314858_078490_1_105 | 3300033742 | Sea-Ice Brine | MEMLKLIKKLLGFEALEKRVRILERKNYWREKYKT |
| ⦗Top⦘ |