


| Basic Information | |
|---|---|
| Family ID | F025677 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.50 % |
| % of genes near scaffold ends (potentially truncated) | 25.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.50 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 18.00 |
| PF12697 | Abhydrolase_6 | 9.50 |
| PF01042 | Ribonuc_L-PSP | 8.50 |
| PF09656 | PGPGW | 5.00 |
| PF01738 | DLH | 4.50 |
| PF13561 | adh_short_C2 | 4.00 |
| PF07969 | Amidohydro_3 | 3.00 |
| PF07883 | Cupin_2 | 2.50 |
| PF04392 | ABC_sub_bind | 2.00 |
| PF08240 | ADH_N | 2.00 |
| PF08530 | PepX_C | 2.00 |
| PF00107 | ADH_zinc_N | 1.50 |
| PF00296 | Bac_luciferase | 1.50 |
| PF00753 | Lactamase_B | 1.50 |
| PF00106 | adh_short | 1.00 |
| PF04536 | TPM_phosphatase | 1.00 |
| PF13602 | ADH_zinc_N_2 | 1.00 |
| PF00676 | E1_dh | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF00005 | ABC_tran | 1.00 |
| PF00528 | BPD_transp_1 | 1.00 |
| PF04909 | Amidohydro_2 | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF02627 | CMD | 0.50 |
| PF13379 | NMT1_2 | 0.50 |
| PF08281 | Sigma70_r4_2 | 0.50 |
| PF05598 | DUF772 | 0.50 |
| PF02504 | FA_synthesis | 0.50 |
| PF01494 | FAD_binding_3 | 0.50 |
| PF01909 | NTP_transf_2 | 0.50 |
| PF12146 | Hydrolase_4 | 0.50 |
| PF02322 | Cyt_bd_oxida_II | 0.50 |
| PF07478 | Dala_Dala_lig_C | 0.50 |
| PF14534 | DUF4440 | 0.50 |
| PF00462 | Glutaredoxin | 0.50 |
| PF02738 | MoCoBD_1 | 0.50 |
| PF00254 | FKBP_C | 0.50 |
| PF14026 | DUF4242 | 0.50 |
| PF02515 | CoA_transf_3 | 0.50 |
| PF02514 | CobN-Mg_chel | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 8.50 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 2.00 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.50 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 1.00 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.00 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 1.00 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.50 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.50 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.50 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.50 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.50 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.50 |
| COG1429 | Cobalamin biosynthesis protein CobN, Mg-chelatase | Coenzyme transport and metabolism [H] | 0.50 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.50 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.00 % |
| Unclassified | root | N/A | 7.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5OHE3B02FTALC | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2410521 | Not Available | 529 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10099376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300003324|soilH2_10278300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1325 | Open in IMG/M |
| 3300004114|Ga0062593_102076633 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300004267|Ga0066396_10010410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300004267|Ga0066396_10037880 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300004267|Ga0066396_10048334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
| 3300004281|Ga0066397_10027391 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300005093|Ga0062594_100161423 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300005167|Ga0066672_10007130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5100 | Open in IMG/M |
| 3300005167|Ga0066672_10724878 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005172|Ga0066683_10189132 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300005172|Ga0066683_10243107 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005294|Ga0065705_10512446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 761 | Open in IMG/M |
| 3300005328|Ga0070676_10910482 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005332|Ga0066388_106355965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300005334|Ga0068869_100343327 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300005340|Ga0070689_101289220 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005345|Ga0070692_10110007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1522 | Open in IMG/M |
| 3300005444|Ga0070694_100019610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4303 | Open in IMG/M |
| 3300005445|Ga0070708_100830442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 868 | Open in IMG/M |
| 3300005445|Ga0070708_101715391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300005471|Ga0070698_100268714 | Not Available | 1637 | Open in IMG/M |
| 3300005471|Ga0070698_100695747 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005471|Ga0070698_101733875 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005518|Ga0070699_100042136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3950 | Open in IMG/M |
| 3300005518|Ga0070699_100789087 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005577|Ga0068857_100369394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1331 | Open in IMG/M |
| 3300005843|Ga0068860_100277296 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300005983|Ga0081540_1030090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3013 | Open in IMG/M |
| 3300006046|Ga0066652_100591357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
| 3300006049|Ga0075417_10011120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3343 | Open in IMG/M |
| 3300006058|Ga0075432_10037063 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300006844|Ga0075428_100185160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2253 | Open in IMG/M |
| 3300006845|Ga0075421_100069987 | All Organisms → cellular organisms → Bacteria | 4429 | Open in IMG/M |
| 3300006845|Ga0075421_100853339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300006845|Ga0075421_102189982 | Not Available | 584 | Open in IMG/M |
| 3300006847|Ga0075431_100256748 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300006847|Ga0075431_102064262 | Not Available | 525 | Open in IMG/M |
| 3300006847|Ga0075431_102129090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300006852|Ga0075433_10069865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3085 | Open in IMG/M |
| 3300006969|Ga0075419_11269248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300007255|Ga0099791_10278315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
| 3300007255|Ga0099791_10355094 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300009012|Ga0066710_100004798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12097 | Open in IMG/M |
| 3300009012|Ga0066710_104106896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300009053|Ga0105095_10170696 | Not Available | 1190 | Open in IMG/M |
| 3300009094|Ga0111539_11842881 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
| 3300009100|Ga0075418_10287465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1752 | Open in IMG/M |
| 3300009147|Ga0114129_10774588 | Not Available | 1226 | Open in IMG/M |
| 3300009147|Ga0114129_10800097 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300009147|Ga0114129_12983550 | Not Available | 557 | Open in IMG/M |
| 3300009148|Ga0105243_10019874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5094 | Open in IMG/M |
| 3300009148|Ga0105243_10031171 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4109 | Open in IMG/M |
| 3300009162|Ga0075423_11916421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300009553|Ga0105249_10899783 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300009610|Ga0105340_1306220 | Not Available | 694 | Open in IMG/M |
| 3300009792|Ga0126374_10819693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 713 | Open in IMG/M |
| 3300009795|Ga0105059_1041101 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 587 | Open in IMG/M |
| 3300009802|Ga0105073_1017887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300009803|Ga0105065_1003252 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300009806|Ga0105081_1015068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
| 3300009808|Ga0105071_1007700 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300009808|Ga0105071_1032374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
| 3300009813|Ga0105057_1045328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 712 | Open in IMG/M |
| 3300009817|Ga0105062_1016544 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300009819|Ga0105087_1083134 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009819|Ga0105087_1118040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300009836|Ga0105068_1126615 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300009837|Ga0105058_1012246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1713 | Open in IMG/M |
| 3300010029|Ga0105074_1076091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300010043|Ga0126380_10539139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 905 | Open in IMG/M |
| 3300010047|Ga0126382_10642199 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010047|Ga0126382_11862223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300010303|Ga0134082_10375164 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010335|Ga0134063_10071941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1539 | Open in IMG/M |
| 3300010336|Ga0134071_10136684 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300010362|Ga0126377_10069981 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
| 3300010362|Ga0126377_10330304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1514 | Open in IMG/M |
| 3300010366|Ga0126379_10359841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1489 | Open in IMG/M |
| 3300010399|Ga0134127_10169355 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300010399|Ga0134127_11285900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300011429|Ga0137455_1074250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 979 | Open in IMG/M |
| 3300011429|Ga0137455_1233716 | Not Available | 544 | Open in IMG/M |
| 3300011441|Ga0137452_1326506 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012096|Ga0137389_10058239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2945 | Open in IMG/M |
| 3300012174|Ga0137338_1064468 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012199|Ga0137383_11316423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300012200|Ga0137382_10227562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300012202|Ga0137363_10967608 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012202|Ga0137363_11023447 | Not Available | 702 | Open in IMG/M |
| 3300012203|Ga0137399_10158265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1815 | Open in IMG/M |
| 3300012203|Ga0137399_11242946 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012204|Ga0137374_10032930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5630 | Open in IMG/M |
| 3300012204|Ga0137374_10681325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 774 | Open in IMG/M |
| 3300012205|Ga0137362_10997051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 713 | Open in IMG/M |
| 3300012207|Ga0137381_10415998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300012207|Ga0137381_10683872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 892 | Open in IMG/M |
| 3300012211|Ga0137377_10056428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3643 | Open in IMG/M |
| 3300012355|Ga0137369_10041706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4098 | Open in IMG/M |
| 3300012355|Ga0137369_10465443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 899 | Open in IMG/M |
| 3300012355|Ga0137369_10594683 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012360|Ga0137375_10149266 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300012362|Ga0137361_10836745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
| 3300012582|Ga0137358_10179319 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300012685|Ga0137397_10342399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1114 | Open in IMG/M |
| 3300012685|Ga0137397_10724932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300012918|Ga0137396_10004417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8046 | Open in IMG/M |
| 3300012922|Ga0137394_10503703 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300012922|Ga0137394_10795680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300012929|Ga0137404_10025691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4307 | Open in IMG/M |
| 3300012929|Ga0137404_10086944 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2491 | Open in IMG/M |
| 3300012930|Ga0137407_10157290 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2013 | Open in IMG/M |
| 3300012948|Ga0126375_10240574 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300013297|Ga0157378_10927621 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300013306|Ga0163162_12323791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
| 3300014873|Ga0180066_1049780 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300014877|Ga0180074_1061374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300014883|Ga0180086_1005080 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300014883|Ga0180086_1017434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1581 | Open in IMG/M |
| 3300015241|Ga0137418_10482241 | Not Available | 995 | Open in IMG/M |
| 3300015358|Ga0134089_10207771 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300017997|Ga0184610_1021062 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1756 | Open in IMG/M |
| 3300017997|Ga0184610_1133891 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 806 | Open in IMG/M |
| 3300018028|Ga0184608_10004450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4448 | Open in IMG/M |
| 3300018028|Ga0184608_10020098 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300018031|Ga0184634_10116640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1178 | Open in IMG/M |
| 3300018052|Ga0184638_1103018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1046 | Open in IMG/M |
| 3300018063|Ga0184637_10017805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4268 | Open in IMG/M |
| 3300018074|Ga0184640_10145906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1053 | Open in IMG/M |
| 3300018079|Ga0184627_10301745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 840 | Open in IMG/M |
| 3300018431|Ga0066655_10130916 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300018468|Ga0066662_12854822 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300018482|Ga0066669_10647136 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300019789|Ga0137408_1096334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
| 3300020004|Ga0193755_1044224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1460 | Open in IMG/M |
| 3300020004|Ga0193755_1115310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300020004|Ga0193755_1181044 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021344|Ga0193719_10110031 | Not Available | 1198 | Open in IMG/M |
| 3300022694|Ga0222623_10362170 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300025885|Ga0207653_10288331 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300025910|Ga0207684_10353317 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300025925|Ga0207650_11415554 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025961|Ga0207712_11387355 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300025972|Ga0207668_10380502 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300026089|Ga0207648_10357467 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300026285|Ga0209438_1121666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 728 | Open in IMG/M |
| 3300026285|Ga0209438_1145903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300026298|Ga0209236_1113787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
| 3300026320|Ga0209131_1292026 | Not Available | 612 | Open in IMG/M |
| 3300026324|Ga0209470_1041521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2271 | Open in IMG/M |
| 3300026325|Ga0209152_10035038 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300026327|Ga0209266_1179390 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 804 | Open in IMG/M |
| 3300026523|Ga0209808_1050091 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300026548|Ga0209161_10560367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300027032|Ga0209877_1025451 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 581 | Open in IMG/M |
| 3300027324|Ga0209845_1014613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1306 | Open in IMG/M |
| 3300027384|Ga0209854_1064757 | Not Available | 639 | Open in IMG/M |
| 3300027490|Ga0209899_1006197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2744 | Open in IMG/M |
| 3300027511|Ga0209843_1004821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3138 | Open in IMG/M |
| 3300027527|Ga0209684_1017192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300027577|Ga0209874_1049548 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300027577|Ga0209874_1144328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300027646|Ga0209466_1008523 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300027748|Ga0209689_1180966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 954 | Open in IMG/M |
| 3300027873|Ga0209814_10001395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8498 | Open in IMG/M |
| 3300027873|Ga0209814_10006923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4380 | Open in IMG/M |
| 3300027903|Ga0209488_10072838 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300027907|Ga0207428_10000306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 65012 | Open in IMG/M |
| 3300027909|Ga0209382_10666857 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300027909|Ga0209382_11413585 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027952|Ga0209889_1002613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5128 | Open in IMG/M |
| 3300028536|Ga0137415_10059500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3687 | Open in IMG/M |
| 3300028812|Ga0247825_11301784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1048507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10130567 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031421|Ga0308194_10131799 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031720|Ga0307469_10070640 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
| 3300031720|Ga0307469_10909681 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300031720|Ga0307469_11101716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 746 | Open in IMG/M |
| 3300031720|Ga0307469_11424587 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031720|Ga0307469_11722830 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031740|Ga0307468_100009250 | All Organisms → cellular organisms → Bacteria | 3742 | Open in IMG/M |
| 3300031740|Ga0307468_101092973 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 710 | Open in IMG/M |
| 3300031740|Ga0307468_101407897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
| 3300031740|Ga0307468_101731325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300031740|Ga0307468_102381052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300031820|Ga0307473_11497663 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031854|Ga0310904_10133155 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300031913|Ga0310891_10041013 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300032180|Ga0307471_100116841 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300032180|Ga0307471_100312370 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300032180|Ga0307471_100372103 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300032180|Ga0307471_101305797 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300032180|Ga0307471_102010726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 725 | Open in IMG/M |
| 3300032180|Ga0307471_102358562 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300032180|Ga0307471_102633231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300032180|Ga0307471_102809140 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032205|Ga0307472_100538448 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 10.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_08075390 | 2067725004 | Soil | MGIGRASKVVAGIVFILAALGVGSPVPLVPIGLAVWVPGEAL |
| ICChiseqgaiiDRAFT_24105211 | 3300000033 | Soil | MSIGRVTKIVAGVLFILAVVGVSSPVLLVPLGLAVWVLGEAA* |
| JGIcombinedJ43975_100993761 | 3300002899 | Soil | MGIGRATKIAAGIIFVVATLGVATPVLLVPLGLAVWVLGEAL* |
| soilH2_102783002 | 3300003324 | Sugarcane Root And Bulk Soil | MGIGRLSKFAAGIIFIMAALGVAAPVPLVPIGLAVWVLGEAV* |
| Ga0062593_1020766332 | 3300004114 | Soil | MGIGRATKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEVL* |
| Ga0066396_100104102 | 3300004267 | Tropical Forest Soil | MPIGRVTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVFGEVL* |
| Ga0066396_100378803 | 3300004267 | Tropical Forest Soil | MGIGRTSKIIAAIIFIVAAVGVAAPVPLVPLGLAVWVIGEVL* |
| Ga0066396_100483342 | 3300004267 | Tropical Forest Soil | MPIGRMTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVFGEVL* |
| Ga0066397_100273911 | 3300004281 | Tropical Forest Soil | MGIGRTSKIIAAIIFIVAAVGIAAPVPLVPLGLAVWVIGEVL* |
| Ga0062594_1001614232 | 3300005093 | Soil | MGIGRASKIVAGIVFILASLGMTAPVPLVPIGLAIWVLGEAL* |
| Ga0066672_100071303 | 3300005167 | Soil | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL* |
| Ga0066672_107248781 | 3300005167 | Soil | MPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWVFGEVLRA* |
| Ga0066683_101891322 | 3300005172 | Soil | MHIGRASKIAAGILFILAALGVSVPVLLVPLGLAVWVLGEAL* |
| Ga0066683_102431071 | 3300005172 | Soil | MGIGRASKIAAGIVFILASLGVAAPVPLVPIGLAVWVLGEAL* |
| Ga0065705_105124462 | 3300005294 | Switchgrass Rhizosphere | MSVGRITKIVAGILFLLAVIGVSSPVLLVPLGLAAWVLGEAA* |
| Ga0070676_109104823 | 3300005328 | Miscanthus Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGEGV* |
| Ga0066388_1063559652 | 3300005332 | Tropical Forest Soil | MPIGRVTKIAAGIIFVVAALGVAAPVPLVPLGLAVWVFGEVL* |
| Ga0068869_1003433272 | 3300005334 | Miscanthus Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGEAV* |
| Ga0070689_1012892203 | 3300005340 | Switchgrass Rhizosphere | IGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGEAV* |
| Ga0070692_101100072 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLMPLGLAVWVLGEAV* |
| Ga0070694_1000196102 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIGRATKIAAGILFLLAVVGVNSPVLLVPLGLAVWVLGEAA* |
| Ga0070708_1008304422 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIGRASKIAAGIIFVVAALGVATPILLVPLGLAVWVLGEAL* |
| Ga0070708_1017153911 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIGRATKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGE |
| Ga0070698_1002687142 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIGRASKLVAGILFIVAALGVGSPVPLVPIGLAVWVLGEAF* |
| Ga0070698_1006957471 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL* |
| Ga0070698_1017338752 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PEDFLMSIGRATKIAAGILFLLAVVGVTSPVLLVPLGLAVWVLGEAA* |
| Ga0070699_1000421362 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIGRASKIAAGIVFILASLGVAAPVLLVPIGLAVWVLGEAL* |
| Ga0070699_1007890872 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLNRASKIAAGIIFILAALGVAAPVALVPIGLAVWVLGEAV* |
| Ga0068857_1003693941 | 3300005577 | Corn Rhizosphere | REDLLMSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGEAV* |
| Ga0068860_1002772963 | 3300005843 | Switchgrass Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGGAV* |
| Ga0081540_10300903 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGIGRATKIAAGIIFVVAALGAATPVLLVPLGLAVWVLGEAV* |
| Ga0066652_1005913572 | 3300006046 | Soil | MPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWVFGEAL* |
| Ga0075417_100111204 | 3300006049 | Populus Rhizosphere | MGIGRGTKIAAGIIFIVAALGVATPVLLVPLGLAVWVLGEAL* |
| Ga0075432_100370633 | 3300006058 | Populus Rhizosphere | MGIGRGTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVLGEAL* |
| Ga0075428_1001851603 | 3300006844 | Populus Rhizosphere | MGIGRASKIVAGILFIVAALGVAAPVALVPIGLAVWVLGEAL* |
| Ga0075421_1000699873 | 3300006845 | Populus Rhizosphere | MGIGRASKIVAGIVFILAALGVGSPVPLVPIGLAVWVLGEAL* |
| Ga0075421_1008533392 | 3300006845 | Populus Rhizosphere | MGIGRATKIAAGIIFVVATLGVATPVPLVPLGLAVWVLGEAL* |
| Ga0075421_1021899823 | 3300006845 | Populus Rhizosphere | MGISRASKIVAGILFIVAALGVAAPVALVPIGLAVWVLGEAL* |
| Ga0075431_1002567481 | 3300006847 | Populus Rhizosphere | IVAGILFIVAALGVAAPVALVPIGLAVWVLGEAL* |
| Ga0075431_1020642622 | 3300006847 | Populus Rhizosphere | MGIGRASKVVAGIVFILAALGVGSPVPLVPIGLAVWVL |
| Ga0075431_1021290901 | 3300006847 | Populus Rhizosphere | IRRLSMGIGRATKIAAGIIFVVAALGAATPVLLVPLGLAVWVLGEAV* |
| Ga0075433_100698655 | 3300006852 | Populus Rhizosphere | MGIGRATKIAAGIIFVVAALGVATPVPLVPLGLAVWVFGEVL* |
| Ga0075419_112692481 | 3300006969 | Populus Rhizosphere | MGIGRATKIAAGIIFVVATLGVATPVPLVPLGLAVW |
| Ga0099791_102783151 | 3300007255 | Vadose Zone Soil | MGIGRASKIAAGIVFILASLGVATPVLLVPIGLAVWVLGEAL* |
| Ga0099791_103550942 | 3300007255 | Vadose Zone Soil | MPIGRVTKIAAGIIFLVAALGVASPVLLVPLGLAVWVFGEVL* |
| Ga0066710_1000047988 | 3300009012 | Grasslands Soil | MHIGRASKIAAGILFILAALGVSVPVLLVPLGLAVWVLGEAL |
| Ga0066710_1041068962 | 3300009012 | Grasslands Soil | MGIGRASKIAAGIVFVLASLGVATPVLLVPIGLAVWVLGEAL |
| Ga0105095_101706963 | 3300009053 | Freshwater Sediment | MSIGRITKIAAGILFILAAVGVNSPVLLVPLGLAVWVLGEAA* |
| Ga0111539_118428812 | 3300009094 | Populus Rhizosphere | MGIGRATKIAAGIFFVVAALGVATPVPLVPLGLAVWVFGEVL* |
| Ga0075418_102874654 | 3300009100 | Populus Rhizosphere | MGIGRGTKIAAGIILIVAALGVATPVLLVPLGLAVWVLGEAL* |
| Ga0114129_107745882 | 3300009147 | Populus Rhizosphere | MGIGRASKIVAGIIFIVAALGAASPVALVPIGLAVWVLGEAL* |
| Ga0114129_108000971 | 3300009147 | Populus Rhizosphere | IGRATKIAAGIIFVVATLGVATPVPLVPLGLAVWVLGEAL* |
| Ga0114129_129835501 | 3300009147 | Populus Rhizosphere | MGIGRASKVVAGIVFILSALGVGSPVPLVPIGLAVWVLGEAL* |
| Ga0105243_100198741 | 3300009148 | Miscanthus Rhizosphere | EDLLMSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGEAV* |
| Ga0105243_100311711 | 3300009148 | Miscanthus Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVW |
| Ga0075423_119164212 | 3300009162 | Populus Rhizosphere | MRRNHMGIGRASKIAAGIIFVVAALGVATPILLVPLGLAVWVLGEAL* |
| Ga0105249_108997832 | 3300009553 | Switchgrass Rhizosphere | MGIGRASKIAAGIVFIVAALGVAAPVLLVPIGLAIWVLGEAL* |
| Ga0105340_13062202 | 3300009610 | Soil | MGVGRATKIAAGILFILAALGVSVPVLLVPVGLAVWVLGEAL* |
| Ga0126374_108196931 | 3300009792 | Tropical Forest Soil | MPIGRMTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVFGEVL |
| Ga0105059_10411012 | 3300009795 | Groundwater Sand | MSIGRASKIAAGILFILAALGVSVPVLLVPVGLAVWVLGEAL* |
| Ga0105073_10178872 | 3300009802 | Groundwater Sand | MGIGRASKIAAGIVFILASLGVAAPVLLVPIGLAVWVLGESL* |
| Ga0105065_10032522 | 3300009803 | Groundwater Sand | MSIGRASKIAAGIVFILASLGVAAPVLLVPIGLAVWVLGEAL* |
| Ga0105081_10150682 | 3300009806 | Groundwater Sand | MGIGRASKIAAGIVFIMASLGVAAPVLLVPIGLAVWVLGEAL* |
| Ga0105071_10077003 | 3300009808 | Groundwater Sand | MSIGRGSKIAAGILFILAALGVSVPVLLVPVGLAVWVLGEAL* |
| Ga0105071_10323742 | 3300009808 | Groundwater Sand | MAIGRASKIVAGILFILAALGVSVPILLVPVGLAVWVL |
| Ga0105057_10453282 | 3300009813 | Groundwater Sand | MAIGRASKIVAGILFILAALGVSVPILLVPVGLAVWVLGEAL* |
| Ga0105062_10165442 | 3300009817 | Groundwater Sand | MRGWKDNRPKRRNSMSIGRASKIAAGVLFVLAALGVSVPVLLVPIGLAVWVLGEAV* |
| Ga0105087_10831343 | 3300009819 | Groundwater Sand | ASKIAAGILFILASLGIATPVLLVPIGLAVWVLGEAI* |
| Ga0105087_11180402 | 3300009819 | Groundwater Sand | IMPAWRRSTPVRRSPMSIGRASKIAAGILFILAALGVSVPVLLVPVGLAVWVLGEAL* |
| Ga0105068_11266152 | 3300009836 | Groundwater Sand | MSIGRASKIAAGIVFIMASLGVAAPVLLVPIGLAVWVLGEAL* |
| Ga0105058_10122461 | 3300009837 | Groundwater Sand | MAAYEENPMGIGRASKIAAGIVFILASLGVATPVLLVPIGLAVWVLGEAF* |
| Ga0105074_10760912 | 3300010029 | Groundwater Sand | MRRNPMIIGRASKIAAGVLFVLAALGVSVPVLLVPIGLAVWVLGEAV* |
| Ga0126380_105391392 | 3300010043 | Tropical Forest Soil | MVIGRVSKIAAGIVFILAALGVAAPVQLVPIGLAVWVLGEAL* |
| Ga0126382_106421992 | 3300010047 | Tropical Forest Soil | MIIGRVSKIAAGIVFILAALGVAAPIQLVPIGLAVWVLGEAL* |
| Ga0126382_118622231 | 3300010047 | Tropical Forest Soil | SPSLTRSMRRRRMGIGRTSKIIAAIIFIVAAVGVAAPVPLVPLGLAVWVIGEVL* |
| Ga0134082_103751642 | 3300010303 | Grasslands Soil | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWLLAEAL* |
| Ga0134063_100719413 | 3300010335 | Grasslands Soil | SKIAAGIIFVVAALGVATPILLVPLGLAVWVLGEAL* |
| Ga0134071_101366842 | 3300010336 | Grasslands Soil | MGIGRASKIAAGIIFVVAARGVATPILLVPLGLAVWVLGEAL* |
| Ga0126377_100699815 | 3300010362 | Tropical Forest Soil | MRRNEMPIGRLTKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEVL* |
| Ga0126377_103303043 | 3300010362 | Tropical Forest Soil | MPIGRLTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVFGEVL* |
| Ga0126379_103598411 | 3300010366 | Tropical Forest Soil | MRRRRMGIGRTSKIIAAIIFIVAAVGVAAPVPLVPLGLAVWVIGEVL* |
| Ga0134127_101693551 | 3300010399 | Terrestrial Soil | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAV |
| Ga0134127_112859002 | 3300010399 | Terrestrial Soil | GRASKIVAGIVFILASLGMTAPVPLVPIGLAIWVLGEAL* |
| Ga0137455_10742501 | 3300011429 | Soil | MSIGRITKIAAGILFILAVVGVNSPVLLVPLGLAVWVLGEA |
| Ga0137455_12337161 | 3300011429 | Soil | TEDLLMSIGRATKIAAGILFILAVVGVNSPVLLVPLGLAVWVLGEAA* |
| Ga0137452_13265062 | 3300011441 | Soil | GRITKIAAGILFILAVVGVNSPVLLVPLGLAVWVLGEAA* |
| Ga0137389_100582394 | 3300012096 | Vadose Zone Soil | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEAL* |
| Ga0137338_10644682 | 3300012174 | Soil | MGINRASKIAAGIIFILAALGVLTPIQLVPIGLAVWVLGEAL* |
| Ga0137383_113164232 | 3300012199 | Vadose Zone Soil | SPFSTEPMRRNRMVIGRASKIAAGIIFVVAALGVATPILLVPLGLAVWVLGEAL* |
| Ga0137382_102275622 | 3300012200 | Vadose Zone Soil | MGVGRATKIAAGIIFVVAALGTATPVLLVPLGLAVWVFGEAL* |
| Ga0137363_109676082 | 3300012202 | Vadose Zone Soil | MPIGRGTKIAAGIIFVVAALGVAVPILLVPLGLAVWVFGEVL* |
| Ga0137363_110234472 | 3300012202 | Vadose Zone Soil | MGIGRASKIIAGIVFILAALGVAAPAPLVPIGLAIWVLGEVL* |
| Ga0137399_101582653 | 3300012203 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAALGVATPVLLMPLGLAVWVLGEAL* |
| Ga0137399_112429462 | 3300012203 | Vadose Zone Soil | MPIGRGTKIAAGIIFVVAALGVAAPILLVPLGLAVWVFGEVL* |
| Ga0137374_100329306 | 3300012204 | Vadose Zone Soil | MGIGRASKIAAAIVFILASLGVAAPVLLVPIGLAVWVLGEAL* |
| Ga0137374_106813251 | 3300012204 | Vadose Zone Soil | MGIGRASKIVAGIVFILASLGVAAPVLLVPIGLAVWVLGEAL* |
| Ga0137362_109970512 | 3300012205 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAALGTATPVLLVPLGLAVWVFGEAL* |
| Ga0137381_104159981 | 3300012207 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAALGTATPVLLVPLGLAVWVF |
| Ga0137381_106838721 | 3300012207 | Vadose Zone Soil | ILLMRRTPMGIGRASKIAAGIVFILASLGVAAPVPLVPIGLAVWVLGEAL* |
| Ga0137377_100564287 | 3300012211 | Vadose Zone Soil | MRRNRMGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL* |
| Ga0137369_100417062 | 3300012355 | Vadose Zone Soil | MSIGRATKIAAGILFILAVVGVAAPVSLVPLGLAVWVLCEAA* |
| Ga0137369_104654432 | 3300012355 | Vadose Zone Soil | MGIGRASKIAAGIVFVLASLGVAAPVLLVPIGLAVWVLGEAF* |
| Ga0137369_105946832 | 3300012355 | Vadose Zone Soil | MGIARASKIAAGIVFILAALGVVAPAPLVPIGLAIWVLGEAL* |
| Ga0137375_101492661 | 3300012360 | Vadose Zone Soil | MSIGRATKIAAGILFILAVVGVAAPVSLVPLGLAVWVLGEAA* |
| Ga0137361_108367452 | 3300012362 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAALGTATPVLLVPLGLAVWVFGEVL* |
| Ga0137358_101793191 | 3300012582 | Vadose Zone Soil | MPIGRATKIAAGIIFVVAALGVAVPILLVPLGLAVWVFGEVL* |
| Ga0137397_103423992 | 3300012685 | Vadose Zone Soil | MPIGRMTKIAAGIIFVVAALGVASPVLLVPLVLAVWVFGEVL* |
| Ga0137397_107249322 | 3300012685 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAARGTATPVLLVPLGLAVGVFGEAL* |
| Ga0137396_100044172 | 3300012918 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEAL* |
| Ga0137394_105037032 | 3300012922 | Vadose Zone Soil | MGVGRASKIAAGIVFIVAALGVAAPVLLVPIGLAIWVLGEAL* |
| Ga0137394_107956802 | 3300012922 | Vadose Zone Soil | MGIGRATKIAAGVIFVVAALGVATPVLLVPLGLAVWVLGEAL* |
| Ga0137404_100256913 | 3300012929 | Vadose Zone Soil | MPIGRMTKIAAGIIFVVAALGVASPVLLVPLALAVWVFGEVL* |
| Ga0137404_100869444 | 3300012929 | Vadose Zone Soil | MSIGRATKIAAGILFLLAVVGVTSPVLLVPLGLAVWVLGEAA* |
| Ga0137407_101572902 | 3300012930 | Vadose Zone Soil | MSIGRATKIAAGILFLLAVAGVTSPVLLVPLGLAVWVLGEAA* |
| Ga0126375_102405743 | 3300012948 | Tropical Forest Soil | MGIGRTSKIIAAIIFIVAAVGIAAPVPFVPLGLAVWVIGEVL* |
| Ga0157378_109276212 | 3300013297 | Miscanthus Rhizosphere | MGIGRASKIVAGIVFILASLGMPAPVPLVPIGLAIWVLGEAL* |
| Ga0163162_123237912 | 3300013306 | Switchgrass Rhizosphere | GRATKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEVL* |
| Ga0180066_10497803 | 3300014873 | Soil | MGINRASKIAAGIIFILAALGVSTPIQLVPIGLAVWVLGEAL* |
| Ga0180074_10613742 | 3300014877 | Soil | MGINRGSKIAAGIIFILAALGVSTPINLVPIGLAVWVLGEAL* |
| Ga0180086_10050801 | 3300014883 | Soil | RRHHMGINRGSKIAAGIIFILAALGVSTPINLIPIGLAVWVLGEAL* |
| Ga0180086_10174341 | 3300014883 | Soil | MGINRGSKIAAGIIFILAALGVSTPINLIPIGLAVW |
| Ga0137418_104822414 | 3300015241 | Vadose Zone Soil | MSIGRGSKIAAGILFVLAALGVSTPVLLVPVGLAVWVLGEAL* |
| Ga0134089_102077713 | 3300015358 | Grasslands Soil | MGIGRASKIAAGIIFVVAALGVASPVLLVPLGLAVWVFGEVL* |
| Ga0184610_10210623 | 3300017997 | Groundwater Sediment | MGIGRASKIVAGIVFILASLGVAAPVLLVPIGLAVWVLGEAL |
| Ga0184610_11338912 | 3300017997 | Groundwater Sediment | MGIGRASKIAAGIVFILASLGVAGPVLLVPIGLAVWVLGEAL |
| Ga0184608_100044506 | 3300018028 | Groundwater Sediment | MGIGRASKIAAGIVFILASLGVATPVLLVPIGLAVWVLGEAL |
| Ga0184608_100200983 | 3300018028 | Groundwater Sediment | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGEAV |
| Ga0184634_101166402 | 3300018031 | Groundwater Sediment | MGIPRASKIAAGIVFLLAALGVAAPVPLVPIGLAIWVLGEAF |
| Ga0184638_11030183 | 3300018052 | Groundwater Sediment | MGISRASKIAAGIVFLVAALGVAAPVPLVPIGLAIWVLGEAF |
| Ga0184637_100178056 | 3300018063 | Groundwater Sediment | MGIGRASKIAAGIVFVLASLGVAGPVLLVPIGLAVWVLGEAL |
| Ga0184640_101459061 | 3300018074 | Groundwater Sediment | MGIGRASKIAAGIVFILASLGVAAPVLLVPIGLAVWVLGEAF |
| Ga0184627_103017452 | 3300018079 | Groundwater Sediment | MSIGRASKIAAGIVFILAALGVAAPVPLVPIGLAVWVLGEAL |
| Ga0066655_101309163 | 3300018431 | Grasslands Soil | MPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWVFGEVLRA |
| Ga0066662_128548222 | 3300018468 | Grasslands Soil | MGIGRASKIAAGIIFILAALGVSVPVLLVPIGLAVWVLGEAL |
| Ga0066669_106471363 | 3300018482 | Grasslands Soil | MPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWVFGEVL |
| Ga0137408_10963342 | 3300019789 | Vadose Zone Soil | MGIGRASKIAAGIIFVVAALGVATPILLVPLGLAVWVLGEAL |
| Ga0193755_10442243 | 3300020004 | Soil | MSIGRATKIAAGILFLLAVVGVNSPVLLVPLGLAVWVLGEAA |
| Ga0193755_11153102 | 3300020004 | Soil | MGIGRASKIAAGIVFVLAALGITGPVPLVPIGLAIWVLGEAL |
| Ga0193755_11810442 | 3300020004 | Soil | MGVGRASKIAAGIVFIVAALGVAAPVLLVPIGLAIWVLGEAL |
| Ga0193719_101100312 | 3300021344 | Soil | MSIGRATKIVAGILFILAVVGVTSPVLLVPLGLAVWVLGEAA |
| Ga0222623_103621702 | 3300022694 | Groundwater Sediment | SKIAAGIVFILASLGVATPVLLVPIGLAVWVLGEAL |
| Ga0207653_102883311 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIGRATKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEVL |
| Ga0207684_103533173 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL |
| Ga0207650_114155542 | 3300025925 | Switchgrass Rhizosphere | MGIGRASKIVAGIVFILASLGMTAPVPLVPIGLAIWVLGEAL |
| Ga0207712_113873553 | 3300025961 | Switchgrass Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLMPLGLAVWVLGEAV |
| Ga0207668_103805022 | 3300025972 | Switchgrass Rhizosphere | MGIGRASKIAAGIVFIVAALGVAAPVLLVPIGLAIWVLGEAL |
| Ga0207648_103574672 | 3300026089 | Miscanthus Rhizosphere | MSIGRATKIAAGILFILAVVGVNSPVLLTPLGLAVWVLGGAV |
| Ga0209438_11216663 | 3300026285 | Grasslands Soil | MGIGRATKIAAGIIFVVAALGTATPVLLVPLGLAVWVFGEVL |
| Ga0209438_11459032 | 3300026285 | Grasslands Soil | MPIGRVTKIAAGIIFLVAALGVASPVLLVPLGLAVWVFGEVL |
| Ga0209236_11137872 | 3300026298 | Grasslands Soil | MGIGRASEIAAGIVFILASLGVATPVLLVPIGLAVWVLGEAL |
| Ga0209131_12920262 | 3300026320 | Grasslands Soil | KIIAGIVFILAALGVAAPAPLVPIGLAIWVLGEVL |
| Ga0209470_10415211 | 3300026324 | Soil | MGIGRASKIAAGIVFILASLGVAAPVPLVPIGLAVWVLGE |
| Ga0209152_100350383 | 3300026325 | Soil | MPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWMFGEVLRA |
| Ga0209266_11793901 | 3300026327 | Soil | ASKIAAGIVFILASLGVAAPVPLVPIGLAVWVLGEAL |
| Ga0209808_10500913 | 3300026523 | Soil | MPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWVFGE |
| Ga0209161_105603671 | 3300026548 | Soil | RNDMPIGRLSKIAAGIIFVVAALGVTAPVLLVPLGLAVWVFGEVLRA |
| Ga0209877_10254512 | 3300027032 | Groundwater Sand | MSIGRASKIAAGILFILAALGVSVPVLLVPVGLAVWVLGEAL |
| Ga0209845_10146132 | 3300027324 | Groundwater Sand | MSIGRASKIAAGIVFIMASLGVAAPVLLVPIGLAVWVLGEAL |
| Ga0209854_10647571 | 3300027384 | Groundwater Sand | MGIGRASKIAAGIVFILAALGVSVPVLLVPIGLAIWVLGEAL |
| Ga0209899_10061975 | 3300027490 | Groundwater Sand | MGIGRASKIAAGIVFIMASLGVAAPVLLVPIGLAVWVLGEAL |
| Ga0209843_10048212 | 3300027511 | Groundwater Sand | MSIGRASKIAAGIVFILASLGVAAPVLLVPIGLAVWVLGEAL |
| Ga0209684_10171922 | 3300027527 | Tropical Forest Soil | MPIGRVTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVFGEVL |
| Ga0209874_10495481 | 3300027577 | Groundwater Sand | RRRRTPMGIGRASKIAAGIVFIMASLGVAAPVLLVPIGLAVWVLGEAL |
| Ga0209874_11443281 | 3300027577 | Groundwater Sand | MSIGRTSKIAAGVLFILAALGVSVPVLLVPIGLAVWVLGEAI |
| Ga0209466_10085232 | 3300027646 | Tropical Forest Soil | MGIGRTSKIIAAIIFIVAAVGIAAPVPLVPLGLAVWVIGEVL |
| Ga0209689_11809661 | 3300027748 | Soil | NRMGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL |
| Ga0209814_1000139512 | 3300027873 | Populus Rhizosphere | MGIGRGTKIAAGIIFIVAALGVATPVLLVPLGLAVWVLGEAL |
| Ga0209814_100069235 | 3300027873 | Populus Rhizosphere | MGIGRATKIAAGIIFVVAALGAATPVLLVPLGLAVWVLGEAV |
| Ga0209488_100728381 | 3300027903 | Vadose Zone Soil | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWV |
| Ga0207428_1000030613 | 3300027907 | Populus Rhizosphere | MGIGRGTKIAAGIIFVVAALGVAAPVLLVPLGLAVWVLGEAL |
| Ga0209382_106668572 | 3300027909 | Populus Rhizosphere | MGISRASKIVAGILFIVAALGVAAPVALVPIGLAVWVLGEAL |
| Ga0209382_114135852 | 3300027909 | Populus Rhizosphere | MGIGRATKIAAGIIFVVATLGVATPVPLVPLGLAVWVLGEAL |
| Ga0209889_10026134 | 3300027952 | Groundwater Sand | MGIGRASKIAAGIVFILASLGVAAPVLLVPIGLAVWVLGEAL |
| Ga0137415_100595005 | 3300028536 | Vadose Zone Soil | MGIGRATKIAAGIIFVVAALGVATPVLLVPLGLAVWVLGEAL |
| Ga0247825_113017842 | 3300028812 | Soil | MSVGRITKIVAGILFLLAVIGVSSPVLLVPLGLAAWVLGEAA |
| (restricted) Ga0255311_10485072 | 3300031150 | Sandy Soil | PTSETTFAPKPMRRNHMGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEAL |
| (restricted) Ga0255310_101305671 | 3300031197 | Sandy Soil | MGIGRASKIAAGIIFVVAALGVATPVLLVPLGLAVWVFGEAL |
| Ga0308194_101317992 | 3300031421 | Soil | MGIGRASKIAAGIVFLVAALGVASPAPLVPIGLAIWVLGEAF |
| Ga0307469_100706403 | 3300031720 | Hardwood Forest Soil | MGIGRTSKIVAGIIFIVAAVGVATPVLLVPLGLAVWVFGEVL |
| Ga0307469_109096812 | 3300031720 | Hardwood Forest Soil | KIAAGIIFVVAALGVATPVPLVPLGLAVWVFGEVL |
| Ga0307469_111017162 | 3300031720 | Hardwood Forest Soil | MAIGRASKIAAGIVFILAALGVTTPVLLVPIGLAVWVLGEAL |
| Ga0307469_114245872 | 3300031720 | Hardwood Forest Soil | MPIGRMTKIAAGIIFVVAALGVASPVLLLPLGLAVWVFGEVL |
| Ga0307469_117228301 | 3300031720 | Hardwood Forest Soil | MGIGRASKIAAGIIFVVAALGVATPILLVPLGLAVW |
| Ga0307468_1000092502 | 3300031740 | Hardwood Forest Soil | MGIGRASKIAAGIVFIVAALGVAAPVLLVPIGLAVWVLGEAL |
| Ga0307468_1010929732 | 3300031740 | Hardwood Forest Soil | MGIGRASKIAAGIVFVLAALGVSPPVLLVPLGLAVWVLGEAL |
| Ga0307468_1014078972 | 3300031740 | Hardwood Forest Soil | MGIGRATKIAAGIIFVVAALGVATPVPLVPLGLAVWVFGEVL |
| Ga0307468_1017313252 | 3300031740 | Hardwood Forest Soil | MGIGRATKIAAGIIFVVATLGVATPVLLVPLGLAVWVLGEAL |
| Ga0307468_1023810522 | 3300031740 | Hardwood Forest Soil | MPIGRMTKIAAGIIFLVAALGVASPVLLVPLGLAVWVFGEVL |
| Ga0307473_114976632 | 3300031820 | Hardwood Forest Soil | MPIGRMTKIAAGILFLVAALGVAAPVLLVPLGLAVWVFGEVL |
| Ga0310904_101331551 | 3300031854 | Soil | GTKIAAGIIFIVAALGVATPVLLVPLGLAVWVLGEAL |
| Ga0310891_100410131 | 3300031913 | Soil | TKIAAGIIFIVAALGVATPVLLVPLGLAVWVLGEAL |
| Ga0307471_1001168414 | 3300032180 | Hardwood Forest Soil | MGIGRASKIAAGIVFILASLGVAAPVPLVPIGLAVWVLGEAL |
| Ga0307471_1003123703 | 3300032180 | Hardwood Forest Soil | MPIGRATKIAAGIIFVVAALGVAAPILLVPLGLAVWVFGEVL |
| Ga0307471_1003721032 | 3300032180 | Hardwood Forest Soil | MGIGRASKIAAGIIFIVAALGVAAPVLLVPIGLAVWVLGEAL |
| Ga0307471_1013057973 | 3300032180 | Hardwood Forest Soil | MPIGRMTKIAAGIIFVVAALGVASPVLLVPLGLAVWVFGEVL |
| Ga0307471_1020107261 | 3300032180 | Hardwood Forest Soil | NDMPIGRVTKIVAGILFLVAALGVAAPVLLVPLGLAVWVFGEVL |
| Ga0307471_1023585622 | 3300032180 | Hardwood Forest Soil | MGIGRASKIVAGIIFIVAALGAASPVALVPIGLAVWVLGEAL |
| Ga0307471_1026332313 | 3300032180 | Hardwood Forest Soil | MGIGRATKIAAGIIFVVAALGVATPVLLVPLGLAV |
| Ga0307471_1028091402 | 3300032180 | Hardwood Forest Soil | MGIGRASKIAAGIVFILAALGVAAPVPLLPIGLAVWVLGEAL |
| Ga0307472_1005384483 | 3300032205 | Hardwood Forest Soil | MPIGRATKIAAGIIFVVAALGVASPVLLVPLGLAVWVFGEVL |
| ⦗Top⦘ |