


| Basic Information | |
|---|---|
| Family ID | F025675 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VPGACTSLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 148 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF11799 | IMS_C | 12.50 |
| PF07883 | Cupin_2 | 8.00 |
| PF01546 | Peptidase_M20 | 4.00 |
| PF02653 | BPD_transp_2 | 3.50 |
| PF00583 | Acetyltransf_1 | 3.00 |
| PF08281 | Sigma70_r4_2 | 2.50 |
| PF04542 | Sigma70_r2 | 2.50 |
| PF06736 | TMEM175 | 2.00 |
| PF05977 | MFS_3 | 2.00 |
| PF04264 | YceI | 2.00 |
| PF01425 | Amidase | 2.00 |
| PF12796 | Ank_2 | 1.50 |
| PF16864 | Dimerisation2 | 1.50 |
| PF04392 | ABC_sub_bind | 1.00 |
| PF01243 | Putative_PNPOx | 1.00 |
| PF13302 | Acetyltransf_3 | 1.00 |
| PF05988 | DUF899 | 1.00 |
| PF13460 | NAD_binding_10 | 1.00 |
| PF12773 | DZR | 1.00 |
| PF01799 | Fer2_2 | 1.00 |
| PF00753 | Lactamase_B | 1.00 |
| PF01699 | Na_Ca_ex | 1.00 |
| PF07366 | SnoaL | 1.00 |
| PF01925 | TauE | 0.50 |
| PF11066 | DUF2867 | 0.50 |
| PF04255 | DUF433 | 0.50 |
| PF00891 | Methyltransf_2 | 0.50 |
| PF14294 | DUF4372 | 0.50 |
| PF00994 | MoCF_biosynth | 0.50 |
| PF01958 | Asp_DH_C | 0.50 |
| PF05598 | DUF772 | 0.50 |
| PF00903 | Glyoxalase | 0.50 |
| PF13701 | DDE_Tnp_1_4 | 0.50 |
| PF04191 | PEMT | 0.50 |
| PF14559 | TPR_19 | 0.50 |
| PF04072 | LCM | 0.50 |
| PF00211 | Guanylate_cyc | 0.50 |
| PF01323 | DSBA | 0.50 |
| PF00005 | ABC_tran | 0.50 |
| PF07973 | tRNA_SAD | 0.50 |
| PF00296 | Bac_luciferase | 0.50 |
| PF09365 | DUF2461 | 0.50 |
| PF07687 | M20_dimer | 0.50 |
| PF13649 | Methyltransf_25 | 0.50 |
| PF12840 | HTH_20 | 0.50 |
| PF01810 | LysE | 0.50 |
| PF13240 | zinc_ribbon_2 | 0.50 |
| PF12710 | HAD | 0.50 |
| PF13193 | AMP-binding_C | 0.50 |
| PF12867 | DinB_2 | 0.50 |
| PF03358 | FMN_red | 0.50 |
| PF12973 | Cupin_7 | 0.50 |
| PF03466 | LysR_substrate | 0.50 |
| PF00817 | IMS | 0.50 |
| PF00561 | Abhydrolase_1 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.50 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.50 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.50 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.50 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 2.00 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 2.00 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 2.00 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.00 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.00 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.00 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.50 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.50 |
| COG1712 | L-aspartate dehydrogenase, NAD(P)-dependent | Amino acid transport and metabolism [E] | 0.50 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.50 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.50 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.50 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.50 % |
| Unclassified | root | N/A | 5.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000564|RepKanNP_BrdU_F12BDRAFT_1006894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 725 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10041731 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300000955|JGI1027J12803_101270940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300000955|JGI1027J12803_102308646 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300000956|JGI10216J12902_113899304 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300002562|JGI25382J37095_10256376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300002908|JGI25382J43887_10274268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300004157|Ga0062590_101459334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
| 3300004268|Ga0066398_10127665 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300004268|Ga0066398_10144584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300004463|Ga0063356_106384387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
| 3300004633|Ga0066395_10646498 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005172|Ga0066683_10293312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1011 | Open in IMG/M |
| 3300005177|Ga0066690_11050851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300005178|Ga0066688_10458848 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300005180|Ga0066685_10032451 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300005181|Ga0066678_11020214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300005294|Ga0065705_10993894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300005445|Ga0070708_100258833 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300005445|Ga0070708_101749587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 577 | Open in IMG/M |
| 3300005451|Ga0066681_10300008 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300005468|Ga0070707_100610282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1053 | Open in IMG/M |
| 3300005468|Ga0070707_101818277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300005471|Ga0070698_100123458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2547 | Open in IMG/M |
| 3300005555|Ga0066692_10827906 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005556|Ga0066707_10190406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1319 | Open in IMG/M |
| 3300005559|Ga0066700_10447181 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005568|Ga0066703_10187458 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1252 | Open in IMG/M |
| 3300005574|Ga0066694_10181356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 999 | Open in IMG/M |
| 3300005713|Ga0066905_100373959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300005719|Ga0068861_101359107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
| 3300005764|Ga0066903_100745696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1738 | Open in IMG/M |
| 3300005983|Ga0081540_1154420 | Not Available | 900 | Open in IMG/M |
| 3300006844|Ga0075428_102350096 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006845|Ga0075421_100000217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 54590 | Open in IMG/M |
| 3300006852|Ga0075433_11780144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 530 | Open in IMG/M |
| 3300006854|Ga0075425_100095910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3366 | Open in IMG/M |
| 3300006854|Ga0075425_102623690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300006954|Ga0079219_12204739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300006969|Ga0075419_10818850 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300007076|Ga0075435_102055257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300007255|Ga0099791_10046975 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300007258|Ga0099793_10159308 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300007265|Ga0099794_10602270 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300009088|Ga0099830_10201270 | Not Available | 1558 | Open in IMG/M |
| 3300009089|Ga0099828_11726460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
| 3300009090|Ga0099827_10036950 | All Organisms → cellular organisms → Bacteria | 3580 | Open in IMG/M |
| 3300009090|Ga0099827_10217387 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300009100|Ga0075418_11979010 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300009137|Ga0066709_102128278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
| 3300009137|Ga0066709_104391631 | Not Available | 515 | Open in IMG/M |
| 3300009143|Ga0099792_10248358 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300009147|Ga0114129_11148626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300009147|Ga0114129_12290023 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009148|Ga0105243_10506911 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300009156|Ga0111538_12554887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata | 641 | Open in IMG/M |
| 3300009156|Ga0111538_13395219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300009444|Ga0114945_10223843 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300009553|Ga0105249_10678848 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300009792|Ga0126374_10357932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1004 | Open in IMG/M |
| 3300009804|Ga0105063_1029328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 700 | Open in IMG/M |
| 3300009821|Ga0105064_1144386 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009822|Ga0105066_1147653 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009836|Ga0105068_1104332 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010043|Ga0126380_10100340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1735 | Open in IMG/M |
| 3300010047|Ga0126382_10551419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 938 | Open in IMG/M |
| 3300010304|Ga0134088_10152862 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300010329|Ga0134111_10214422 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010336|Ga0134071_10449253 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010337|Ga0134062_10758451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300010360|Ga0126372_10087716 | Not Available | 2290 | Open in IMG/M |
| 3300010360|Ga0126372_10478431 | Not Available | 1163 | Open in IMG/M |
| 3300010360|Ga0126372_13049464 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010362|Ga0126377_10633749 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300010362|Ga0126377_12156676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300010366|Ga0126379_11286649 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010397|Ga0134124_10229611 | Not Available | 1698 | Open in IMG/M |
| 3300010398|Ga0126383_11222914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300010401|Ga0134121_10954563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
| 3300010403|Ga0134123_12570846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 576 | Open in IMG/M |
| 3300011269|Ga0137392_11013136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
| 3300012081|Ga0154003_1063302 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300012198|Ga0137364_10029824 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
| 3300012199|Ga0137383_10471040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 920 | Open in IMG/M |
| 3300012201|Ga0137365_11255235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300012202|Ga0137363_10216761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1543 | Open in IMG/M |
| 3300012202|Ga0137363_11145749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300012204|Ga0137374_10984780 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300012204|Ga0137374_11053806 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012208|Ga0137376_10602307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 951 | Open in IMG/M |
| 3300012353|Ga0137367_11170443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300012359|Ga0137385_10906382 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012582|Ga0137358_10285969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1120 | Open in IMG/M |
| 3300012582|Ga0137358_10579037 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300012912|Ga0157306_10091532 | Not Available | 863 | Open in IMG/M |
| 3300012922|Ga0137394_10097067 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300012922|Ga0137394_10379712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
| 3300012922|Ga0137394_10785109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
| 3300012929|Ga0137404_11206830 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012929|Ga0137404_11918602 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012930|Ga0137407_10248915 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300012930|Ga0137407_10723281 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300012930|Ga0137407_11709242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300012944|Ga0137410_10941718 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012944|Ga0137410_11314217 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012948|Ga0126375_11713810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012957|Ga0164303_11042795 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012971|Ga0126369_13117761 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012972|Ga0134077_10189087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300012972|Ga0134077_10318085 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012976|Ga0134076_10234140 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300015054|Ga0137420_1029518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2323 | Open in IMG/M |
| 3300015054|Ga0137420_1176141 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300015170|Ga0120098_1039053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 647 | Open in IMG/M |
| 3300015241|Ga0137418_10733899 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300015254|Ga0180089_1020532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1207 | Open in IMG/M |
| 3300015358|Ga0134089_10152424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 913 | Open in IMG/M |
| 3300015371|Ga0132258_11074645 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300015373|Ga0132257_101851752 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300016445|Ga0182038_11217659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 672 | Open in IMG/M |
| 3300017657|Ga0134074_1084957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300017657|Ga0134074_1274615 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300017997|Ga0184610_1202045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
| 3300018052|Ga0184638_1152482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 834 | Open in IMG/M |
| 3300018053|Ga0184626_10089016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1306 | Open in IMG/M |
| 3300018054|Ga0184621_10109698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 981 | Open in IMG/M |
| 3300018074|Ga0184640_10091606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1313 | Open in IMG/M |
| 3300018076|Ga0184609_10231268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 864 | Open in IMG/M |
| 3300018078|Ga0184612_10007379 | All Organisms → cellular organisms → Bacteria | 5519 | Open in IMG/M |
| 3300018078|Ga0184612_10346706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300018078|Ga0184612_10468165 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018422|Ga0190265_11966997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
| 3300018429|Ga0190272_11220096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300018466|Ga0190268_11127341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 641 | Open in IMG/M |
| 3300018468|Ga0066662_11773152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300018468|Ga0066662_12155507 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018482|Ga0066669_10058525 | All Organisms → cellular organisms → Bacteria | 2481 | Open in IMG/M |
| 3300019259|Ga0184646_1318901 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300019360|Ga0187894_10274929 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300019487|Ga0187893_10174080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1702 | Open in IMG/M |
| 3300020170|Ga0179594_10120990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 954 | Open in IMG/M |
| 3300020199|Ga0179592_10300558 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300021081|Ga0210379_10343867 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021344|Ga0193719_10003243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6564 | Open in IMG/M |
| 3300021560|Ga0126371_10528386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1328 | Open in IMG/M |
| 3300025904|Ga0207647_10815762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300025922|Ga0207646_11235813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300025922|Ga0207646_11503319 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300025932|Ga0207690_11274758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300025935|Ga0207709_11529802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300025940|Ga0207691_11380655 | Not Available | 579 | Open in IMG/M |
| 3300025961|Ga0207712_10427106 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300026015|Ga0208286_1018619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300026041|Ga0207639_11992547 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300026313|Ga0209761_1086412 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300026320|Ga0209131_1048844 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300026320|Ga0209131_1278667 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
| 3300026326|Ga0209801_1306410 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026328|Ga0209802_1073462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1609 | Open in IMG/M |
| 3300026331|Ga0209267_1154062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300026331|Ga0209267_1211733 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300026334|Ga0209377_1052028 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300026446|Ga0257178_1040283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
| 3300026527|Ga0209059_1183440 | Not Available | 722 | Open in IMG/M |
| 3300026536|Ga0209058_1169316 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300026547|Ga0209156_10118797 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300027169|Ga0209897_1041665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
| 3300027561|Ga0209887_1016454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1833 | Open in IMG/M |
| 3300027654|Ga0209799_1104080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300027655|Ga0209388_1052574 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300027671|Ga0209588_1060366 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300027775|Ga0209177_10443412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300027874|Ga0209465_10509600 | Not Available | 600 | Open in IMG/M |
| 3300027909|Ga0209382_10286462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1860 | Open in IMG/M |
| 3300027909|Ga0209382_12151224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300027961|Ga0209853_1170829 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300028381|Ga0268264_11833709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
| 3300028784|Ga0307282_10375004 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300030336|Ga0247826_10316520 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300030336|Ga0247826_11068402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 643 | Open in IMG/M |
| 3300031640|Ga0318555_10679584 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031681|Ga0318572_10337497 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031720|Ga0307469_11495231 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031720|Ga0307469_12101509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300031720|Ga0307469_12119178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
| 3300031740|Ga0307468_100263954 | Not Available | 1222 | Open in IMG/M |
| 3300031754|Ga0307475_10663386 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031770|Ga0318521_10517512 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031779|Ga0318566_10117434 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300031805|Ga0318497_10378579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 791 | Open in IMG/M |
| 3300031820|Ga0307473_10977768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
| 3300031860|Ga0318495_10348587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 656 | Open in IMG/M |
| 3300032059|Ga0318533_10470098 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300032174|Ga0307470_10055825 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300032180|Ga0307471_100536555 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300032180|Ga0307471_100999943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1003 | Open in IMG/M |
| 3300032180|Ga0307471_102189458 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300032180|Ga0307471_103298287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300033233|Ga0334722_11149872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300033550|Ga0247829_10640436 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.50% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.50% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.50% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.50% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.50% |
| Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000564 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RepKanNP_BrdU_F12BDRAFT_10068941 | 3300000564 | Soil | VPGACASLLEAMVRSGFRLGDPALFMASRLFGRPELXLPSGPILY* |
| AF_2010_repII_A1DRAFT_100417311 | 3300000597 | Forest Soil | AGSSGGDSVTMRVPGACTLLLETLVRCGFRLGDPTLFMASRLFGRLELYLPSGPILY* |
| JGI1027J12803_1012709403 | 3300000955 | Soil | AAAASAGGGGNVTMRVPGICASLLEALVGCGFRVGELAVFMASRLFGRPELYLPSGPILY |
| JGI1027J12803_1023086462 | 3300000955 | Soil | AAGAAGGERVTARVPGACTSLLQALIGCGFQLGEPTLFMASRLFGRPELYLPSGPILY* |
| JGI10216J12902_1138993041 | 3300000956 | Soil | TSLLEALVGCGFRLGDPTLFMASRLFGRPELYLPSGPILY* |
| JGI25382J37095_102563762 | 3300002562 | Grasslands Soil | CASLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| JGI25382J43887_102742682 | 3300002908 | Grasslands Soil | NVTVRVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0062590_1014593342 | 3300004157 | Soil | SVMIRVPGVCASLLQALVGSGFRIGSSPTLFMASRLIGRPELYLPSGPILY* |
| Ga0066398_101276652 | 3300004268 | Tropical Forest Soil | SKRVTMRVPGACASLLEVMITSGFHISNMTVFLSSRPYGRPECYLPSGPILY* |
| Ga0066398_101445842 | 3300004268 | Tropical Forest Soil | MSAAGSSKRVTMRVPGACASMLEALITSGFQISNMTVFLSSRPYGRPEFYVPSGPILY* |
| Ga0063356_1063843872 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RVPGACASLLEALVSCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0066395_106464982 | 3300004633 | Tropical Forest Soil | VPGACTSLLEALIGCGFRLGAPSLLMASRLFGRPELYVPSGPILY* |
| Ga0066683_102933121 | 3300005172 | Soil | SLLEALVSCGFRIGAPTLFMASRVFGRPELYLPSGPILY* |
| Ga0066690_110508512 | 3300005177 | Soil | GACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0066688_104588481 | 3300005178 | Soil | SLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0066685_100324516 | 3300005180 | Soil | PGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0066678_110202141 | 3300005181 | Soil | VTIRVPGGCASLLEAPVRCGFRIGAPTPFMASRVFGRPELYLPS |
| Ga0065705_109938941 | 3300005294 | Switchgrass Rhizosphere | SVMMRVPGACASLLEALVSCGFRIAGAPTLFMASRPFGRPELYVPSGPILY* |
| Ga0070708_1002588331 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0070708_1017495873 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SVTMRVPGACTSLLEAPVSCGFRIGPLTLFMASRPFGRPALYLPSGPILY* |
| Ga0066681_103000082 | 3300005451 | Soil | MRVTGACASLLEALLSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0070707_1006102822 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGGESVTMRVPGACASLLEALVSCGFRIGGAPTLFMASRLFGRPELYVPSGPILY* |
| Ga0070707_1018182771 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAGGGGSVTMRVPGACTSLLEAPVSCGFRIGGDPTLFMASRPFGRPELYLPSGPILY* |
| Ga0070698_1001234586 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SLLEAMVGCGFRIGAPTLFMASRLFGRPELYLPSGPILY* |
| Ga0066692_108279061 | 3300005555 | Soil | TVRVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0066707_101904061 | 3300005556 | Soil | RVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0066700_104471812 | 3300005559 | Soil | SLLEALISCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0066703_101874584 | 3300005568 | Soil | SLLEALVSCGFRIGDPTLFMASRPFGRPELYLPSGPILY* |
| Ga0066694_101813562 | 3300005574 | Soil | MRVTGACASLLEALLSCGFRIGDPTLFMASRLFGRPELYLPSGPILYQARL* |
| Ga0066905_1003739592 | 3300005713 | Tropical Forest Soil | VAGAADGANVTARVPGSCASLLETLVSCGFRFGSPTLFMASRLFGRPELYLPSGPILY* |
| Ga0068861_1013591072 | 3300005719 | Switchgrass Rhizosphere | LQALVGSGFRIGSSPTLFMASRLIGRPELYLPAGPILY* |
| Ga0066903_1007456961 | 3300005764 | Tropical Forest Soil | GRSVTMRVPGACTSLLEALVRCGFRLGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0081540_11544202 | 3300005983 | Tabebuia Heterophylla Rhizosphere | QALVACGFHIGEPSLFMASQLFGRHELYLPSGPILF* |
| Ga0075428_1023500961 | 3300006844 | Populus Rhizosphere | VTARVPGACTSLLQALLGCGFQLGEPTVFMASRLFGRPELYLPSGPILY* |
| Ga0075421_10000021761 | 3300006845 | Populus Rhizosphere | RVPGACTSLLQALLGCGFQLGEPTVFMASRLFGRPELYLPSGPILY* |
| Ga0075433_117801441 | 3300006852 | Populus Rhizosphere | VPGACASLLEALVGCGFRLGDPTLFMASQLFGRPELYLPSGPILY* |
| Ga0075425_1000959101 | 3300006854 | Populus Rhizosphere | PGICASLLEALVGCGFRVGELAVFMASRLFGRPELYLPSGPILY* |
| Ga0075425_1026236902 | 3300006854 | Populus Rhizosphere | TLRVPGACASLLEALVSSGFRVGPLTLFMASRRFGRPELYIPSGPILY* |
| Ga0079219_122047391 | 3300006954 | Agricultural Soil | CASLLQALVGCGFRLGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0075419_108188501 | 3300006969 | Populus Rhizosphere | LLEALVGSGFQLGAPTLFMASRLFGRHELYLPSGPILY* |
| Ga0075435_1020552572 | 3300007076 | Populus Rhizosphere | RVPGACASLLQSLVGSGFRIGYPTLFMASRPFGRPELYLPSGPILY* |
| Ga0099791_100469754 | 3300007255 | Vadose Zone Soil | AGSGRSVTMRVPGACASLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0099793_101593082 | 3300007258 | Vadose Zone Soil | VTTVRVPGAGASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0099794_106022701 | 3300007265 | Vadose Zone Soil | GGNVTVRVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0099830_102012702 | 3300009088 | Vadose Zone Soil | VRVPGACASLLEALVGCGFRIGELAVFLASRPFGRHELYLPSGPILY* |
| Ga0099828_117264601 | 3300009089 | Vadose Zone Soil | MRVPGACASLLEALVSCGFRIGAPTLFMASRLFGRPELYLPSGPILY* |
| Ga0099827_100369506 | 3300009090 | Vadose Zone Soil | PGACVSLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0099827_102173872 | 3300009090 | Vadose Zone Soil | GGGSVTMRVPGACTSLLEALVSCGFRIGAPTLFMASRLFGRPELYLPSGPILY* |
| Ga0075418_119790101 | 3300009100 | Populus Rhizosphere | PGACVCLLEALVGCDFRIDAPTLSMASRLFGRLELHLSSGPIQLGRSYFFP* |
| Ga0066709_1021282781 | 3300009137 | Grasslands Soil | LVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0066709_1043916312 | 3300009137 | Grasslands Soil | ALVGCGFRIGDLALFMASRPFGRPELYLPSGPILY* |
| Ga0099792_102483581 | 3300009143 | Vadose Zone Soil | NAGGGGNVTVRVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYPPSGPILY* |
| Ga0114129_111486262 | 3300009147 | Populus Rhizosphere | AADPATDTALEALVTSGFRIGGPTLFMASLVFGRPELYLPSGPILF* |
| Ga0114129_122900232 | 3300009147 | Populus Rhizosphere | AADPATDTALEALVTSGFRIGGPTLFMASRVFGRPELYLPSGPILY* |
| Ga0105243_105069112 | 3300009148 | Miscanthus Rhizosphere | LQALVGSGFRIGSSPTLFMASRLIGRPELYLPSGPILY* |
| Ga0111538_125548871 | 3300009156 | Populus Rhizosphere | PGACASLLQSLVGSGFRIGYPTLFMASRPFGRPELYLPSGPILY* |
| Ga0111538_133952192 | 3300009156 | Populus Rhizosphere | AAAVRAGGGSVTMRVPGACASLLEALVGSGFRIGELAVFLASRLFGRPELYLPSGPILF* |
| Ga0114945_102238433 | 3300009444 | Thermal Springs | VPGACASLLEALVSSGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0105249_106788481 | 3300009553 | Switchgrass Rhizosphere | ASLLEALVGSGFRIGELAVFLTSRLFGRPELYLPSGPILF* |
| Ga0126374_103579323 | 3300009792 | Tropical Forest Soil | INSGSVTIRVPGVCAPLLEALVSSGFRIGELAVFLSSRLFGRAELYLPSGPILF* |
| Ga0105063_10293281 | 3300009804 | Groundwater Sand | ACASLLEALVRCGFRIGNPTLFMASRPFGRPELYVPSGPILY* |
| Ga0105064_11443862 | 3300009821 | Groundwater Sand | ACAFLLEALVGSGFRIGALTLFMASRLFGRPELYLPSGPILY* |
| Ga0105066_11476532 | 3300009822 | Groundwater Sand | CTSLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0105068_11043322 | 3300009836 | Groundwater Sand | SLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0126380_101003404 | 3300010043 | Tropical Forest Soil | SLLEALVCCGFRLGDPSLFMASRLFGRPELYLPSGPILY* |
| Ga0126382_105514192 | 3300010047 | Tropical Forest Soil | LLEALVHSGFRLGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0134088_101528621 | 3300010304 | Grasslands Soil | NAGDGGNVTVRVPGACACLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0134111_102144222 | 3300010329 | Grasslands Soil | EALVSCGFRISAPTLFMASRLFGRPELYLPSGPILY* |
| Ga0134071_104492532 | 3300010336 | Grasslands Soil | PGACASLLEALVSCGFRISAPTLFMASRLFGRPELYLPSGPILY* |
| Ga0134062_107584512 | 3300010337 | Grasslands Soil | MRVPGACASLLEALISCGFRIGDPTLFMASRLFGRPELYLPS |
| Ga0126372_100877164 | 3300010360 | Tropical Forest Soil | VPGACASLLDALVGCGFRIGTPTTLFMASRLFGRPELYLPSGPILY* |
| Ga0126372_104784311 | 3300010360 | Tropical Forest Soil | LVGCGFRLGDPTVFMASRLFGRPELYLPSGPILY* |
| Ga0126372_130494642 | 3300010360 | Tropical Forest Soil | TGTGGVGSVALRVPGACTRLLEALVGCGFRLGAPALFMASRLFGRPELYLPSGPFLY* |
| Ga0126377_106337491 | 3300010362 | Tropical Forest Soil | LEALITSGFQISNMTVFLSSRPYGRPELYLPSGPILY* |
| Ga0126377_121566763 | 3300010362 | Tropical Forest Soil | VPGACASLLEALVRCGFRLGDPSLFMASRVFGRPELYLPSGPILY* |
| Ga0126379_112866493 | 3300010366 | Tropical Forest Soil | ASAAGGERVTLRVPGACTSLLEALIGCGFQLGAPSLLMASRLFGRPELYVPSGPILY* |
| Ga0134124_102296111 | 3300010397 | Terrestrial Soil | SLLEALVGCGFRLGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0126383_112229141 | 3300010398 | Tropical Forest Soil | PGACASLLEALVGCGFRIGDPTLFMASQLFGRPELYLPSGPILF* |
| Ga0134121_109545632 | 3300010401 | Terrestrial Soil | VPGACASLLEALVSSGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0134123_125708462 | 3300010403 | Terrestrial Soil | VTIRVPGACASLLEAVVSCGFQIGGTPTLFMASRLFGRLELYVPSGPILF* |
| Ga0137392_110131362 | 3300011269 | Vadose Zone Soil | MRVPGACTSLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0154003_10633021 | 3300012081 | Attine Ant Fungus Gardens | LVGCGFRIGAPSLFMTSRLFGRPELYLPSGPILY* |
| Ga0137364_100298241 | 3300012198 | Vadose Zone Soil | VRVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLHSGLILY* |
| Ga0137383_104710402 | 3300012199 | Vadose Zone Soil | VTIRVPGACASLLEALVSCGFRIGAPTLFMASRVFGRPELYLPSGPILY* |
| Ga0137365_112552353 | 3300012201 | Vadose Zone Soil | PGACSSLLEALVSCGFRIGPLTLFMASRPFGRPELYLPSGPILY* |
| Ga0137363_102167611 | 3300012202 | Vadose Zone Soil | SLLEALVSCGFHIGAPTLFMASRVFGRPELYLPSGPILY* |
| Ga0137363_111457492 | 3300012202 | Vadose Zone Soil | SLLEARVSCGFRIGDPTLFMASRLFGRPEFYLPSGPILY* |
| Ga0137374_109847801 | 3300012204 | Vadose Zone Soil | MRVPGACASLLDALVSCGFRISAPTLFMASRLFGRPELYLPSGPILY* |
| Ga0137374_110538062 | 3300012204 | Vadose Zone Soil | SVTVRVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0137376_106023071 | 3300012208 | Vadose Zone Soil | NVTVRVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0137367_111704432 | 3300012353 | Vadose Zone Soil | CTSLLEALVSCGFRIGDLALFMASRRFGRPELYLPSGPILY* |
| Ga0137385_109063821 | 3300012359 | Vadose Zone Soil | NVTVRVPGACASLLEALVGSGFRIGELAVFLASRPFGRHELYLPSGPILY* |
| Ga0137358_102859692 | 3300012582 | Vadose Zone Soil | GGGESVTIRVPGACASLLEALVSCGFHIGAPTLFMASRVFGRPELYLPSGPILY* |
| Ga0137358_105790373 | 3300012582 | Vadose Zone Soil | CASLLEALVGCGVRIGELAVFLGSRPFGRPELYLPSGPILY* |
| Ga0157306_100915322 | 3300012912 | Soil | TVRVPGACASLLETLVCCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0137394_100970674 | 3300012922 | Vadose Zone Soil | PGVCASLLQALVGSGFRIGSSPTLFMASRLIGRPALYLPSGPILY* |
| Ga0137394_103797122 | 3300012922 | Vadose Zone Soil | FETLVSCGFRIGDPTLFMASRPFGRPELYLPSGPILY* |
| Ga0137394_107851091 | 3300012922 | Vadose Zone Soil | GSVTMRVPGACTSLLEALVSCGFRIGGAPSLFMASRLFGRPELYLPSGPILY* |
| Ga0137404_112068302 | 3300012929 | Vadose Zone Soil | GVCASLLQALVGSGFRIGSSPTLFMASQLIGRPEFYLPSGPILY* |
| Ga0137404_119186021 | 3300012929 | Vadose Zone Soil | ACTSLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0137407_102489151 | 3300012930 | Vadose Zone Soil | LLEALVSCGFRIGPLTMFMASRPFGRPELYLPSGPILY* |
| Ga0137407_107232811 | 3300012930 | Vadose Zone Soil | LQALVGSGFRIGSSPTLFMASRLIGRPALYLPSGPILY* |
| Ga0137407_117092421 | 3300012930 | Vadose Zone Soil | GGGSGGNVTMRVPGACGSLLEALVSCGFRIGPLTLFMASRPFGRPELYLPSGPILY* |
| Ga0137410_109417182 | 3300012944 | Vadose Zone Soil | EALVSCGFRIGDPTLFMASRPFGRPELYLPSGPILS* |
| Ga0137410_113142172 | 3300012944 | Vadose Zone Soil | SLLEALVRSGFRLGDPTLFIASRLFGRPELYLPSGPILY* |
| Ga0126375_117138101 | 3300012948 | Tropical Forest Soil | AINSGSVTIRVPGVCAPLLEALVSSGFRIGELAVFLSSRLFGRPELYLPSGPILF* |
| Ga0164303_110427952 | 3300012957 | Soil | CASLLEALVGCGFRIGELAIFLASQPFGRPELYLPSGPILY* |
| Ga0126369_131177612 | 3300012971 | Tropical Forest Soil | SLLEALIGCGFHLGDPTIFMASRVFGRPELYLPSGPILC* |
| Ga0134077_101890871 | 3300012972 | Grasslands Soil | ALVSCGFRIGDPTLFMASRPFGRPEFYLPSGPILY* |
| Ga0134077_103180852 | 3300012972 | Grasslands Soil | RVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY* |
| Ga0134076_102341403 | 3300012976 | Grasslands Soil | MRVPGACTSLLEALVSCGFRIGDPTLFMASRPFGRPEFYLPSGPILY* |
| Ga0137420_10295185 | 3300015054 | Vadose Zone Soil | RNVTTVRVAGAGASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0137420_11761411 | 3300015054 | Vadose Zone Soil | RDDNVTTVRVAGAGASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY* |
| Ga0120098_10390531 | 3300015170 | Fossill | MRVPGACASLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0137418_107338992 | 3300015241 | Vadose Zone Soil | CASLLQTLVGSGFRIGSPTLFMASRLFGRPELYLPSGPILY* |
| Ga0180089_10205322 | 3300015254 | Soil | MRVPGACTSLLEALVSCGFRIGPLTLFMASRPFGRPELYLPSGPILY* |
| Ga0134089_101524242 | 3300015358 | Grasslands Soil | LLEALVICGFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0132258_110746451 | 3300015371 | Arabidopsis Rhizosphere | PGACASLLEALVSCSFRIGDPTLFMASRLFGRPELYLPSGPILY* |
| Ga0132257_1018517523 | 3300015373 | Arabidopsis Rhizosphere | PGACASLLEALVSCGFRIGDLAVFLASRPFGRPELYLPSGPILY* |
| Ga0182038_112176592 | 3300016445 | Soil | EALVGSGFRIGELAVFLASRLFGRPELYLPSGPILF |
| Ga0134074_10849571 | 3300017657 | Grasslands Soil | LLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0134074_12746152 | 3300017657 | Grasslands Soil | VPGACTSLLEALVSCGFRIGGAPSLFMASRLFGRPELYLPSGPILY |
| Ga0184610_12020452 | 3300017997 | Groundwater Sediment | GACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0184638_11524821 | 3300018052 | Groundwater Sediment | GGSVTMRVPGACTSLLEALVSCGFRIGVLTLFMASRPFGRPELYLPSGPILY |
| Ga0184626_100890163 | 3300018053 | Groundwater Sediment | GACTSLLEALVSCGFRIGPLTLFMASRPFGRPELYLPSGPILY |
| Ga0184621_101096982 | 3300018054 | Groundwater Sediment | MRVPGACTSLLEALVSCGFRIGALTLFMASRPFGRPELYLPSGPILY |
| Ga0184640_100916061 | 3300018074 | Groundwater Sediment | SVTLRVPGACASLLEALVSSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0184609_102312682 | 3300018076 | Groundwater Sediment | CTFLLEALVSCGFRIGFLTLFMASRPFGRPELYLPSGPILY |
| Ga0184612_100073796 | 3300018078 | Groundwater Sediment | VTVRVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0184612_103467062 | 3300018078 | Groundwater Sediment | SLLEALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0184612_104681651 | 3300018078 | Groundwater Sediment | ASLLEALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0190265_119669972 | 3300018422 | Soil | SGADGGGSVTMRVPRACASLLQALVGSGFRIGSPTLFMASRLFGRPELYLPSGPILY |
| Ga0190272_112200961 | 3300018429 | Soil | CTFLLEALVSCGFRIGPLTLFMASRPFGRPELYLPSGPILY |
| Ga0190268_111273412 | 3300018466 | Soil | GESVTMRVPGACASLLEALVSCGFRIAGAPTLFMASRPFGRPELYVPSGPILY |
| Ga0066662_117731522 | 3300018468 | Grasslands Soil | PGACACLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| Ga0066662_121555072 | 3300018468 | Grasslands Soil | MRVPGACASLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0066669_100585253 | 3300018482 | Grasslands Soil | MRVTGACASLLEALLSCGFRIGDPTLFMASRLFGRPELYLPSGPILYQARL |
| Ga0184646_13189011 | 3300019259 | Groundwater Sediment | TVRVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| Ga0187894_102749291 | 3300019360 | Microbial Mat On Rocks | TMRVPGACSSLLEALVRCGFRIGDPTLFMASRPFGRPELYLPSGPILY |
| Ga0187893_101740803 | 3300019487 | Microbial Mat On Rocks | CTSLLEALVSCGFRIGPLTLFMASRLFGRPELYLPSGPILY |
| Ga0179594_101209902 | 3300020170 | Vadose Zone Soil | SLLEALVSCGFRIGDPTLFMASRPFGRPELYLPSGPILY |
| Ga0179592_103005581 | 3300020199 | Vadose Zone Soil | GNVTVRVPGACASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| Ga0210379_103438672 | 3300021081 | Groundwater Sediment | CASLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| Ga0193719_100032431 | 3300021344 | Soil | GESVTIRVPGACASLLEALVSCGFHIGAPTLFMASRVFGRPELYLPSGPILY |
| Ga0126371_105283861 | 3300021560 | Tropical Forest Soil | GAGDGGSVTARVPGACTSLLEALVRCGFRLGDPSLFMASRVFGRPELYLPSGPILY |
| Ga0207647_108157622 | 3300025904 | Corn Rhizosphere | MRVPGACASLLETLVGCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0207646_112358131 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0207646_115033192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVPGACACLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| Ga0207690_112747581 | 3300025932 | Corn Rhizosphere | ASLLQALVGSGFRIGSSPTLFMASRLIGRPELYLPAGPILY |
| Ga0207709_115298021 | 3300025935 | Miscanthus Rhizosphere | LLQALVGSGFRIGSSPTLFMASRLIGRPELYLPSGPILY |
| Ga0207691_113806551 | 3300025940 | Miscanthus Rhizosphere | NVTMRVPGACASLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0207712_104271061 | 3300025961 | Switchgrass Rhizosphere | ESVTMRVPGACASLLEALVGSGFRIGELAVFLTSRLFGRPELYLPSGPILF |
| Ga0208286_10186192 | 3300026015 | Rice Paddy Soil | PGACASLLQALVGSGFRIGNPTLFMASRLFGRPELYLPSGPILY |
| Ga0207639_119925472 | 3300026041 | Corn Rhizosphere | GGSVMIRVPGVCASLLQALVGSGFRIGSSPTLFMASRLIGRPELYLPAGPILY |
| Ga0209761_10864121 | 3300026313 | Grasslands Soil | GGSVTMRVPGACISLLEALISCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209131_10488445 | 3300026320 | Grasslands Soil | AAASGVEGGGSVTIRVPGVCASLLQALVGSGFRIGSSPTLFMASRLIGRPELYLPSGPIL |
| Ga0209131_12786671 | 3300026320 | Grasslands Soil | GAGGGESVTIRVPGACASLLEALVSCGFHIGAPTLFMASRVFGRPELYLPSGPILY |
| Ga0209801_13064101 | 3300026326 | Soil | SLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209802_10734623 | 3300026328 | Soil | LEALISCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209267_11540622 | 3300026331 | Soil | NVTVRVPGACTSLLEALVGCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0209267_12117331 | 3300026331 | Soil | MRVPGACASLLEALISCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209377_10520282 | 3300026334 | Soil | ALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0257178_10402831 | 3300026446 | Soil | GACASLLEALVSCGFHIGAPTLFMASRVFGRPELYLPSWPILY |
| Ga0209059_11834402 | 3300026527 | Soil | SLLEALLSCGFRIGDPTLFMASRRFRRPELYLPSGPILY |
| Ga0209058_11693162 | 3300026536 | Soil | NVTVRVPGACASLLEALVGSGFRIGELAVFLASRPFGRHELYLPSGPILY |
| Ga0209156_101187972 | 3300026547 | Soil | VTMRVPGACASLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209897_10416653 | 3300027169 | Groundwater Sand | GACASLLEALVGSGFRLGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209887_10164543 | 3300027561 | Groundwater Sand | TSLLEALVSCGFRIGPLTLFMASRPFGRPELYLPSGPILY |
| Ga0209799_11040801 | 3300027654 | Tropical Forest Soil | MSAAGSSKRVTMRVPGACASMLEALITSGFQISNMTVFLSSRPYGRPEFYVPSGPILY |
| Ga0209388_10525742 | 3300027655 | Vadose Zone Soil | ACSSLLEALVRSGFRLGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209588_10603662 | 3300027671 | Vadose Zone Soil | CASLLEALVGCGFRIGELAIFLTSRPFGRPELYLPSGPILY |
| Ga0209177_104434121 | 3300027775 | Agricultural Soil | CASLLQALVGCGFRLGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209465_105096002 | 3300027874 | Tropical Forest Soil | ALLEALVHSGFRLGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0209382_102864623 | 3300027909 | Populus Rhizosphere | CTSLLEALVSCGFRIAGAPTLFMASRPFGRPELYVPSGPILY |
| Ga0209382_121512241 | 3300027909 | Populus Rhizosphere | EALVSCGFRIGELAIFLASRPFGRPELYLPSGPILY |
| Ga0209853_11708292 | 3300027961 | Groundwater Sand | VPGACTSLLEALVSCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0268264_118337092 | 3300028381 | Switchgrass Rhizosphere | VPGACASLLEALVGSGFRIGELAVFLTSRLFGRPELYLPSGPILF |
| Ga0307282_103750041 | 3300028784 | Soil | CASLLEALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0247826_103165202 | 3300030336 | Soil | EALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| Ga0247826_110684021 | 3300030336 | Soil | AASGADGGGSVTMRVPGACASLLQTLVGSGFRIGNASRLFGRPELYLPSGPILY |
| Ga0318555_106795842 | 3300031640 | Soil | SLLQALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0318572_103374973 | 3300031681 | Soil | SVTARVPGACTSLLQALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0307469_114952311 | 3300031720 | Hardwood Forest Soil | ASLLEALVSCGFRIGAPTLFMASRVFGRPELYLPSGPILY |
| Ga0307469_121015091 | 3300031720 | Hardwood Forest Soil | TMRVPGACASLLEALVSCGFRIGDLAVFLASRPFGRPELYLPSGPILY |
| Ga0307469_121191781 | 3300031720 | Hardwood Forest Soil | MRVPGACASLLEALVTCGFRIGGAPTLFMASRPFGRPELYVPSGPILY |
| Ga0307468_1002639541 | 3300031740 | Hardwood Forest Soil | MRVPGACASLLEALVSSGFRLGDPTLFMASRLFGRPELYLPSRPILY |
| Ga0307475_106633863 | 3300031754 | Hardwood Forest Soil | TAAAGAGGEGSVTIRVPGACASLLEALVSCGFRIGAPTLFMASRVFGRPELYLRSGPIFY |
| Ga0318521_105175122 | 3300031770 | Soil | AASGGRSVTARVPGACTSLLQALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0318566_101174341 | 3300031779 | Soil | GASGGRSVTARVPGACTSLLEALVGCGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0318497_103785792 | 3300031805 | Soil | LLLETLVRCGFRLGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0307473_109777682 | 3300031820 | Hardwood Forest Soil | MRVPGACTSLLEALVSCGFRLGVPTLFMASRVFGRPELYLPSGPILY |
| Ga0318495_103485871 | 3300031860 | Soil | RSVTARVPGACTSLLQALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0318533_104700981 | 3300032059 | Soil | PGACTSLLQALVGSGFRIGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0307470_100558253 | 3300032174 | Hardwood Forest Soil | VTIRVPGACASLLQALVGSGFRIGNPTLFMASRLFGRPELYLPSGPILY |
| Ga0307471_1005365552 | 3300032180 | Hardwood Forest Soil | EALVSCGFRIGAPTLFMASRLFGRPELYVPSGPILY |
| Ga0307471_1009999433 | 3300032180 | Hardwood Forest Soil | ASLLQALVGSGFRIGNPTLFMASRLFGRPELYLPSGPILY |
| Ga0307471_1021894582 | 3300032180 | Hardwood Forest Soil | RVPGACASLLEALVGCGFRIGDLAVFLASRPFGRPELYLPSGPILY |
| Ga0307471_1032982871 | 3300032180 | Hardwood Forest Soil | CASLLEALVSCGFRLGDPTLFMASRLFGRPELYLPSGPILY |
| Ga0334722_111498722 | 3300033233 | Sediment | EALVASGFGIGEPTLFMASRLFGRPELYVPSGPILY |
| Ga0247829_106404361 | 3300033550 | Soil | SLLEALVGCGFRIGELAVFLASRPFGRPELYLPSGPILY |
| ⦗Top⦘ |