


| Basic Information | |
|---|---|
| Family ID | F025548 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 201 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QCAGLNRHEAEEEEASRERTSDPLGPEFCVGHREVHGEA |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 201 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.04 % |
| % of genes near scaffold ends (potentially truncated) | 95.52 % |
| % of genes from short scaffolds (< 2000 bps) | 88.56 % |
| Associated GOLD sequencing projects | 177 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.607 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.945 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.881 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 0.00% Coil/Unstructured: 89.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 201 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 25.37 |
| PF13305 | TetR_C_33 | 1.49 |
| PF02371 | Transposase_20 | 1.00 |
| PF07676 | PD40 | 1.00 |
| PF13545 | HTH_Crp_2 | 0.50 |
| PF00072 | Response_reg | 0.50 |
| PF07729 | FCD | 0.50 |
| PF01548 | DEDD_Tnp_IS110 | 0.50 |
| PF04041 | Glyco_hydro_130 | 0.50 |
| PF00196 | GerE | 0.50 |
| PF13432 | TPR_16 | 0.50 |
| PF03551 | PadR | 0.50 |
| PF00872 | Transposase_mut | 0.50 |
| PF00069 | Pkinase | 0.50 |
| PF07366 | SnoaL | 0.50 |
| PF12706 | Lactamase_B_2 | 0.50 |
| PF00144 | Beta-lactamase | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 201 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.99 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.49 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.50 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.50 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.50 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.50 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.50 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.50 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.50 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.50 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.61 % |
| Unclassified | root | N/A | 21.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918024|NODE_396321_length_607_cov_6.070840 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1045617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10095637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1058309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10081429 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300000909|JGI12488J12863_108151 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300001089|JGI12683J13190_1005343 | Not Available | 1456 | Open in IMG/M |
| 3300001108|JGI12647J13326_100766 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300001137|JGI12637J13337_1001313 | Not Available | 1960 | Open in IMG/M |
| 3300001141|JGI12638J13249_102092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300001143|JGI12687J13287_101510 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300001164|JGI11823J13286_1020228 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300001356|JGI12269J14319_10054863 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
| 3300001546|JGI12659J15293_10049891 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300001593|JGI12635J15846_10584568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300001867|JGI12627J18819_10046566 | Not Available | 1812 | Open in IMG/M |
| 3300001867|JGI12627J18819_10268407 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100916739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300002671|Ga0005481J37269_105643 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300002678|Ga0005477J37265_111365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300002886|JGI25612J43240_1003092 | Not Available | 2172 | Open in IMG/M |
| 3300002911|JGI25390J43892_10024801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1446 | Open in IMG/M |
| 3300003370|JGI26337J50220_1036687 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10113253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300004153|Ga0063455_100162216 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300004465|Ga0068944_1144586 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300004467|Ga0068978_1228005 | Not Available | 1768 | Open in IMG/M |
| 3300004477|Ga0068971_1525936 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300004503|Ga0068981_1121442 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300004803|Ga0058862_12850857 | Not Available | 604 | Open in IMG/M |
| 3300005103|Ga0066813_1014861 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005161|Ga0066807_1001573 | Not Available | 1698 | Open in IMG/M |
| 3300005162|Ga0066814_10081142 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005171|Ga0066677_10458407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300005177|Ga0066690_10448513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300005332|Ga0066388_102726291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300005332|Ga0066388_105473578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005332|Ga0066388_106453686 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005434|Ga0070709_11327988 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005435|Ga0070714_101039618 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005446|Ga0066686_10607581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300005447|Ga0066689_10988535 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005471|Ga0070698_101414274 | Not Available | 646 | Open in IMG/M |
| 3300005534|Ga0070735_10499615 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005536|Ga0070697_101626777 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005539|Ga0068853_100954338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300005557|Ga0066704_10310817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300005559|Ga0066700_10216841 | Not Available | 1327 | Open in IMG/M |
| 3300005574|Ga0066694_10542795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300005598|Ga0066706_10668372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300005598|Ga0066706_10952730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 665 | Open in IMG/M |
| 3300005610|Ga0070763_10534580 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005712|Ga0070764_10039567 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300005764|Ga0066903_105931656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300005944|Ga0066788_10083947 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006046|Ga0066652_101399013 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006047|Ga0075024_100187821 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006059|Ga0075017_100852931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 706 | Open in IMG/M |
| 3300006086|Ga0075019_10362478 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300006175|Ga0070712_100387554 | Not Available | 1152 | Open in IMG/M |
| 3300006176|Ga0070765_100066072 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
| 3300006572|Ga0074051_10005145 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006573|Ga0074055_11003280 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006576|Ga0074047_11919767 | Not Available | 547 | Open in IMG/M |
| 3300006579|Ga0074054_11929430 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300006581|Ga0074048_10028370 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006796|Ga0066665_10312294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300006796|Ga0066665_11025177 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006800|Ga0066660_10296541 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300006860|Ga0063829_1461361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300006893|Ga0073928_10390382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300006904|Ga0075424_100030924 | All Organisms → cellular organisms → Bacteria | 5542 | Open in IMG/M |
| 3300009029|Ga0066793_10180671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300009522|Ga0116218_1024603 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2686 | Open in IMG/M |
| 3300009616|Ga0116111_1091556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300009700|Ga0116217_10074338 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2376 | Open in IMG/M |
| 3300009839|Ga0116223_10240944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300010048|Ga0126373_10542448 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1210 | Open in IMG/M |
| 3300010048|Ga0126373_10561981 | Not Available | 1190 | Open in IMG/M |
| 3300010086|Ga0127496_1102221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300010147|Ga0126319_1014261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300010154|Ga0127503_10590265 | Not Available | 783 | Open in IMG/M |
| 3300010358|Ga0126370_10357006 | Not Available | 1183 | Open in IMG/M |
| 3300010362|Ga0126377_10375955 | Not Available | 1425 | Open in IMG/M |
| 3300010366|Ga0126379_11232316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300010373|Ga0134128_10179326 | Not Available | 2390 | Open in IMG/M |
| 3300010376|Ga0126381_104195959 | Not Available | 559 | Open in IMG/M |
| 3300010398|Ga0126383_12148148 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010403|Ga0134123_12321669 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010858|Ga0126345_1030106 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010859|Ga0126352_1280405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300010866|Ga0126344_1285759 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300011039|Ga0138593_130519 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300011077|Ga0138572_1023940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300011081|Ga0138575_1084306 | Not Available | 1848 | Open in IMG/M |
| 3300011090|Ga0138579_1067958 | Not Available | 1911 | Open in IMG/M |
| 3300011120|Ga0150983_12148320 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300011120|Ga0150983_14395637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300011120|Ga0150983_15678307 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012176|Ga0153952_1073000 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012209|Ga0137379_10086457 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
| 3300012357|Ga0137384_10430490 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300012362|Ga0137361_11951823 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012929|Ga0137404_10502574 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300012971|Ga0126369_10170905 | Not Available | 2066 | Open in IMG/M |
| 3300014489|Ga0182018_10076136 | Not Available | 1996 | Open in IMG/M |
| 3300014657|Ga0181522_10417694 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300014839|Ga0182027_10641498 | Not Available | 1134 | Open in IMG/M |
| 3300014839|Ga0182027_11483010 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300016445|Ga0182038_10215026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1523 | Open in IMG/M |
| 3300016730|Ga0181515_1068361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300017926|Ga0187807_1293783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017942|Ga0187808_10050891 | Not Available | 1753 | Open in IMG/M |
| 3300017943|Ga0187819_10053951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2386 | Open in IMG/M |
| 3300017948|Ga0187847_10798409 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300017970|Ga0187783_10715027 | Not Available | 723 | Open in IMG/M |
| 3300018006|Ga0187804_10026437 | Not Available | 2158 | Open in IMG/M |
| 3300018024|Ga0187881_10295004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300018043|Ga0187887_10286371 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300018057|Ga0187858_10520502 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300019877|Ga0193722_1075513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300020022|Ga0193733_1090754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300020579|Ga0210407_10212490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1504 | Open in IMG/M |
| 3300021086|Ga0179596_10094995 | Not Available | 1344 | Open in IMG/M |
| 3300021088|Ga0210404_10002428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7684 | Open in IMG/M |
| 3300021168|Ga0210406_10612544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 848 | Open in IMG/M |
| 3300021478|Ga0210402_10475265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii → Sinorhizobium fredii USDA 257 | 1161 | Open in IMG/M |
| 3300021478|Ga0210402_10478097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300021559|Ga0210409_10401491 | Not Available | 1226 | Open in IMG/M |
| 3300021559|Ga0210409_10933548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 742 | Open in IMG/M |
| 3300021560|Ga0126371_10241484 | Not Available | 1917 | Open in IMG/M |
| 3300021560|Ga0126371_10292635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1753 | Open in IMG/M |
| 3300022523|Ga0242663_1098391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 580 | Open in IMG/M |
| 3300022530|Ga0242658_1140450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300022712|Ga0242653_1016336 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300024179|Ga0247695_1006285 | Not Available | 1696 | Open in IMG/M |
| 3300025442|Ga0208034_1067972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300025916|Ga0207663_11381926 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026088|Ga0207641_12286026 | Not Available | 540 | Open in IMG/M |
| 3300026315|Ga0209686_1115139 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300026360|Ga0257173_1001381 | Not Available | 1981 | Open in IMG/M |
| 3300026377|Ga0257171_1064679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300026523|Ga0209808_1170487 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300026721|Ga0208841_102247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300026880|Ga0209623_1002046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 3300026894|Ga0207980_1001005 | Not Available | 1728 | Open in IMG/M |
| 3300026995|Ga0208761_1004547 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300027061|Ga0209729_1014958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 909 | Open in IMG/M |
| 3300027502|Ga0209622_1042749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300027523|Ga0208890_1002320 | Not Available | 2034 | Open in IMG/M |
| 3300027560|Ga0207981_1035439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300027669|Ga0208981_1014978 | Not Available | 1970 | Open in IMG/M |
| 3300027696|Ga0208696_1044797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1564 | Open in IMG/M |
| 3300027748|Ga0209689_1199194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300027879|Ga0209169_10030515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2865 | Open in IMG/M |
| 3300027905|Ga0209415_10196210 | Not Available | 1916 | Open in IMG/M |
| 3300028665|Ga0302160_10063451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300028789|Ga0302232_10511443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 590 | Open in IMG/M |
| 3300028792|Ga0307504_10387718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300028884|Ga0307308_10327781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300029913|Ga0311362_10049123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6430 | Open in IMG/M |
| 3300029939|Ga0311328_10881483 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300029952|Ga0311346_11308258 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300029983|Ga0302284_1122245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300029989|Ga0311365_10086384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2679 | Open in IMG/M |
| 3300030002|Ga0311350_10992542 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300030044|Ga0302281_10147034 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300030053|Ga0302177_10308809 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300030114|Ga0311333_10859691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300030294|Ga0311349_10672072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300030399|Ga0311353_10836647 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300030518|Ga0302275_10097430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1981 | Open in IMG/M |
| 3300030524|Ga0311357_10161559 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300030598|Ga0210287_1110162 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300030646|Ga0302316_10468482 | Not Available | 504 | Open in IMG/M |
| 3300030659|Ga0316363_10050997 | Not Available | 1977 | Open in IMG/M |
| 3300030707|Ga0310038_10069722 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1916 | Open in IMG/M |
| 3300030759|Ga0265745_1007563 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300030993|Ga0308190_1084552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300031344|Ga0265316_10736124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300031469|Ga0170819_11732705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300031525|Ga0302326_12413881 | Not Available | 663 | Open in IMG/M |
| 3300031724|Ga0318500_10164738 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031724|Ga0318500_10200222 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300031771|Ga0318546_10594131 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031777|Ga0318543_10575447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 505 | Open in IMG/M |
| 3300031788|Ga0302319_10840051 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300031880|Ga0318544_10366230 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300032025|Ga0318507_10241540 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300032039|Ga0318559_10334561 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300032059|Ga0318533_10542802 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300032160|Ga0311301_10056733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8717 | Open in IMG/M |
| 3300032160|Ga0311301_10238443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3025 | Open in IMG/M |
| 3300032782|Ga0335082_10191624 | Not Available | 1948 | Open in IMG/M |
| 3300032828|Ga0335080_10283693 | Not Available | 1802 | Open in IMG/M |
| 3300032954|Ga0335083_11130395 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300033402|Ga0326728_10212529 | Not Available | 1920 | Open in IMG/M |
| 3300033433|Ga0326726_10617525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300033513|Ga0316628_100161964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.98% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.49% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.99% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.50% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.50% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.50% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.50% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001108 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001143 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002671 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF130 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002678 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF126 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004465 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004467 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004503 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026721 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN395 (SPAdes) | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026894 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029983 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B_all_v_01900840 | 2140918024 | Soil | CAGINRQEAEDEKSLRERSSDPLGPEFCSVCREVQGEA |
| AF_2010_repII_A01DRAFT_10456172 | 3300000580 | Forest Soil | KSGLQCAGLNRHEAEEEEASRERSSDPLGPEFCVGHREVHGEA* |
| AF_2010_repII_A1DRAFT_100956372 | 3300000597 | Forest Soil | GLQCAGLNRHEAEEEEASRERSSDPLGPEFCXGHREVHGEA* |
| AF_2010_repII_A100DRAFT_10583091 | 3300000655 | Forest Soil | VVTSRLQCAGLNRHEAEEEEASRERSSDPLGPEFCVGHREVHGEA* |
| AF_2010_repII_A001DRAFT_100814291 | 3300000793 | Forest Soil | KSGLQCAGLNRHEAENAKFLRERTSDLLGPEFCAGHREVHGEA* |
| JGI12488J12863_1081511 | 3300000909 | Tropical Forest Soil | EVRLCAGINRHEVENERVLRERSSDPLGPEFCAGYREVHSEA* |
| JGI12683J13190_10053433 | 3300001089 | Forest Soil | QLGGVKQIVDVISSFQCAGINRHEAEDERALRERSSDPLGLESCVGYREVLSEA* |
| JGI12647J13326_1007661 | 3300001108 | Forest Soil | GGVKQIVDVISSFQCAGINRHEAEDERALRERSSDPLGLESCVGYREVLSEA* |
| JGI12637J13337_10013131 | 3300001137 | Forest Soil | SRFQCAGINRHEAEDERALRERSSDPLGLESCVGYREVLSEA* |
| JGI12638J13249_1020922 | 3300001141 | Forest Soil | TVVDVKSPLQCAGLNRHEAEEEEALRERTSDPLGPEFCAGHREVHGEA* |
| JGI12687J13287_1015101 | 3300001143 | Forest Soil | TGLTSRLQCAGLNRLEVEDESSLRERSSDPLGLESCAGYREVLSEA* |
| JGI11823J13286_10202282 | 3300001164 | Forest Soil | TQCAGINRHEAGNERVLRERSSEPLGPEFCVAHREVFGEA* |
| JGI12269J14319_100548631 | 3300001356 | Peatlands Soil | CAGINRHEAENAKFSRVRISDPLGPEFALGYREVHSEA* |
| JGI12659J15293_100498912 | 3300001546 | Forest Soil | MNRHEAEDESSLRERSSDPLGLESCAGYREVLSEA* |
| JGI12635J15846_105845682 | 3300001593 | Forest Soil | AGINRHEAENAKFLRVRSSDPLGPEFCVGYREVQGEA* |
| JGI12627J18819_100465661 | 3300001867 | Forest Soil | GMNRHEAEEEESSRERSSDPLGPELRESYREVGREA* |
| JGI12627J18819_102684072 | 3300001867 | Forest Soil | VCAGINRHGVEDERALRERSSDPLGPEFCAGRCEVSSEA* |
| JGIcombinedJ26739_1009167392 | 3300002245 | Forest Soil | MLAKNQFQCAGINRHEAEDERALRERSSDPLGLESCVGYREVLSEA* |
| Ga0005481J37269_1056431 | 3300002671 | Forest Soil | LLRCAGINRHEAEDESSLRERSSDPLGLETCAGYREVLSEA* |
| Ga0005477J37265_1113651 | 3300002678 | Forest Soil | QCAGINRYEAGVEETPRERNSDPLGPEFCVGYREVHSEA* |
| JGI25612J43240_10030923 | 3300002886 | Grasslands Soil | PSQCAGINRHEVEDERALRERSSDPLGLESCAGYREVLSEA* |
| JGI25390J43892_100248013 | 3300002911 | Grasslands Soil | GEKSPLQCAGINRQEAENAKFSRVRSSDPLGPEFCAGYREVHGEA* |
| JGI26337J50220_10366871 | 3300003370 | Bog Forest Soil | TRPDMSAGINRHEAGNERFLRERSSEPLGPEFCAVYREVHGEA* |
| JGIcombinedJ51221_101132532 | 3300003505 | Forest Soil | MVVDDKSPLQCAGINRYEAGVEETPRERNSDPLGPEFCVGYREVHSEA* |
| Ga0063455_1001622161 | 3300004153 | Soil | QKKSWVCAGINRHGVEDERALRERSSDPLGPEFCIGFREVSSEA* |
| Ga0068944_11445861 | 3300004465 | Peatlands Soil | RRAALSDVSRRLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA* |
| Ga0068978_12280051 | 3300004467 | Peatlands Soil | QCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA* |
| Ga0068971_15259361 | 3300004477 | Peatlands Soil | LQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA* |
| Ga0068981_11214422 | 3300004503 | Peatlands Soil | QNGLSVEIRPLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA* |
| Ga0058862_128508571 | 3300004803 | Host-Associated | LCAGINRHEVENVRVLRERSSDPLGPEFCVGHREVNDEA* |
| Ga0066813_10148611 | 3300005103 | Soil | QCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066807_10015732 | 3300005161 | Soil | VGEKSPLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066814_100811421 | 3300005162 | Soil | PLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066677_104584071 | 3300005171 | Soil | QCAGLNRHEAEEEEASRERTSDPLGPEFCVGHREVHGEA* |
| Ga0066690_104485132 | 3300005177 | Soil | SPLQCAGINRQEAENAKFSRVRSSDPLGPEFCAGYREVHGEA* |
| Ga0066388_1027262911 | 3300005332 | Tropical Forest Soil | RFMCAGINRHEAENENFLRERSSEPLGPERCVGHRVVHGEA* |
| Ga0066388_1054735782 | 3300005332 | Tropical Forest Soil | VIVGEKSPYQCAGLNRHEAENAKFLRERISDPLGPEFCARHREVQGEA* |
| Ga0066388_1064536861 | 3300005332 | Tropical Forest Soil | LSWNQLQCAGLNRHEAEEEEASRERSSDPLGPEFCVGHREVHGEA* |
| Ga0070709_113279881 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RLQCAGVNRHEAEEEESLRERSSEPLGPEFCSGHREVLAEA* |
| Ga0070714_1010396182 | 3300005435 | Agricultural Soil | NSWVCAGINRHGAEDERALRERSSDPLGPEFCAGRCEVSSEA* |
| Ga0066686_106075812 | 3300005446 | Soil | LQCAGINRQEAENAKFSRVRSSDPLGPEFCAGYREVHGEA* |
| Ga0066689_109885352 | 3300005447 | Soil | LCAGINRHEVENERVLRERSSDPLGPEFCAGCREADGEA* |
| Ga0070707_1022346641 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNTEVGKQAFPRSVDEKSPMQCAGINRHEAGNERVLRERSSEPLGPEFCVAHREVFGEA |
| Ga0070698_1014142741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TLCAGINRHEAEDERALRERSSDPLGPEFCTGHREVHSEA* |
| Ga0070735_104996151 | 3300005534 | Surface Soil | MIGETSPLQCAGLNRHEAENAKFSRERISDLLGPEFCVVHREVH |
| Ga0070697_1016267772 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QCAGLNRHEAEEEEASRERTSDPLGPEFCTGHREVLGEA* |
| Ga0068853_1009543382 | 3300005539 | Corn Rhizosphere | VSRYFGITVETSPLQCAGLNRHGVEDERALRERNSDPLGLESCAGYREVHSEA* |
| Ga0066704_103108171 | 3300005557 | Soil | MSIGVTSPLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVH |
| Ga0066700_102168412 | 3300005559 | Soil | KSPLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066694_105427952 | 3300005574 | Soil | ASVCASIWISEAVTDEKSLLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066706_106683721 | 3300005598 | Soil | CAGINRHEAENGKFLRVRSSDPLGPEFCVGYREVHGEA* |
| Ga0066706_109527302 | 3300005598 | Soil | QCAGINRHEAGNERVLRERSSEPLGPEFCVAHREVFGEA* |
| Ga0070763_105345801 | 3300005610 | Soil | CAGINRHEAGNERFLRERSSEPLGPEFCAVYREVHGEA* |
| Ga0070764_100395671 | 3300005712 | Soil | PLQCAGINRHEAEDESSLRERSSDPLGLESCAGYREVLSEA* |
| Ga0066903_1059316562 | 3300005764 | Tropical Forest Soil | LQCAGLNRHEAENAKFLRERISDPLGPEFCAGHRKVHGEA* |
| Ga0066788_100839471 | 3300005944 | Soil | FQCAGINRHEAEEEEVSRERTSDPLGPEFCVRHREVHDEA* |
| Ga0066652_1013990132 | 3300006046 | Soil | QCAGLNRHEAEEEEASRGRTSDPLGPEFCAGHREVHGEA* |
| Ga0075024_1001878213 | 3300006047 | Watersheds | QCAGINRHEAEDESSLRERSSDPLGLESCAGYREVLSEA* |
| Ga0075017_1008529311 | 3300006059 | Watersheds | CAGINRHEAEDERALRERSSDPLGLESCAGYREVLSEA* |
| Ga0075019_103624781 | 3300006086 | Watersheds | NRHEAGEEESLRERSSEPLGPEFCVMHREVYYEA* |
| Ga0070712_1003875541 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | CAGINRHEAEDESSLRERSSDPLGLESCAGYREVLSEA* |
| Ga0070765_1000660724 | 3300006176 | Soil | LCAGLNRLEAENGKFSRERTSDLLGPESCTWYREVHSEA* |
| Ga0074051_100051451 | 3300006572 | Soil | LQCAGLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0074055_110032802 | 3300006573 | Soil | QCAGLNRHEAEEEEASRERTSDSLGPEFCVGYREVHDEA* |
| Ga0074047_119197671 | 3300006576 | Soil | LQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0074054_119294301 | 3300006579 | Soil | SPLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0074048_100283702 | 3300006581 | Soil | EKSPFQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066665_103122941 | 3300006796 | Soil | MVYVTSPFQCAGLNRHEAEEEEASRERTSDPLGPEFCVGYRE |
| Ga0066665_110251771 | 3300006796 | Soil | GLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0066660_102965413 | 3300006800 | Soil | MCCGIAWRSIDEKSPLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREV |
| Ga0063829_14613611 | 3300006860 | Peatlands Soil | INRQEAENENFSREGSSDPLGPEFCAGRREAHSEA* |
| Ga0073928_103903822 | 3300006893 | Iron-Sulfur Acid Spring | QCAGINRHEAEDESSLRERSSDPLGLESCAGYREVHNEA* |
| Ga0075424_1000309241 | 3300006904 | Populus Rhizosphere | MIGDKSPYQCAGLNRHEAENAKFLRERTSDLLGPEVCAGHREVHGEA* |
| Ga0066793_101806711 | 3300009029 | Prmafrost Soil | MVVETSRLQCAGLNRHEVGVEETLQERISDPLGPEFCVGHREVQSEA |
| Ga0116218_10246033 | 3300009522 | Peatlands Soil | MSTDANRPLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHR |
| Ga0116111_10915562 | 3300009616 | Peatland | QCAGINRHEAENGKFLRVRSSDPLGPEFCVGYREVHGEA* |
| Ga0116217_100743384 | 3300009700 | Peatlands Soil | MSTDANRPLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHG |
| Ga0116223_102409442 | 3300009839 | Peatlands Soil | MVYVSRRLQCAGLNRHEVEDERALRERNSDPLGLESCAGYREV |
| Ga0126373_105424482 | 3300010048 | Tropical Forest Soil | RLQCAGLNRHEAENEKFLRERISDPLGPEFCDGHREVHGEA* |
| Ga0126373_105619812 | 3300010048 | Tropical Forest Soil | AGLNRYEAENAKFLRERISDLLGPEFCAGHREVHGEA* |
| Ga0127496_11022212 | 3300010086 | Grasslands Soil | LNRHEAEEEEASREKTSDPLGPEFCVGHREVHDEA* |
| Ga0126319_10142611 | 3300010147 | Soil | RRLQCAGINRHEAEDESSLRERSSDPLGLESCVGYREVLIEA* |
| Ga0127503_105902651 | 3300010154 | Soil | WEPTLLWNQLQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0126370_103570061 | 3300010358 | Tropical Forest Soil | NRHEVEEEESLRERTSEPLGPEFCTGHREALGEA* |
| Ga0126377_103759551 | 3300010362 | Tropical Forest Soil | LQCAGLNRHEAENAKFLRERTSDLLGPEFCAGHREVHGEA* |
| Ga0126379_112323161 | 3300010366 | Tropical Forest Soil | YQCAGLNRHEAENAKFLRERISDPLGPEFCVGHREVHDEA* |
| Ga0134128_101793261 | 3300010373 | Terrestrial Soil | QCAGLNRHEAENARFLRGRTSDLLGPEFCVGYREVQGEA* |
| Ga0126381_1041959591 | 3300010376 | Tropical Forest Soil | QYAGINRHETEEEEASRETTSDPLGPEFSVVHREVHGEV* |
| Ga0126383_121481481 | 3300010398 | Tropical Forest Soil | INRHEAEEEESLRERTSEPLGPEFCTGHREALGEA* |
| Ga0134123_123216691 | 3300010403 | Terrestrial Soil | AGMNRHGVEDERALRERISDPLGPEFCIGFREVSSEA* |
| Ga0126345_10301061 | 3300010858 | Boreal Forest Soil | AGINRHEAGNARVLRERSSEPLGPEFCVVHREVYGEA* |
| Ga0126352_12804051 | 3300010859 | Boreal Forest Soil | AGMNRHEAENAKFLRVRSSDPLGPEFCVGYREVRGEA* |
| Ga0126344_12857592 | 3300010866 | Boreal Forest Soil | GYLCAGLNRLEAENGKFLRERTSDLLGPESCTGYREVHSEA* |
| Ga0138593_1305191 | 3300011039 | Peatlands Soil | NRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA* |
| Ga0138572_10239401 | 3300011077 | Peatlands Soil | NRHEAEEEEALRERTSDPLGPEFCVGHREVHDEA* |
| Ga0138575_10843062 | 3300011081 | Peatlands Soil | LNRHEAEEEEALRERTSDPLGPEFCVGHREMHGEA* |
| Ga0138579_10679582 | 3300011090 | Peatlands Soil | CAGLNRHEAEEEEALRERTSDPLGPEFCVGHREMHGEA* |
| Ga0150983_121483201 | 3300011120 | Forest Soil | KVNSCAGINRHEVEDERVSRERASDPLGPEFCVGHREVHSEA* |
| Ga0150983_143956371 | 3300011120 | Forest Soil | INRHEAENAKFLRVRSSDPLGPEFCVGYREVHDEA* |
| Ga0150983_156783071 | 3300011120 | Forest Soil | AGLNRHGIEDERALRERSSEPLGPEFCTEHREALGEA* |
| Ga0153952_10730002 | 3300012176 | Attine Ant Fungus Gardens | CAGINRHEAGNERFLRERSSEPLGPEFCAVHREVHGEA* |
| Ga0137379_100864571 | 3300012209 | Vadose Zone Soil | QCAGLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0137384_104304901 | 3300012357 | Vadose Zone Soil | AGLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA* |
| Ga0137361_119518231 | 3300012362 | Vadose Zone Soil | NRYEAGVEETLRERTSDSLGPEFCVGYREVHSEA* |
| Ga0137404_105025741 | 3300012929 | Vadose Zone Soil | QCAGINRHEAEDESSLRERSSDPLGLESCAGYREVPSEA* |
| Ga0126369_101709051 | 3300012971 | Tropical Forest Soil | QCAGLNRHEVEEEESLRERTSEPLGPEFCTGHREALGEA* |
| Ga0182018_100761361 | 3300014489 | Palsa | LQCAGLNRHEAENEKFLRVRSSDPLGPEFCVGYREVHGEA* |
| Ga0181522_104176941 | 3300014657 | Bog | NRQEAEDEKSSRERSSEPLGPEFCVGHREVHGEA* |
| Ga0182027_106414982 | 3300014839 | Fen | SPESIEAKSLLQCAGINRHEVENARVSRERGSDPLGPEFSAGHREVHSEA* |
| Ga0182027_114830101 | 3300014839 | Fen | CAGLNRLEAENGKFLRERTSDLLGPESCTGYREVHSEA* |
| Ga0182038_102150261 | 3300016445 | Soil | MVTLCAGINRHEVENARVLRARISDPLGPEFCVGHREVHDE |
| Ga0181515_10683611 | 3300016730 | Peatland | GDSCAGINRHEAENAKVLRERNSDPLGPEFCVGYREVHSEA |
| Ga0187807_12937831 | 3300017926 | Freshwater Sediment | DAVNTIDVAKSPYQCAGINRHEAEAERALRERSSDPLGPEFCVGYREVHSEA |
| Ga0187808_100508912 | 3300017942 | Freshwater Sediment | QCAGVNRHEAEEEESLRVRTSEPLGPEFCTGHREVLGEA |
| Ga0187819_100539514 | 3300017943 | Freshwater Sediment | AIVDAKSPLQCAGLNRHEAEEVEASRERTSDLLGPEFCVEHREVHGEA |
| Ga0187847_107984092 | 3300017948 | Peatland | CAGLNRHEVEDERALRERISEPLGPEFCAVFREDQGEA |
| Ga0187783_107150271 | 3300017970 | Tropical Peatland | VVVVERSPFQSAGINRHEAEEEESLRVRTSDPLGPESCGVAREG |
| Ga0187804_100264371 | 3300018006 | Freshwater Sediment | QCAGLNRHEAEAEEASRERTSDPLGPEFCVGHREVHGEA |
| Ga0187881_102950041 | 3300018024 | Peatland | NSCAGINRHEAENARVSRERASDPLGPEFCVGHREVHGEA |
| Ga0187887_102863712 | 3300018043 | Peatland | LQCAGLNRLEVEDARALRERSSDPLGLESCTGYREVFSEA |
| Ga0187858_105205021 | 3300018057 | Peatland | GNSCAGINRHEVENARVSRERASDPLGPEFCAGYREVHGKA |
| Ga0193722_10755131 | 3300019877 | Soil | GQCAGINRYEAGVEETPRERSSDPLGPEFCVGYREVHSEA |
| Ga0193733_10907541 | 3300020022 | Soil | EKAPLQCAGINRHEAENAKFLRVRSSDPLGPEFCVGYREVHDEA |
| Ga0210407_102124901 | 3300020579 | Soil | KKSPLQCAGINRHEAENAKFLRVRSSDPLGPEFCVGYREVHDEA |
| Ga0179596_100949951 | 3300021086 | Vadose Zone Soil | RKQALQCAGINRHEAEDESSLRERSSDPLGLESCAGYREVLSEA |
| Ga0210404_100024281 | 3300021088 | Soil | MIGEKSRLQCAGINRYEAGVEETPRERNSDPLGPEFCVGYREVHSEA |
| Ga0210406_106125443 | 3300021168 | Soil | VAKPLLRCAGINRHEAEDESSLRERSSDPLGLETCAGYREVLSEA |
| Ga0210402_104752651 | 3300021478 | Soil | VIESLQCAGINRYEAGVEETPRERNSDPLGPEFCVGYREVHSEA |
| Ga0210402_104780971 | 3300021478 | Soil | SPLQCAGINRHEAGVEETLQERTSDPLGPEFCVVHREVHSEA |
| Ga0210409_104014911 | 3300021559 | Soil | LRCAGLNRHEAEEEEALRERTSDPLGPEFCVGHREVHDEA |
| Ga0210409_109335481 | 3300021559 | Soil | GLNRHEAGNERVLRERSSEPLGPEFCVAHREVFGAA |
| Ga0126371_102414842 | 3300021560 | Tropical Forest Soil | LQCAGLNRHEVEEEESLRERTSEPLGPEFCTGHREALGEA |
| Ga0126371_102926353 | 3300021560 | Tropical Forest Soil | MIAEKSPLQCAGLNRHEAENAKFLRERTSDLLGPEFCAGHREVHGE |
| Ga0213853_101572281 | 3300021861 | Watersheds | GINRYEAGVEETLRERTSDPFGPESCADSREGVSEA |
| Ga0242663_10983912 | 3300022523 | Soil | LNRHEAEEEEASRERTSDPLGPEFCAGHREMHSEA |
| Ga0242658_11404501 | 3300022530 | Soil | GLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA |
| Ga0242653_10163362 | 3300022712 | Soil | LRSVRCAGINRHEAGNERFLRERSSEPLGPEFCAVYREVHGEA |
| Ga0247695_10062852 | 3300024179 | Soil | SSLQCAGLNRLEVEDESSLGERSSDPLGLESCAGYREVLNEA |
| Ga0208034_10679721 | 3300025442 | Peatland | QCAGINRHEAENGKFLRVRSSDPLGPEFCVGYREVHGEA |
| Ga0207663_113819262 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | CAGLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA |
| Ga0207641_122860262 | 3300026088 | Switchgrass Rhizosphere | CAGINRHEVENARVLRERSSDPPGPEFALRYREVHCEA |
| Ga0209686_11151391 | 3300026315 | Soil | GLNRHEAEEEEASRERTSDPLGPEFCVGYREIHDEA |
| Ga0257173_10013812 | 3300026360 | Soil | TLSWNQLQCAGLNRHEAEEEEASRERTSDPLGPEFCAGHREMHSEA |
| Ga0257171_10646791 | 3300026377 | Soil | GLNRYEAGVEETLRERTSDSLGPEFCVGYREVHSEA |
| Ga0209808_11704872 | 3300026523 | Soil | VTSPFQCAGLNRHEAEEEEASRERTSDPLGPEFCVGYREIHDEA |
| Ga0208841_1022471 | 3300026721 | Soil | PFQCAGINRHEAENAKFLRVRSSDPLGPEFCVGYREVHDEA |
| Ga0209623_10020461 | 3300026880 | Forest Soil | NLAIGEKSRLRCAGINRHEAEDERASRERSSDPLGLESCAGYREVLSEA |
| Ga0207980_10010051 | 3300026894 | Soil | WLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA |
| Ga0208761_10045472 | 3300026995 | Soil | VVVGEKSPLQCAGLNRLEAEEEEASRERTSDSLGPEFCVGYREVHDEA |
| Ga0209729_10149581 | 3300027061 | Forest Soil | DETRRLQCAGINRHEAEEEESLRVRTSEPLGPEFCTWHREVFGEA |
| Ga0209622_10427492 | 3300027502 | Forest Soil | TVVDVKSPLQCAGLNRHEAEEEEALRERTSDPLGPEFCAGHREVHGEA |
| Ga0208890_10023201 | 3300027523 | Soil | FSIDVTSRLQCAGLNRLEAEEEEASRERTSDSLGPEFCVGYREVHDEA |
| Ga0207981_10354391 | 3300027560 | Soil | DKSRFQCAGLNRHEAEEEEASRERTSDPLGPEFCVGYREVHDEA |
| Ga0208981_10149781 | 3300027669 | Forest Soil | SGLVQIANACAGLNRHEAGNERVLRERSSEPLGPEFCVAHREVFGEA |
| Ga0208696_10447974 | 3300027696 | Peatlands Soil | SGMGPRSIGEKSRLQCAGLNRHEAEEEEALRERTSDPLGPEFCVGHREVHDEA |
| Ga0209689_11991941 | 3300027748 | Soil | EKSPLQCAGINRQEAENAKFSRVRSSDPLGPEFCAGYREVHGEA |
| Ga0209169_100305153 | 3300027879 | Soil | SFWMVYETRRLQCAGINRHEAEDESSLRERSSDPLGLESCAGYREVLSEA |
| Ga0209415_101962102 | 3300027905 | Peatlands Soil | LQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA |
| Ga0302160_100634512 | 3300028665 | Fen | LLWNQLQCAGINRHEAEEEEASRERTSDPLGPEFCVRHREMHDEA |
| Ga0302232_105114432 | 3300028789 | Palsa | MQCAGINRHEAGNARVLRERSSEPLGPEFCVAHREVFGEA |
| Ga0307504_103877183 | 3300028792 | Soil | LNRYEAGVEETPRERSSDPLGPEFCVGYREVHSEA |
| Ga0307308_103277811 | 3300028884 | Soil | INRHEAENAKFLRVRSSDPLGPEFCVGYREVHNEA |
| Ga0311362_100491231 | 3300029913 | Bog | RLVTVDKSPLQCAGLNRYEAGEEESLRERSSDPLGPEFCAVFREELGEA |
| Ga0311328_108814832 | 3300029939 | Bog | RCSTDLPERLVTVDKSPLQCAGLNRYEAGEEESLRERSSDPLGPEFCAVFREELGEA |
| Ga0311346_113082581 | 3300029952 | Bog | VTVDKSPLQCAGLNRYEAGEEESLRERSSDPLGPEFCAVFREELGEA |
| Ga0302284_11222452 | 3300029983 | Fen | LQCAGINRHEAEEEEASRERTSDPLGPEFCVRHREMHDEA |
| Ga0311365_100863844 | 3300029989 | Fen | TLLWNQLQCAGINRHEAEEEEASRERTSDPLGPEFCVRHREMHDEA |
| Ga0311350_109925422 | 3300030002 | Fen | SPFQCAGLNRHEAEEEEASRERTSDPLGPEFCVRHREVHDEA |
| Ga0302281_101470342 | 3300030044 | Fen | ARLSTGDNRAMQCAGVNRHEAGTERVLRERSSEPLGPEFCVAHREVFDEA |
| Ga0302177_103088092 | 3300030053 | Palsa | PEVSAGINRHEAGNERFLRERSSEPLGPEFCAVHREVQGEA |
| Ga0311333_108596911 | 3300030114 | Fen | VVGAKSPLQCAGINRHEAEEEEASRERTSDPLGPEFCVRHREMHDEA |
| Ga0311349_106720723 | 3300030294 | Fen | PTLLWNQLQCAGINRHEAEEEEASRERTSDPLGPEFCVRHREMHDEA |
| Ga0311353_108366471 | 3300030399 | Palsa | PDMSAGINRHEAGNERFLRERSSEPLGPEFCAVHREVQGEA |
| Ga0302275_100974301 | 3300030518 | Bog | DKSPLQCAGLNRYEAGEEESLRERSSDPLGPEFCAVFREELGEA |
| Ga0311357_101615593 | 3300030524 | Palsa | INRHEAGNERFLRERSSEPLGPEFCAVHREVQGEA |
| Ga0210287_11101621 | 3300030598 | Soil | SILTDMSAGINRHEAGNERFLRERSSEPLGPEFCAVHREVHGEA |
| Ga0302316_104684821 | 3300030646 | Palsa | MSAGINRHEAGNERFLRERSSEPLGPEFCAVHREVQGEA |
| Ga0316363_100509972 | 3300030659 | Peatlands Soil | IDDLTRPLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA |
| Ga0310038_100697221 | 3300030707 | Peatlands Soil | MSTDANRPLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGE |
| Ga0265745_10075631 | 3300030759 | Soil | INRHEAEEEEASRERTSDPLGPEFCVRHREVHDEA |
| Ga0308190_10845521 | 3300030993 | Soil | GINRHEAENAKFLRVRSSDPLGPEFCVGYREVHNEA |
| Ga0265316_107361241 | 3300031344 | Rhizosphere | KSPFQCAGINRHEAEEEEASRERTSDPLGPEFCVRHREVHDEA |
| Ga0170819_117327051 | 3300031469 | Forest Soil | EKSPFQCAGINRHEAGVEETLRERTSDPLGPEFCVVRREVHSEA |
| Ga0302326_124138811 | 3300031525 | Palsa | MSAGINRHEAGNERFLRERSSEPLGPEFCAVHREVQGE |
| Ga0318500_101647382 | 3300031724 | Soil | GINRHEAEEEESSRERTSDPLGPEFCVVHREVHNEA |
| Ga0318500_102002221 | 3300031724 | Soil | LDVLTLCAGINRHEVENARVLRARISDPLGPEFCVGHREVHDEA |
| Ga0318546_105941311 | 3300031771 | Soil | LQCAGLNRHEAEEEEASRERTSDPLGPEFCAGHREVHGEA |
| Ga0318543_105754471 | 3300031777 | Soil | GLNRHEAEEEEASRERTSDPLGPEFCAGHREVHGEA |
| Ga0302319_108400511 | 3300031788 | Bog | ARLSTGDNRAMQCAGVNRHEAGTERVLRERSSEPLGPEFCVAHREVFSEA |
| Ga0318544_103662302 | 3300031880 | Soil | SQLQCAGINRHEAEEEESSRERTSDPLGPEFCVVHREVHNEA |
| Ga0318507_102415401 | 3300032025 | Soil | ITKVLNVRRPKWINSQLQCAGINRHEAEEEESSRERTSDPLGPEFCVVHREVHNEA |
| Ga0318559_103345611 | 3300032039 | Soil | WINSQLQCAGINRHEAEEEESSRERTSDPLGPEFCVVHREVHNEA |
| Ga0318533_105428022 | 3300032059 | Soil | INRHEVENARVSRERTSDSPGPEFCAAHREVHSEA |
| Ga0311301_100567331 | 3300032160 | Peatlands Soil | MFVVEVIRRLQCAGLNRHEAEEEESSRERTSDPLGPEFCVGHREMHGEA |
| Ga0311301_102384432 | 3300032160 | Peatlands Soil | MVYVSRRLQCAGLNRHEVEDERALRERNSDPLGLESCAGYREVHS |
| Ga0335082_101916241 | 3300032782 | Soil | QSAGVNRHEAEEEESLRERSSEPLGPEFCSGHREVLAEA |
| Ga0335080_102836932 | 3300032828 | Soil | DKSRLQSAGVNRHEAEEEESLRERSSEPLGPEFCSGHREVLAEA |
| Ga0335083_111303951 | 3300032954 | Soil | AGVNRHEAEEEESLRERSSEPLGPEFCSGHREVLAEA |
| Ga0326728_102125291 | 3300033402 | Peat Soil | EQCAGINRQEAENENFSRERISDPLGPEFCVACREVRSEA |
| Ga0326726_106175251 | 3300033433 | Peat Soil | CAGLNRHEAEEEEASRERTSDPLGPEFCVGHREVHDEA |
| Ga0316628_1001619643 | 3300033513 | Soil | LIVGVTSPFQCAGLNRLEAEEEEASRERTSDPLGPEFCVGYREVHDEA |
| ⦗Top⦘ |