


| Basic Information | |
|---|---|
| Family ID | F025528 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 201 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDFQQE |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 201 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.01 % |
| % of genes near scaffold ends (potentially truncated) | 70.15 % |
| % of genes from short scaffolds (< 2000 bps) | 96.02 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.746 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.378 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.353 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.73% β-sheet: 0.00% Coil/Unstructured: 60.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 201 Family Scaffolds |
|---|---|---|
| PF01610 | DDE_Tnp_ISL3 | 6.97 |
| PF13340 | DUF4096 | 2.49 |
| PF02371 | Transposase_20 | 1.00 |
| PF13546 | DDE_5 | 1.00 |
| PF13751 | DDE_Tnp_1_6 | 1.00 |
| PF13672 | PP2C_2 | 0.50 |
| PF01796 | OB_aCoA_assoc | 0.50 |
| PF00496 | SBP_bac_5 | 0.50 |
| PF13561 | adh_short_C2 | 0.50 |
| PF01436 | NHL | 0.50 |
| PF04851 | ResIII | 0.50 |
| PF00293 | NUDIX | 0.50 |
| PF14104 | DUF4277 | 0.50 |
| PF00440 | TetR_N | 0.50 |
| PF13586 | DDE_Tnp_1_2 | 0.50 |
| PF14319 | Zn_Tnp_IS91 | 0.50 |
| PF01609 | DDE_Tnp_1 | 0.50 |
| PF12728 | HTH_17 | 0.50 |
| PF00211 | Guanylate_cyc | 0.50 |
| PF12746 | GNAT_acetyltran | 0.50 |
| PF00656 | Peptidase_C14 | 0.50 |
| PF01850 | PIN | 0.50 |
| PF09707 | Cas_Cas2CT1978 | 0.50 |
| PF13614 | AAA_31 | 0.50 |
| PF00239 | Resolvase | 0.50 |
| PF00871 | Acetate_kinase | 0.50 |
| PF00296 | Bac_luciferase | 0.50 |
| PF13384 | HTH_23 | 0.50 |
| PF01526 | DDE_Tnp_Tn3 | 0.50 |
| PF13358 | DDE_3 | 0.50 |
| PF12762 | DDE_Tnp_IS1595 | 0.50 |
| PF11535 | Calci_bind_CcbP | 0.50 |
| PF02518 | HATPase_c | 0.50 |
| PF00069 | Pkinase | 0.50 |
| PF02738 | MoCoBD_1 | 0.50 |
| PF01548 | DEDD_Tnp_IS110 | 0.50 |
| PF02899 | Phage_int_SAM_1 | 0.50 |
| PF00171 | Aldedh | 0.50 |
| PF03466 | LysR_substrate | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 201 Family Scaffolds |
|---|---|---|---|
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 6.97 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.99 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.49 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.50 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.50 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.50 |
| COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 0.50 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.50 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.50 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.50 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.50 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.50 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.50 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.50 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.50 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.50 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.50 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.50 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.50 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.75 % |
| Unclassified | root | N/A | 49.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_10019293 | Not Available | 1517 | Open in IMG/M |
| 3300000890|JGI11643J12802_10528184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1358 | Open in IMG/M |
| 3300000955|JGI1027J12803_100143984 | Not Available | 606 | Open in IMG/M |
| 3300000955|JGI1027J12803_101945865 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1195 | Open in IMG/M |
| 3300000955|JGI1027J12803_103382140 | Not Available | 673 | Open in IMG/M |
| 3300005176|Ga0066679_10916306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica | 551 | Open in IMG/M |
| 3300005180|Ga0066685_10150680 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300005289|Ga0065704_10263847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 940 | Open in IMG/M |
| 3300005289|Ga0065704_10270765 | Not Available | 938 | Open in IMG/M |
| 3300005294|Ga0065705_10023592 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1588 | Open in IMG/M |
| 3300005332|Ga0066388_102761260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica | 897 | Open in IMG/M |
| 3300005332|Ga0066388_104080788 | Not Available | 745 | Open in IMG/M |
| 3300005332|Ga0066388_106564005 | Not Available | 586 | Open in IMG/M |
| 3300005450|Ga0066682_10641586 | Not Available | 661 | Open in IMG/M |
| 3300005536|Ga0070697_101719316 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005536|Ga0070697_101876462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica | 536 | Open in IMG/M |
| 3300005545|Ga0070695_100511167 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005549|Ga0070704_102288533 | Not Available | 503 | Open in IMG/M |
| 3300005552|Ga0066701_10930665 | Not Available | 514 | Open in IMG/M |
| 3300005556|Ga0066707_10046754 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300005713|Ga0066905_101548970 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005764|Ga0066903_103548349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica | 840 | Open in IMG/M |
| 3300005981|Ga0081538_10363414 | Not Available | 523 | Open in IMG/M |
| 3300006046|Ga0066652_101449223 | Not Available | 640 | Open in IMG/M |
| 3300006194|Ga0075427_10006473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1697 | Open in IMG/M |
| 3300006794|Ga0066658_10522327 | Not Available | 646 | Open in IMG/M |
| 3300006794|Ga0066658_10875423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300006797|Ga0066659_10374440 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1112 | Open in IMG/M |
| 3300006844|Ga0075428_100406668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1458 | Open in IMG/M |
| 3300006844|Ga0075428_101800213 | Not Available | 637 | Open in IMG/M |
| 3300006844|Ga0075428_101820736 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006845|Ga0075421_100855982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. JMULE4 | 1041 | Open in IMG/M |
| 3300006847|Ga0075431_101505233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 631 | Open in IMG/M |
| 3300006852|Ga0075433_10497016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1074 | Open in IMG/M |
| 3300006853|Ga0075420_101126925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 675 | Open in IMG/M |
| 3300007255|Ga0099791_10021876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2755 | Open in IMG/M |
| 3300007255|Ga0099791_10105034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1302 | Open in IMG/M |
| 3300007265|Ga0099794_10726859 | Not Available | 529 | Open in IMG/M |
| 3300009012|Ga0066710_103711754 | Not Available | 574 | Open in IMG/M |
| 3300009012|Ga0066710_103993823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 552 | Open in IMG/M |
| 3300009038|Ga0099829_10025434 | All Organisms → cellular organisms → Bacteria | 4143 | Open in IMG/M |
| 3300009038|Ga0099829_10640524 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300009088|Ga0099830_10266609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales | 1359 | Open in IMG/M |
| 3300009088|Ga0099830_11361555 | Not Available | 590 | Open in IMG/M |
| 3300009089|Ga0099828_10925632 | Not Available | 778 | Open in IMG/M |
| 3300009089|Ga0099828_12024271 | Not Available | 503 | Open in IMG/M |
| 3300009090|Ga0099827_10105944 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300009090|Ga0099827_10637266 | Not Available | 920 | Open in IMG/M |
| 3300009090|Ga0099827_11943614 | Not Available | 512 | Open in IMG/M |
| 3300009094|Ga0111539_10528963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1374 | Open in IMG/M |
| 3300009094|Ga0111539_10674605 | Not Available | 1203 | Open in IMG/M |
| 3300009100|Ga0075418_11139496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 845 | Open in IMG/M |
| 3300009147|Ga0114129_11286994 | Not Available | 907 | Open in IMG/M |
| 3300009156|Ga0111538_13473649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 547 | Open in IMG/M |
| 3300009157|Ga0105092_10404517 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300009174|Ga0105241_10554785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300009444|Ga0114945_10359735 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009444|Ga0114945_10679390 | Not Available | 627 | Open in IMG/M |
| 3300009553|Ga0105249_11705673 | Not Available | 702 | Open in IMG/M |
| 3300009691|Ga0114944_1153867 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300009792|Ga0126374_10113254 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300009792|Ga0126374_11310932 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin15 | 585 | Open in IMG/M |
| 3300009795|Ga0105059_1007628 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300009802|Ga0105073_1042549 | Not Available | 575 | Open in IMG/M |
| 3300009836|Ga0105068_1078417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 624 | Open in IMG/M |
| 3300009836|Ga0105068_1117880 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009837|Ga0105058_1152086 | Not Available | 563 | Open in IMG/M |
| 3300010029|Ga0105074_1008438 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300010043|Ga0126380_10393979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1026 | Open in IMG/M |
| 3300010043|Ga0126380_10438690 | Not Available | 983 | Open in IMG/M |
| 3300010043|Ga0126380_10817120 | Not Available | 765 | Open in IMG/M |
| 3300010043|Ga0126380_11561021 | Not Available | 587 | Open in IMG/M |
| 3300010044|Ga0126310_11830139 | Not Available | 506 | Open in IMG/M |
| 3300010046|Ga0126384_10572603 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300010046|Ga0126384_10597123 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 966 | Open in IMG/M |
| 3300010046|Ga0126384_11925575 | Not Available | 564 | Open in IMG/M |
| 3300010046|Ga0126384_12215786 | Not Available | 529 | Open in IMG/M |
| 3300010047|Ga0126382_10204812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1407 | Open in IMG/M |
| 3300010159|Ga0099796_10589161 | Not Available | 501 | Open in IMG/M |
| 3300010358|Ga0126370_10958949 | Not Available | 777 | Open in IMG/M |
| 3300010358|Ga0126370_11476769 | Not Available | 645 | Open in IMG/M |
| 3300010358|Ga0126370_12346319 | Not Available | 529 | Open in IMG/M |
| 3300010358|Ga0126370_12429805 | Not Available | 521 | Open in IMG/M |
| 3300010359|Ga0126376_10991863 | Not Available | 839 | Open in IMG/M |
| 3300010359|Ga0126376_12631705 | Not Available | 552 | Open in IMG/M |
| 3300010359|Ga0126376_12889998 | Not Available | 530 | Open in IMG/M |
| 3300010360|Ga0126372_10969461 | Not Available | 859 | Open in IMG/M |
| 3300010362|Ga0126377_11423836 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010362|Ga0126377_12718115 | Not Available | 570 | Open in IMG/M |
| 3300010362|Ga0126377_13434295 | Not Available | 512 | Open in IMG/M |
| 3300010366|Ga0126379_10256438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1726 | Open in IMG/M |
| 3300010366|Ga0126379_13027789 | Not Available | 562 | Open in IMG/M |
| 3300010398|Ga0126383_13105204 | Not Available | 542 | Open in IMG/M |
| 3300010398|Ga0126383_13433130 | Not Available | 517 | Open in IMG/M |
| 3300011270|Ga0137391_10604862 | Not Available | 919 | Open in IMG/M |
| 3300011270|Ga0137391_10860835 | Not Available | 744 | Open in IMG/M |
| 3300012189|Ga0137388_10406194 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300012189|Ga0137388_10439292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1210 | Open in IMG/M |
| 3300012189|Ga0137388_11412689 | Not Available | 635 | Open in IMG/M |
| 3300012200|Ga0137382_10850547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 657 | Open in IMG/M |
| 3300012205|Ga0137362_10854852 | Not Available | 778 | Open in IMG/M |
| 3300012206|Ga0137380_11534694 | Not Available | 550 | Open in IMG/M |
| 3300012207|Ga0137381_10972790 | Not Available | 732 | Open in IMG/M |
| 3300012210|Ga0137378_11305403 | Not Available | 641 | Open in IMG/M |
| 3300012211|Ga0137377_10553333 | Not Available | 1088 | Open in IMG/M |
| 3300012349|Ga0137387_10308712 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300012349|Ga0137387_10936417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 624 | Open in IMG/M |
| 3300012350|Ga0137372_11220588 | Not Available | 506 | Open in IMG/M |
| 3300012351|Ga0137386_10126243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1821 | Open in IMG/M |
| 3300012351|Ga0137386_11128548 | Not Available | 552 | Open in IMG/M |
| 3300012356|Ga0137371_11208762 | Not Available | 564 | Open in IMG/M |
| 3300012357|Ga0137384_10539513 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012357|Ga0137384_10569231 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium | 926 | Open in IMG/M |
| 3300012359|Ga0137385_10572758 | Not Available | 951 | Open in IMG/M |
| 3300012359|Ga0137385_10742910 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012359|Ga0137385_11168507 | Not Available | 631 | Open in IMG/M |
| 3300012359|Ga0137385_11258765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 602 | Open in IMG/M |
| 3300012361|Ga0137360_10064989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2679 | Open in IMG/M |
| 3300012361|Ga0137360_10600406 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012362|Ga0137361_10125744 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 2264 | Open in IMG/M |
| 3300012362|Ga0137361_10647198 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012363|Ga0137390_11238576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300012363|Ga0137390_11876383 | Not Available | 528 | Open in IMG/M |
| 3300012486|Ga0157331_1008975 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012532|Ga0137373_10649452 | Not Available | 791 | Open in IMG/M |
| 3300012925|Ga0137419_11826642 | Not Available | 520 | Open in IMG/M |
| 3300012925|Ga0137419_11893833 | Not Available | 512 | Open in IMG/M |
| 3300012929|Ga0137404_11343911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300012929|Ga0137404_12215510 | Not Available | 514 | Open in IMG/M |
| 3300012948|Ga0126375_10364075 | Not Available | 1031 | Open in IMG/M |
| 3300012948|Ga0126375_10365068 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300012948|Ga0126375_10873124 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 720 | Open in IMG/M |
| 3300012948|Ga0126375_11924265 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012948|Ga0126375_12053885 | Not Available | 506 | Open in IMG/M |
| 3300012961|Ga0164302_11375539 | Not Available | 575 | Open in IMG/M |
| 3300012971|Ga0126369_10990679 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300012971|Ga0126369_11857690 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012976|Ga0134076_10221462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Merismopediaceae → Synechocystis → unclassified Synechocystis → Synechocystis sp. PCC 7509 | 799 | Open in IMG/M |
| 3300014263|Ga0075324_1025570 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1060 | Open in IMG/M |
| 3300014318|Ga0075351_1065392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 711 | Open in IMG/M |
| 3300014488|Ga0182001_10655857 | Not Available | 515 | Open in IMG/M |
| 3300015245|Ga0137409_10447688 | Not Available | 1111 | Open in IMG/M |
| 3300015245|Ga0137409_11452877 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 532 | Open in IMG/M |
| 3300015358|Ga0134089_10118980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1025 | Open in IMG/M |
| 3300015372|Ga0132256_102351728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Competibacter → Candidatus Competibacter denitrificans → Candidatus Competibacter denitrificans Run_A_D11 | 636 | Open in IMG/M |
| 3300015374|Ga0132255_106035134 | Not Available | 513 | Open in IMG/M |
| 3300016404|Ga0182037_11827386 | Not Available | 543 | Open in IMG/M |
| 3300017656|Ga0134112_10155649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 881 | Open in IMG/M |
| 3300018031|Ga0184634_10087641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1345 | Open in IMG/M |
| 3300018053|Ga0184626_10452814 | Not Available | 504 | Open in IMG/M |
| 3300018056|Ga0184623_10501470 | Not Available | 518 | Open in IMG/M |
| 3300018063|Ga0184637_10118794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1630 | Open in IMG/M |
| 3300018063|Ga0184637_10343190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300018078|Ga0184612_10336559 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300018079|Ga0184627_10588660 | Not Available | 561 | Open in IMG/M |
| 3300018433|Ga0066667_11823660 | Not Available | 551 | Open in IMG/M |
| 3300018465|Ga0190269_11627068 | Not Available | 540 | Open in IMG/M |
| 3300018466|Ga0190268_10959248 | Not Available | 675 | Open in IMG/M |
| 3300019279|Ga0184642_1600738 | Not Available | 588 | Open in IMG/M |
| 3300020063|Ga0180118_1401689 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300020084|Ga0194110_10924375 | Not Available | 517 | Open in IMG/M |
| 3300021073|Ga0210378_10148185 | Not Available | 906 | Open in IMG/M |
| 3300021560|Ga0126371_11430328 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300022563|Ga0212128_10117391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1718 | Open in IMG/M |
| 3300025911|Ga0207654_10569236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 806 | Open in IMG/M |
| 3300026296|Ga0209235_1221630 | Not Available | 611 | Open in IMG/M |
| 3300026297|Ga0209237_1098871 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300026298|Ga0209236_1055348 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae | 1955 | Open in IMG/M |
| 3300026326|Ga0209801_1157121 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300026328|Ga0209802_1128526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1102 | Open in IMG/M |
| 3300026524|Ga0209690_1249316 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026540|Ga0209376_1236930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300026540|Ga0209376_1339919 | Not Available | 570 | Open in IMG/M |
| 3300026548|Ga0209161_10571165 | Not Available | 505 | Open in IMG/M |
| 3300027722|Ga0209819_10046798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1481 | Open in IMG/M |
| 3300027880|Ga0209481_10389732 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027907|Ga0207428_10843239 | Not Available | 649 | Open in IMG/M |
| 3300027909|Ga0209382_11860283 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300028608|Ga0247819_10810427 | Not Available | 580 | Open in IMG/M |
| 3300030830|Ga0308205_1006279 | Not Available | 1106 | Open in IMG/M |
| 3300031094|Ga0308199_1003908 | Not Available | 1903 | Open in IMG/M |
| 3300031094|Ga0308199_1101290 | Not Available | 635 | Open in IMG/M |
| 3300031184|Ga0307499_10011466 | Not Available | 1791 | Open in IMG/M |
| 3300031421|Ga0308194_10186744 | Not Available | 663 | Open in IMG/M |
| 3300031421|Ga0308194_10258001 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 588 | Open in IMG/M |
| 3300031545|Ga0318541_10727876 | Not Available | 554 | Open in IMG/M |
| 3300031719|Ga0306917_10073118 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2384 | Open in IMG/M |
| 3300031854|Ga0310904_10543687 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031912|Ga0306921_10973007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 959 | Open in IMG/M |
| 3300031946|Ga0310910_11584354 | Not Available | 501 | Open in IMG/M |
| 3300031947|Ga0310909_10775482 | Not Available | 793 | Open in IMG/M |
| 3300031954|Ga0306926_12604285 | Not Available | 552 | Open in IMG/M |
| 3300032002|Ga0307416_101156737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 879 | Open in IMG/M |
| 3300032012|Ga0310902_11115602 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032013|Ga0310906_10330387 | Not Available | 985 | Open in IMG/M |
| 3300032075|Ga0310890_10749323 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300032174|Ga0307470_10980638 | Not Available | 671 | Open in IMG/M |
| 3300032205|Ga0307472_101176642 | Not Available | 731 | Open in IMG/M |
| 3300032261|Ga0306920_100925604 | Not Available | 1273 | Open in IMG/M |
| 3300033551|Ga0247830_10038920 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300034664|Ga0314786_144777 | Not Available | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.99% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.50% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_100192933 | 3300000858 | Soil | MAITVQMRFESAVTEIYQDAFVGSSIENGVTMITFDLRQHDFQQPA* |
| JGI11643J12802_105281842 | 3300000890 | Soil | MAVTVQMQFESAVTEMYQDACVGSSIENGATIITFDLRQRDVHHE* |
| JGI1027J12803_1001439842 | 3300000955 | Soil | MAVTVQRQFESAVTEMSQDTFVGSSIENGTTIIQCDL |
| JGI1027J12803_1019458652 | 3300000955 | Soil | MAVTVQMQFESVVTEVYQDAFVGSSSENGMTIIQFDLRKHDF |
| JGI1027J12803_1033821401 | 3300000955 | Soil | LRCGEGGQMAVTVQMQFESAVTEMSEEALVGSAIENGTTMIIF |
| Ga0066679_109163061 | 3300005176 | Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTIIQFDLRKHNFQ |
| Ga0066685_101506802 | 3300005180 | Soil | MAVTVQMQCTSVVTERYQDAFVGSAMENGATISQFDLRQHALP* |
| Ga0065704_102638471 | 3300005289 | Switchgrass Rhizosphere | MAVTVQMQFESVITELYEDAFVGSSIENGTTIIQFDLRKLDF* |
| Ga0065704_102707651 | 3300005289 | Switchgrass Rhizosphere | MAVAVQMQFESAVTELYEDAFIGSSIENGTTIIQFDLRKLDFQRVLE |
| Ga0065705_100235921 | 3300005294 | Switchgrass Rhizosphere | MQFESAGTELYEDAFIGSSIENGTTIIQFDLRKLDFQRVLE |
| Ga0066388_1027612601 | 3300005332 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDTFVGSSIESGTTIIQFDLRKRDWKVR* |
| Ga0066388_1040807882 | 3300005332 | Tropical Forest Soil | MALTVQMQFESAVTEMYQDAFVGSSVENGVTIITFDLRQHDFQQELGMQVRP* |
| Ga0066388_1065640052 | 3300005332 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDVHHALSSWTKIFLTL* |
| Ga0066682_106415861 | 3300005450 | Soil | MAVTVQMQFESVVTEMYQDAFIGSSIENGATIITFDLRNLDFQRELGTTSTISW |
| Ga0070697_1017193162 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVTVPRQFESAVTEMYQDACVGSSIENGATIIKFDLRHRDFQHE* |
| Ga0070697_1018764621 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDFQQE* |
| Ga0070695_1005111671 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVTVQMQFTSAVTERYQDAFVGSAIENGTTIIQFDLRQLDFQRAL |
| Ga0070704_1022885331 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVTIQMQFASAVTELYEDAFVGSSMENGTTIITFDLRQHDFHQ |
| Ga0066701_109306651 | 3300005552 | Soil | MAVTVQMQFTSAVTERYQDAFVGSAMENGATISQFDLRQHALP* |
| Ga0066707_100467544 | 3300005556 | Soil | MAVTVQMQCTSAVTERYQDAFVGSAMENGATISQFDLRQHALP* |
| Ga0066905_1015489702 | 3300005713 | Tropical Forest Soil | MAITVQMQFTSAVTEIYQDAFVGSSIENGTTIIQFDLRQHDFH |
| Ga0066903_1035483492 | 3300005764 | Tropical Forest Soil | MAITVQMQFESAVTELYEDAFIGSSIENGTTIIQFDLRKLDFQRVLETTSTIC* |
| Ga0081538_103634141 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MAVTVQRQFASAVTELYEDALIGSSIENGPTIIQFDLRQLDFQRVLGTTSMLC |
| Ga0066652_1014492232 | 3300006046 | Soil | MAVMIQMQVASAVTEIDEDACVGSSRENGTTMIMFALRQHDFHQELGTQATL |
| Ga0075427_100064732 | 3300006194 | Populus Rhizosphere | MAVTVQMQFESAVTEMYQDAFVGSSLENGATISTFDLRQRDVHHE* |
| Ga0066658_105223271 | 3300006794 | Soil | MAVTVQMQFTSAVTERYQDAFVGSAIENGTTIIQFD |
| Ga0066658_108754232 | 3300006794 | Soil | MAVTVQMQFESVVTQIYEDAFIGSSIENGTTIIQFDLRKLDFQ |
| Ga0066659_103744402 | 3300006797 | Soil | MAVTVQMQFTSAVTERYQDAFVGSAIENGTTIIQFDLRQHD |
| Ga0075428_1004066682 | 3300006844 | Populus Rhizosphere | MAVTVQMQLESAVTEMYQDAFVGSSIENGATLITCDLRQRDVHHE* |
| Ga0075428_1018002131 | 3300006844 | Populus Rhizosphere | MAITVQMQFESAVTEMYQDAFVGLSIENGTTVMQFDLRKHDFQ* |
| Ga0075428_1018207361 | 3300006844 | Populus Rhizosphere | AVTVQMQFESAVTEMYQDAFVGSSLENGATISTFDLRQRDVHHE* |
| Ga0075421_1008559822 | 3300006845 | Populus Rhizosphere | MAVTVQMQFTSAVTEIYQDAFVGSSIENGATISTFDLRQRDFQPELGATSTLSWR |
| Ga0075431_1015052332 | 3300006847 | Populus Rhizosphere | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDVHHE* |
| Ga0075433_104970163 | 3300006852 | Populus Rhizosphere | MAVTVQMQFASAVTELYEDAFLGSSIENGTTIIQFDLRKLDFQR |
| Ga0075420_1011269251 | 3300006853 | Populus Rhizosphere | MAVTVQMQFESVVTELYEDAFVGSSIENGTTIIQFDLRKLDFQRALA |
| Ga0099791_100218763 | 3300007255 | Vadose Zone Soil | MAVTVQMQCESAVTERYQNAFGGSSIENGTTRIPFDLRKLDLQRELGTTSPICW |
| Ga0099791_101050342 | 3300007255 | Vadose Zone Soil | MAVTVQMQFESVVTERYEDAFVGSSIEHGTTMIQFDLRKLDFQLIIP* |
| Ga0099794_107268591 | 3300007265 | Vadose Zone Soil | MAVTVQMQFESAVTELYEDTFVGSSIEHGTTIIQF |
| Ga0066710_1037117541 | 3300009012 | Grasslands Soil | MAVTVQIQFESAVTEMYQDAFVGSSIENGATVSDLRQSRRLENL |
| Ga0066710_1039938232 | 3300009012 | Grasslands Soil | MAVTVQMQFESVVTEMYEDAFVGSSIENGTTIIQFDLRKLDFQLIIP |
| Ga0099829_100254341 | 3300009038 | Vadose Zone Soil | MAVTVPRQFASAVTEMSQDALVGSSIEEGATIIQCDLRQCALQRA* |
| Ga0099829_106405242 | 3300009038 | Vadose Zone Soil | MAGTVQMQFASAVTEIYQDAFVGSSIENGATISTFALRPHDFQPE* |
| Ga0099830_102666091 | 3300009088 | Vadose Zone Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATISTFALRQRD |
| Ga0099830_113615552 | 3300009088 | Vadose Zone Soil | MAVTVQMQFASAVTEMYQDAFVGSCMENGTTIIKFDLRKHDFHQELGTQ |
| Ga0099828_109256322 | 3300009089 | Vadose Zone Soil | MAVIVQMQFESVVTEMYQDAFVGSSIENGATIITFDLRHLDF |
| Ga0099828_120242711 | 3300009089 | Vadose Zone Soil | MAVTVQMQFESVVTAVYEDAFVGSSIENGTTIIQFDLRKLDFQ |
| Ga0099827_101059443 | 3300009090 | Vadose Zone Soil | MAVTVQMQFKSAVTEIYQDAFVGSSIENGGTIITFDLRQRDFHQE* |
| Ga0099827_106372662 | 3300009090 | Vadose Zone Soil | MAITVQMQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFQQELGTT |
| Ga0099827_119436141 | 3300009090 | Vadose Zone Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTVIQFDLRRHNF |
| Ga0111539_105289632 | 3300009094 | Populus Rhizosphere | ERMAVTVQMQFESAVTEMYQDAFVGSSLENGATISTFDLRQRDVHHE* |
| Ga0111539_106746052 | 3300009094 | Populus Rhizosphere | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTIIQFDLRKHNFQQELG |
| Ga0075418_111394962 | 3300009100 | Populus Rhizosphere | MAVTVPMQFASAVTERYQDAFVGASIENGATIITFALRKLDLQRELG |
| Ga0114129_112869942 | 3300009147 | Populus Rhizosphere | MAVTVQMQFASVVTEIYQDAFVGSSIENGTTVIQFDLRRHNFQQELGTQ |
| Ga0111538_134736491 | 3300009156 | Populus Rhizosphere | MAITVQMQFESAVTEMYQDAFVGSSIENGVTIITFDLRQHDFQQELGTQARLCW |
| Ga0105092_104045172 | 3300009157 | Freshwater Sediment | MAVTVQMQVESAVTEMYQDAFVGSSIENGATIIKFDLRQRDFQQE* |
| Ga0105241_105547851 | 3300009174 | Corn Rhizosphere | MAVTVQMQFESAVTEMYQDAFVGSSIENGTTIITFDLRQHAFQQEVGAAATLA |
| Ga0114945_103597352 | 3300009444 | Thermal Springs | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDFHHE* |
| Ga0114945_106793902 | 3300009444 | Thermal Springs | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIIPFDLRQRAFQQE* |
| Ga0105249_117056732 | 3300009553 | Switchgrass Rhizosphere | MAVTVQMQFTSAVTERYQDAFVGSSMENGTTMIIFDLR |
| Ga0114944_11538671 | 3300009691 | Thermal Springs | MAVTVQRQFESAVTEIYQDAFVGSSIANGATILTFDLRQHDFQQE* |
| Ga0126374_101132543 | 3300009792 | Tropical Forest Soil | MAITVQMQFTSAVTEIYQDAFVGSSLENGTTVSQFDLRKHDFHQELG |
| Ga0126374_113109322 | 3300009792 | Tropical Forest Soil | MQFESAVTEMYQDTFVGSSIENGTTIITFDQRQRDFHQE* |
| Ga0105059_10076281 | 3300009795 | Groundwater Sand | MAVTVQMQFESVVTELYQDAFVGSSIENGTTIIQFDLR |
| Ga0105073_10425492 | 3300009802 | Groundwater Sand | MAVTVQMQFESAVTEMYQDAFVGSSIENGATMITFDLRQHDFQHA* |
| Ga0105068_10784172 | 3300009836 | Groundwater Sand | MQFESVVTEMYQDAFVGSSIENGATIMMFDLRKLDFQRELGTTSP |
| Ga0105068_11178802 | 3300009836 | Groundwater Sand | MAITVQMQFESAVTEMYQDAFVGSSIENGVTIITFDLQQLDFQ |
| Ga0105058_11520862 | 3300009837 | Groundwater Sand | MAVTVQMQFTSVVTEMYQDAFVGSSIEDGTTIIQFDLRKYDFQH |
| Ga0105074_10084384 | 3300010029 | Groundwater Sand | MAVIVQMQFTSAVTEMYQDAFVGSAMENGTTIIQFDLCQHDFHYE |
| Ga0126380_103939791 | 3300010043 | Tropical Forest Soil | MAITVQMQFESAVTELYEDAFIGSSIENGTTIIQFDLRKHDFQQELGTQATLCW |
| Ga0126380_104386902 | 3300010043 | Tropical Forest Soil | MAVTVQMQCESAVTELYEDAVIGSSIENGTTIIQFDLRKL |
| Ga0126380_108171202 | 3300010043 | Tropical Forest Soil | MAVTVQMPFTSAVTERYQDAFVGSSIENGATIIQFD |
| Ga0126380_115610212 | 3300010043 | Tropical Forest Soil | MAVTVQMQFESAVTELYEDAFIGSSIENGTTIIQFDL |
| Ga0126310_118301391 | 3300010044 | Serpentine Soil | MAVTVQMQFESVVTEMYEDAFVGSSIENGTTIIQFDLRKLDFQRVLETTST |
| Ga0126384_105726032 | 3300010046 | Tropical Forest Soil | MAVTVQMQFTSAVTERYQDAFVGSSIENGATIIQFDLRQHDFHDDLGT |
| Ga0126384_105971233 | 3300010046 | Tropical Forest Soil | MAVTVQMQFESAVTELYEDVFIGSSIENGTTIIQFDLRKL |
| Ga0126384_119255751 | 3300010046 | Tropical Forest Soil | MAVTVQMPFTSAVTERYQDAFVGSSIENGATIIQFDLRQHDFHDDLGT |
| Ga0126384_122157862 | 3300010046 | Tropical Forest Soil | MQFESAVTELYEDAFIGSSIENGTTIIQFDLRKHDFQ |
| Ga0126382_102048121 | 3300010047 | Tropical Forest Soil | MAMTVQMQFASAVTEMSQDAFVGSSMEHGVTMITFDRRQLDFQRE* |
| Ga0099796_105891611 | 3300010159 | Vadose Zone Soil | MAITVQMQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFQQELGTKATLYWRK |
| Ga0126370_109589491 | 3300010358 | Tropical Forest Soil | MAVTVQMEFESVVTDIYQDAFVGSSIENGTTIIQFDL |
| Ga0126370_114767691 | 3300010358 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDAFVGSCIEKGATIITFDLRQHDF |
| Ga0126370_123463192 | 3300010358 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDTFVGSSIENGTTIITFDQRQRDFHQE* |
| Ga0126370_124298051 | 3300010358 | Tropical Forest Soil | MAVTVQMQFESAVTELYEDVFIGSSIENGTTIIQFDLRKLDFQRV |
| Ga0126376_109918631 | 3300010359 | Tropical Forest Soil | MAITVQMQFESAVTELYEDAFIGSSIENGTTIIQFDLRTHDV |
| Ga0126376_126317051 | 3300010359 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDAFVGSSSENGATISTFDLRQHDLQPELGATATR |
| Ga0126376_128899981 | 3300010359 | Tropical Forest Soil | MALTVQMQFESAVTEMYRDAFVGSSVENGVTIITFDLRQHDFQQELGMQVRP* |
| Ga0126372_109694612 | 3300010360 | Tropical Forest Soil | MPFESAVTEMYQDTFVGSSIDNGTTIIEFDLRKRDWQGTWRTSA |
| Ga0126377_114238361 | 3300010362 | Tropical Forest Soil | MAITVQRRFESAVTELYEDAFIGSSIENGTTIIQFD |
| Ga0126377_127181151 | 3300010362 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRD |
| Ga0126377_134342951 | 3300010362 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQKAFVGSSIENGTTVIQFDLRQLDFQRELGTTSPI |
| Ga0126379_102564381 | 3300010366 | Tropical Forest Soil | MAITVQMQFESAVTEMYQDAFVGSSIENGVTMITFDLR* |
| Ga0126379_130277892 | 3300010366 | Tropical Forest Soil | MALTVQMQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFHQELGTQATL* |
| Ga0126383_131052041 | 3300010398 | Tropical Forest Soil | MAVTVQMQFESAVTEMYEEAFVGSAIENGTTMIIFDLRKLNFQQKLGTTSE |
| Ga0126383_134331301 | 3300010398 | Tropical Forest Soil | MAVTVQMQFESAVTELYEDVFIGSSIENGTTIIQFDLRKLDF |
| Ga0137391_106048622 | 3300011270 | Vadose Zone Soil | MAVTVPLQFKSVVTEIYQDAFVGSSIENGTTVIQFDLRRHNFHQELGTQ |
| Ga0137391_108608351 | 3300011270 | Vadose Zone Soil | MAVTVQMQFTSAVTEMYQDAFVGSSMENGTTIITFDLRKHDFQ |
| Ga0137388_104061942 | 3300012189 | Vadose Zone Soil | MAVTVQMQFESVVTELYEDAFIGSSIEHGTTIIQFDLRKRDFQR |
| Ga0137388_104392922 | 3300012189 | Vadose Zone Soil | MAITVQMQFTSAVTEIDQDAFVGSSIENGTTVIQFDLRKHDFQQELGTKA |
| Ga0137388_114126892 | 3300012189 | Vadose Zone Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIIKFDLRQRDFHHELG |
| Ga0137382_108505472 | 3300012200 | Vadose Zone Soil | MAVTVQMQFESAVTELYEDAFIGSSIENGTTIIQFDLRKLDFQRVLETTSTIC* |
| Ga0137362_108548523 | 3300012205 | Vadose Zone Soil | MALTVQMQCTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFQQELGT |
| Ga0137380_115346942 | 3300012206 | Vadose Zone Soil | MAVTVQMQFESAVTERYQDACVGSAIENGTTIILFDLRKHDFHQEVGT |
| Ga0137381_109727901 | 3300012207 | Vadose Zone Soil | MAVTVQRQFTSAVTERYPDACVGSAMENGTTILPFDLR |
| Ga0137378_113054032 | 3300012210 | Vadose Zone Soil | MAVTVQMQFTSAVTERYQDAFVGSSIENGATIIQFDLRQ |
| Ga0137377_105533332 | 3300012211 | Vadose Zone Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIIKFDLRQRDFQ |
| Ga0137387_103087121 | 3300012349 | Vadose Zone Soil | MAGTVQMQFASAVTEIYQDAFVGSSIENGATISTFDLRPHDFQPE* |
| Ga0137387_109364171 | 3300012349 | Vadose Zone Soil | MAVTVQMQFTSAVTEMYQDAFVGSSMENGTTIITFDLRKHDFHQEFGTKVRLWWRK |
| Ga0137372_112205881 | 3300012350 | Vadose Zone Soil | MAVTVQMQFESAVTEMYQDAFVGSAIENGTTIILFDLRKHDFQSEL |
| Ga0137386_101262432 | 3300012351 | Vadose Zone Soil | MAVTVQMQCTSAVTERYQDAFGGSAMENGATISQFDLRQHALP* |
| Ga0137386_111285481 | 3300012351 | Vadose Zone Soil | MAITVQMQFESAVTEMYQDALVGSSIENGVTIITFDLRQ |
| Ga0137371_112087621 | 3300012356 | Vadose Zone Soil | MAVTVQMQFESAVTEIYQDAFVGSSIENGTTIIQFDLRKHDHQRELGTQARLC |
| Ga0137384_105395131 | 3300012357 | Vadose Zone Soil | MAVTVQMQFESVVTDLYQDAFVGSSIENGTTIIQFDLRKLDF |
| Ga0137384_105692311 | 3300012357 | Vadose Zone Soil | MAITVQMQFESAVTEMYQDAFVGSSIENGVTIITFDLRQHDFQQALGTKAKLCW |
| Ga0137385_105727581 | 3300012359 | Vadose Zone Soil | MAVTVQMQFTSAVTERYQDACVGSAMENGTTIIQCDLR |
| Ga0137385_107429101 | 3300012359 | Vadose Zone Soil | MAGTVQMQFASAVTEIYQDAFVGSSIENGATISTFALRQHDFQPE* |
| Ga0137385_111685072 | 3300012359 | Vadose Zone Soil | MAVTVQMQFESVVTEIYEDAFIGSSIENGTTIIQFDLRKLDFQ |
| Ga0137385_112587652 | 3300012359 | Vadose Zone Soil | MAVTVQMQFESAVTEMYQNAFVGSSIENGATIIQFDLRQLDCQRELGTTSP |
| Ga0137360_100649892 | 3300012361 | Vadose Zone Soil | MAVTVQMQFASAVTEIYQDAFVGSSIENGATISTFALRQHDFQPE* |
| Ga0137360_106004062 | 3300012361 | Vadose Zone Soil | MAVTVQMQLTSVVTEMSQDAFVGSSLENGATIIQCDLRQLDFQR |
| Ga0137361_101257441 | 3300012362 | Vadose Zone Soil | MAITVQMQFTSAVTEIYQDAFVGSSIENGTTVIQF |
| Ga0137361_106471983 | 3300012362 | Vadose Zone Soil | MAVTVQRQFESAVTEMYQKAFVGSSLENGTTIIQCDLRKRDFQRALGTTSTI |
| Ga0137390_112385761 | 3300012363 | Vadose Zone Soil | MAITVQMQFTSAVTEIDQDAFVGSSIENGTTVIQFDLRKHDFQQELG |
| Ga0137390_118763831 | 3300012363 | Vadose Zone Soil | MAVTVQMQFESAVTEIYQDAFVGSAIANGTTIILFD |
| Ga0157331_10089753 | 3300012486 | Soil | MAVTVQMQFESAVTEMYQDAFVGSSMENGTTIITFDLRQHDFH |
| Ga0137373_106494522 | 3300012532 | Vadose Zone Soil | MAITVQMQFESVVTEMYQDAFVGSSIENGATIMTFDLRKLDFQR |
| Ga0137419_118266421 | 3300012925 | Vadose Zone Soil | MAITVQMQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFQQELGT |
| Ga0137419_118938331 | 3300012925 | Vadose Zone Soil | MALTVQMQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFQQELGTTAPI |
| Ga0137404_113439111 | 3300012929 | Vadose Zone Soil | MALTVQRQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRQ |
| Ga0137404_122155101 | 3300012929 | Vadose Zone Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTMIQFDLRKRDFQRALGTTSTIG |
| Ga0126375_103640753 | 3300012948 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQKAFVGSSIDNGATIIQFDLRQLDFQR |
| Ga0126375_103650682 | 3300012948 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQ |
| Ga0126375_108731242 | 3300012948 | Tropical Forest Soil | MAVTVQMQFESAVTELYQNAFVGSSIESGTTIIQFDLR |
| Ga0126375_119242651 | 3300012948 | Tropical Forest Soil | MAITVQMQFTSAVTEISQDAFVGSSIENGTTVIQFDLRKHDFHQ |
| Ga0126375_120538851 | 3300012948 | Tropical Forest Soil | MAVTVQMQLPSAVTELYEDAFIGSSIENGTTIIQCDLRKLDFQRVL |
| Ga0164302_113755391 | 3300012961 | Soil | MAVTVQMQFTSAVTEMYQDAFVGSSMENGTTIITFDLRQHDFQQELG |
| Ga0126369_109906791 | 3300012971 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQKAFVGSSIENGTTIIQFDLRKPD |
| Ga0126369_118576901 | 3300012971 | Tropical Forest Soil | MAITVQMQFESAVTELYEDAFIGSSIENGTTIIQFDLRKLDFQR |
| Ga0134076_102214621 | 3300012976 | Grasslands Soil | MAITVQMQFTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFQQELGTKATL |
| Ga0075324_10255701 | 3300014263 | Natural And Restored Wetlands | MAVTVQTQLQFESVVTEMYQEAFVGSSIENGTTLIKFDLRKLDFQHE |
| Ga0075351_10653922 | 3300014318 | Natural And Restored Wetlands | MALTVQTQFESVVTEMSQEVFVGSSIENGTTLITFDLRKLDFQRKSGTTS |
| Ga0182001_106558571 | 3300014488 | Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTVIQFDLRRHNFQ |
| Ga0137409_104476882 | 3300015245 | Vadose Zone Soil | MAVTVQMQFESVVTEMSQDAFIGSSIENGATIITFDL |
| Ga0137409_114528771 | 3300015245 | Vadose Zone Soil | MAVTVQMQFESVVTAVYEDAFVGSSIENGTTIIQF |
| Ga0134089_101189801 | 3300015358 | Grasslands Soil | MAVTVQMQFESAVTEIYQDAFVGSSIENGTTIIQFDLRKHD |
| Ga0132256_1023517281 | 3300015372 | Arabidopsis Rhizosphere | MAVTVQRQFESAVTEMYQDAFVGSSIEDGATIITFD |
| Ga0132255_1060351342 | 3300015374 | Arabidopsis Rhizosphere | MAVTVQMQFESAVTEMYQDAFVSSSIENGATIITCDLRQRDFQQE* |
| Ga0182037_118273861 | 3300016404 | Soil | MAITVQMQFASAVTERYQDAFVGSSMENGVTMITFDLRQHDFHQELGTQA |
| Ga0134112_101556491 | 3300017656 | Grasslands Soil | MAVTVQMQFESAVTEMYQDAFVGSAIENGTTIIMF |
| Ga0184634_100876412 | 3300018031 | Groundwater Sediment | MAVTVQMQFVSAVTEIYQDACVDSSIENGTTIITFALRKHDFQQE |
| Ga0184626_104528141 | 3300018053 | Groundwater Sediment | MAVTVQMQFASAVTEIYQDAFVGSAIENGTTIILFDLRKHDFQ |
| Ga0184623_105014701 | 3300018056 | Groundwater Sediment | MAVTVQRQFESVVTEIYQDAFVGSSIENGTTIIQFDLRKRDLQRELRTTSTICWR |
| Ga0184637_101187943 | 3300018063 | Groundwater Sediment | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIIQFDLRQRDFHHE |
| Ga0184637_103431903 | 3300018063 | Groundwater Sediment | MAVTVQMQFESVVTELYEDAFVGSSIENGTTIIQFDLRKLDF |
| Ga0184612_103365591 | 3300018078 | Groundwater Sediment | MAVTVQMPFESAVTEMYQNAFVGSSIENGATIIQFDLRTLDFQRELGTTSPICWR |
| Ga0184627_105886601 | 3300018079 | Groundwater Sediment | MAVTVQMQFASAVTEMYQDAFVGSSIEDGTTIIQFDLRKCDFQRA |
| Ga0066667_118236601 | 3300018433 | Grasslands Soil | MAVTVQMQFESVVTEMYQDAFIGSSIENGATIITF |
| Ga0190269_116270682 | 3300018465 | Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGVTMITFDLRQHDFQQELGTQ |
| Ga0190268_109592482 | 3300018466 | Soil | MAITVQMQFESVVTEIYQDAFVGSSIENGTTVIQFDLRRHNFH |
| Ga0184642_16007382 | 3300019279 | Groundwater Sediment | MAVTVQMQVTSAVTEVAQDAFGGSSIENGTTIIMFDLRKQVVYL |
| Ga0180118_14016892 | 3300020063 | Groundwater Sediment | MAVTVQMQFESAVTEMYQDTFVGSAIENGATIITFDLRQRDFQQE |
| Ga0194110_109243751 | 3300020084 | Freshwater Lake | MALTVQTQFESVVTEMYQDVFVGSSIENGTTLITFDLRKLDFQRQFGTTSTIY |
| Ga0210378_101481853 | 3300021073 | Groundwater Sediment | MAVTVQMQFTSAVTEMYQDAFVGSAMENGTTIIQFDLR |
| Ga0126371_114303282 | 3300021560 | Tropical Forest Soil | MAVTVQMQFESAVTEMYQNAFVGSSIENGTTIIQFDLG |
| Ga0212128_101173912 | 3300022563 | Thermal Springs | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIIPFDLRQRAFQQE |
| Ga0207654_105692361 | 3300025911 | Corn Rhizosphere | MAVTVQMQFESAVTERYQDAFVGSSIEDGATIITFDLRK |
| Ga0209235_12216302 | 3300026296 | Grasslands Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTIIQFDLRQLDFQRA |
| Ga0209237_10988712 | 3300026297 | Grasslands Soil | MAVTVQMQCTSAVTERYQDACVGSAMENGATISQFDLRQHALP |
| Ga0209236_10553483 | 3300026298 | Grasslands Soil | MAVTVQMQFTSAVTEMYQDAFVGSSMENGTTMIIFD |
| Ga0209801_11571212 | 3300026326 | Soil | MAVTVQMQCTSAVTERYQDAFVGSAMENGATISQFDLRQHALP |
| Ga0209802_11285261 | 3300026328 | Soil | MAVTVQMQFASAVTEMYQDAFVGSTIENGTTIIQFDLRKHDFQQALG |
| Ga0209690_12493162 | 3300026524 | Soil | MAVTVQMQFESVVTEIYQDAFVGSSIENGMTIIQFDLRKHDFHQELGTRATICWR |
| Ga0209376_12369302 | 3300026540 | Soil | MAVTVQMQCTSVVTERYQDAFVGSAMENGATISQFDLRQHALP |
| Ga0209376_13399192 | 3300026540 | Soil | MAVTVQMQFESVVTEMYQDAFIGSSIENGATIITFDLRNLDFQRELGTT |
| Ga0209161_105711651 | 3300026548 | Soil | MAVTVQMQFESVVTEMYQDAFIGSSIENGATIITFDLRNLDF |
| Ga0209819_100467982 | 3300027722 | Freshwater Sediment | MAVTVQMQVESAVTEMYQDAFVGSSIENGATIIKFDLRQRDFQQE |
| Ga0209481_103897321 | 3300027880 | Populus Rhizosphere | MAVTVQMQFESAVTEMYQDAFVGSSLENGATISTFDLRQRDVHHE |
| Ga0207428_108432391 | 3300027907 | Populus Rhizosphere | MAVTVQMQFESVVTEIYQDAFVGSSIENGTTIIQFDLR |
| Ga0209382_118602831 | 3300027909 | Populus Rhizosphere | MAVTVQMQFASVVTEIYQDAFVGSSIENGMTIIQFDLRKHNFHQELGTR |
| Ga0247819_108104271 | 3300028608 | Soil | MAVTVQRQFESVVTELYEGAFVGSSIENGTTIIQFDLRKLDFQRALAT |
| Ga0308205_10062793 | 3300030830 | Soil | MAVTVQMQVTSAVTEVSQDAFGGSSIENGTTIIMFDLRKQVVYL |
| Ga0308199_10039083 | 3300031094 | Soil | MALTVQMQFTSAVTEIYQDALVGSSIENGTTVIQFDLRKHDFQQELGTTA |
| Ga0308199_11012902 | 3300031094 | Soil | MAVTVQMQFTSAVTEMYQDAFVGSAMENGTTIIQFDL |
| Ga0307499_100114661 | 3300031184 | Soil | MAVTVPMQFESVVTERYEDAFIGSSIANGTTILQCALRKR |
| Ga0308194_101867442 | 3300031421 | Soil | MAVMVQMQFESAVTEMYQNAFVGSSIENDATIIQFDLR |
| Ga0308194_102580012 | 3300031421 | Soil | MAVTVQMQFTSAVTEMYQDAFVGSSMENGTTMIIFDLRKHNFHQELGTKA |
| Ga0318541_107278761 | 3300031545 | Soil | MAITVQMQFASAVTERYQDAFVGSSMENGVTMITFDLRQHWP |
| Ga0306917_100731181 | 3300031719 | Soil | MAITVQMQLTSAVTELYQDAFVGSSIENGTTVIQFDLRKHDFHQELGTQATLCW |
| Ga0310904_105436872 | 3300031854 | Soil | MAVTVQMQLESAVTEMYQDAFVGSSIENGATLITCDLRQRDVHHE |
| Ga0306921_109730072 | 3300031912 | Soil | MAITVQMQFASAVTERYQDAFVGSSMENGVTMITFDLRQHDFHQELRTQAR |
| Ga0310910_115843541 | 3300031946 | Soil | MAVTVQMQFESVVTELYEDAFVGSSIENGTTIIQFDLRKLDFQRALET |
| Ga0310909_107754822 | 3300031947 | Soil | MAITVQMQLTSAVTEIYQDAFVGSSIENGTTVIQFDLRKHDFHQELGTQAT |
| Ga0306926_126042852 | 3300031954 | Soil | MAVTVQMQFESVVTELYEDACVGSSIENGTTIIQFDLRTLDFPRAL |
| Ga0307416_1011567372 | 3300032002 | Rhizosphere | MAVTVQMQFESVVPEMSEDAFIGSSIENGTTIIQCDLRKLDLQ |
| Ga0310902_111156022 | 3300032012 | Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDFSQE |
| Ga0310906_103303871 | 3300032013 | Soil | MAVTVQMQFESAVTETYQNAFVGSSIENGATILQCDLRQLDLQREL |
| Ga0310890_107493232 | 3300032075 | Soil | MAVTVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDLHHE |
| Ga0307470_109806382 | 3300032174 | Hardwood Forest Soil | MAITVQMQFESAVTEMYQDAFVGSSIENGATIITFDLRQRDLHHE |
| Ga0307472_1011766421 | 3300032205 | Hardwood Forest Soil | MAVTVQMQFESVVTELYQDAFVGSSIENGTTIIQC |
| Ga0306920_1009256042 | 3300032261 | Soil | ITVQMQFASAVTERYQDAFVGSSMENGVTMITFDLRQHWP |
| Ga0247830_100389204 | 3300033551 | Soil | MAVTVQRQFESAVTERSQDTFVGSSIENGATILPFELRQRDFPHA |
| Ga0314786_144777_412_549 | 3300034664 | Soil | MAVTVQMQFESAVTEMYQDAFVGSAIENGTTIILFDLRKHDFQSEW |
| ⦗Top⦘ |