


| Basic Information | |
|---|---|
| Family ID | F025407 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 202 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSNCVVGSGGSRLPCSIIAEHSVEGCDHFSHDGDDDDLGF |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.47 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 81.68 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.119 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.327 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.030 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 80.69 |
| PF02371 | Transposase_20 | 2.48 |
| PF03401 | TctC | 0.99 |
| PF08240 | ADH_N | 0.99 |
| PF13602 | ADH_zinc_N_2 | 0.99 |
| PF13467 | RHH_4 | 0.50 |
| PF10503 | Esterase_PHB | 0.50 |
| PF07883 | Cupin_2 | 0.50 |
| PF13088 | BNR_2 | 0.50 |
| PF00106 | adh_short | 0.50 |
| PF13676 | TIR_2 | 0.50 |
| PF01266 | DAO | 0.50 |
| PF05199 | GMC_oxred_C | 0.50 |
| PF14534 | DUF4440 | 0.50 |
| PF11799 | IMS_C | 0.50 |
| PF05362 | Lon_C | 0.50 |
| PF16864 | Dimerisation2 | 0.50 |
| PF02515 | CoA_transf_3 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 80.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.48 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.99 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.50 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.50 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.50 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.12 % |
| Unclassified | root | N/A | 11.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1025173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
| 3300005332|Ga0066388_108061304 | Not Available | 526 | Open in IMG/M |
| 3300005339|Ga0070660_101453623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300005439|Ga0070711_101797882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300005445|Ga0070708_101339029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 668 | Open in IMG/M |
| 3300005557|Ga0066704_10739976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300005713|Ga0066905_100197826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1499 | Open in IMG/M |
| 3300005713|Ga0066905_100394724 | Not Available | 1120 | Open in IMG/M |
| 3300005764|Ga0066903_100678939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1809 | Open in IMG/M |
| 3300005764|Ga0066903_101600536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1235 | Open in IMG/M |
| 3300005764|Ga0066903_102108065 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005764|Ga0066903_108180383 | Not Available | 535 | Open in IMG/M |
| 3300006163|Ga0070715_10074353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1526 | Open in IMG/M |
| 3300006173|Ga0070716_100177224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1396 | Open in IMG/M |
| 3300006573|Ga0074055_10005081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1935 | Open in IMG/M |
| 3300006606|Ga0074062_12890265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300006844|Ga0075428_102571200 | Not Available | 520 | Open in IMG/M |
| 3300006847|Ga0075431_100044855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4559 | Open in IMG/M |
| 3300006881|Ga0068865_101004411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 731 | Open in IMG/M |
| 3300010359|Ga0126376_10214008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1609 | Open in IMG/M |
| 3300016270|Ga0182036_10716446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 810 | Open in IMG/M |
| 3300016270|Ga0182036_11743833 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300016294|Ga0182041_10340040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1258 | Open in IMG/M |
| 3300016294|Ga0182041_10665673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 920 | Open in IMG/M |
| 3300016294|Ga0182041_10782020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300016319|Ga0182033_10322270 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300016319|Ga0182033_10638648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 928 | Open in IMG/M |
| 3300016319|Ga0182033_11307202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300016319|Ga0182033_11912678 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300016319|Ga0182033_11961289 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300016357|Ga0182032_10387732 | Not Available | 1127 | Open in IMG/M |
| 3300016371|Ga0182034_10213230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1501 | Open in IMG/M |
| 3300016371|Ga0182034_11291588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300016387|Ga0182040_10152344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1649 | Open in IMG/M |
| 3300016387|Ga0182040_10236993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1363 | Open in IMG/M |
| 3300016387|Ga0182040_10794212 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300016404|Ga0182037_10330527 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300016404|Ga0182037_10373821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300016422|Ga0182039_10035006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3274 | Open in IMG/M |
| 3300016422|Ga0182039_10986566 | Not Available | 755 | Open in IMG/M |
| 3300016445|Ga0182038_10090678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2189 | Open in IMG/M |
| 3300016445|Ga0182038_10337029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1245 | Open in IMG/M |
| 3300018072|Ga0184635_10063017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1441 | Open in IMG/M |
| 3300018072|Ga0184635_10232521 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300018081|Ga0184625_10141834 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300018081|Ga0184625_10150040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1217 | Open in IMG/M |
| 3300018081|Ga0184625_10461509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300018083|Ga0184628_10353045 | Not Available | 771 | Open in IMG/M |
| 3300019881|Ga0193707_1089322 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300019887|Ga0193729_1070950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1374 | Open in IMG/M |
| 3300020016|Ga0193696_1056955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300020016|Ga0193696_1174337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300021073|Ga0210378_10299710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300021168|Ga0210406_10218715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1574 | Open in IMG/M |
| 3300021405|Ga0210387_11235179 | Not Available | 648 | Open in IMG/M |
| 3300021560|Ga0126371_10107331 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300021560|Ga0126371_10632444 | Not Available | 1219 | Open in IMG/M |
| 3300022694|Ga0222623_10221193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300022756|Ga0222622_10324889 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300024288|Ga0179589_10086241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
| 3300025910|Ga0207684_10980685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300025910|Ga0207684_11669359 | Not Available | 514 | Open in IMG/M |
| 3300025915|Ga0207693_10703042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300025961|Ga0207712_11140247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300026041|Ga0207639_11679461 | Not Available | 595 | Open in IMG/M |
| 3300027874|Ga0209465_10239936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 906 | Open in IMG/M |
| 3300028712|Ga0307285_10093360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300028754|Ga0307297_10067703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300028768|Ga0307280_10066980 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300028768|Ga0307280_10083174 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300028778|Ga0307288_10084835 | Not Available | 1136 | Open in IMG/M |
| 3300028787|Ga0307323_10056935 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300028796|Ga0307287_10151361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 882 | Open in IMG/M |
| 3300028819|Ga0307296_10121307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1405 | Open in IMG/M |
| 3300028819|Ga0307296_10551999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300028828|Ga0307312_10732175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300028875|Ga0307289_10080470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
| 3300028876|Ga0307286_10022728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2030 | Open in IMG/M |
| 3300028876|Ga0307286_10024963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1945 | Open in IMG/M |
| 3300028885|Ga0307304_10122378 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300031446|Ga0170820_12934174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300031543|Ga0318516_10024213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3142 | Open in IMG/M |
| 3300031543|Ga0318516_10109946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1563 | Open in IMG/M |
| 3300031544|Ga0318534_10026645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3120 | Open in IMG/M |
| 3300031545|Ga0318541_10023804 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
| 3300031545|Ga0318541_10025394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2885 | Open in IMG/M |
| 3300031545|Ga0318541_10225229 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300031546|Ga0318538_10041164 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300031546|Ga0318538_10089523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1574 | Open in IMG/M |
| 3300031547|Ga0310887_10432573 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031549|Ga0318571_10093748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300031561|Ga0318528_10290664 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031561|Ga0318528_10662446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300031572|Ga0318515_10054463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2021 | Open in IMG/M |
| 3300031572|Ga0318515_10361112 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031573|Ga0310915_10060927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2461 | Open in IMG/M |
| 3300031573|Ga0310915_10110707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1866 | Open in IMG/M |
| 3300031573|Ga0310915_10143249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1648 | Open in IMG/M |
| 3300031573|Ga0310915_10198865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1401 | Open in IMG/M |
| 3300031573|Ga0310915_10240332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1273 | Open in IMG/M |
| 3300031573|Ga0310915_10481242 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031668|Ga0318542_10177866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300031679|Ga0318561_10094288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1565 | Open in IMG/M |
| 3300031679|Ga0318561_10246618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 973 | Open in IMG/M |
| 3300031682|Ga0318560_10021382 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
| 3300031719|Ga0306917_10310582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1219 | Open in IMG/M |
| 3300031719|Ga0306917_10335499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1172 | Open in IMG/M |
| 3300031723|Ga0318493_10841312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300031736|Ga0318501_10061781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1786 | Open in IMG/M |
| 3300031736|Ga0318501_10198679 | Not Available | 1048 | Open in IMG/M |
| 3300031744|Ga0306918_10054429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2673 | Open in IMG/M |
| 3300031744|Ga0306918_10226618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1418 | Open in IMG/M |
| 3300031744|Ga0306918_10293779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 1250 | Open in IMG/M |
| 3300031744|Ga0306918_10660444 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031747|Ga0318502_10834239 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031748|Ga0318492_10279195 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300031763|Ga0318537_10044204 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300031763|Ga0318537_10053240 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300031768|Ga0318509_10022388 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300031768|Ga0318509_10502200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 678 | Open in IMG/M |
| 3300031770|Ga0318521_10528116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300031770|Ga0318521_10861430 | Not Available | 553 | Open in IMG/M |
| 3300031771|Ga0318546_11019010 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031777|Ga0318543_10007616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3642 | Open in IMG/M |
| 3300031777|Ga0318543_10126545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1112 | Open in IMG/M |
| 3300031782|Ga0318552_10532968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031792|Ga0318529_10467733 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031792|Ga0318529_10567051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 527 | Open in IMG/M |
| 3300031794|Ga0318503_10028010 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300031794|Ga0318503_10065923 | Not Available | 1122 | Open in IMG/M |
| 3300031796|Ga0318576_10289300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300031797|Ga0318550_10195341 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300031798|Ga0318523_10621259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300031799|Ga0318565_10162097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300031805|Ga0318497_10590061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 623 | Open in IMG/M |
| 3300031819|Ga0318568_10606157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis | 682 | Open in IMG/M |
| 3300031821|Ga0318567_10813171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300031832|Ga0318499_10155824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 890 | Open in IMG/M |
| 3300031833|Ga0310917_10162594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1479 | Open in IMG/M |
| 3300031833|Ga0310917_11096741 | Not Available | 531 | Open in IMG/M |
| 3300031879|Ga0306919_10021794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3892 | Open in IMG/M |
| 3300031879|Ga0306919_10092307 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300031879|Ga0306919_11515809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300031890|Ga0306925_10076813 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300031890|Ga0306925_10157091 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300031890|Ga0306925_10179104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2283 | Open in IMG/M |
| 3300031890|Ga0306925_10200631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2151 | Open in IMG/M |
| 3300031890|Ga0306925_10329160 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300031890|Ga0306925_10531443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300031890|Ga0306925_11484712 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031893|Ga0318536_10081670 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300031910|Ga0306923_10228065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2130 | Open in IMG/M |
| 3300031910|Ga0306923_10456790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1448 | Open in IMG/M |
| 3300031910|Ga0306923_10636642 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300031910|Ga0306923_10657903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1170 | Open in IMG/M |
| 3300031910|Ga0306923_10681352 | Not Available | 1146 | Open in IMG/M |
| 3300031910|Ga0306923_11089717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 861 | Open in IMG/M |
| 3300031910|Ga0306923_11443927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300031910|Ga0306923_11537436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300031910|Ga0306923_11912147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300031912|Ga0306921_10340238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1755 | Open in IMG/M |
| 3300031912|Ga0306921_10529996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1367 | Open in IMG/M |
| 3300031912|Ga0306921_10556892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1329 | Open in IMG/M |
| 3300031912|Ga0306921_10692716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1171 | Open in IMG/M |
| 3300031912|Ga0306921_12733317 | Not Available | 506 | Open in IMG/M |
| 3300031941|Ga0310912_10096193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2173 | Open in IMG/M |
| 3300031941|Ga0310912_10815976 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031941|Ga0310912_11010966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 637 | Open in IMG/M |
| 3300031942|Ga0310916_10082917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2538 | Open in IMG/M |
| 3300031942|Ga0310916_11759594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300031945|Ga0310913_10285156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1163 | Open in IMG/M |
| 3300031946|Ga0310910_10259921 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031946|Ga0310910_10783961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300031947|Ga0310909_10017170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5130 | Open in IMG/M |
| 3300031947|Ga0310909_11237909 | Not Available | 602 | Open in IMG/M |
| 3300032001|Ga0306922_10147130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2517 | Open in IMG/M |
| 3300032001|Ga0306922_10180949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2260 | Open in IMG/M |
| 3300032043|Ga0318556_10016486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3223 | Open in IMG/M |
| 3300032055|Ga0318575_10504276 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032059|Ga0318533_10250093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1279 | Open in IMG/M |
| 3300032060|Ga0318505_10116677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1219 | Open in IMG/M |
| 3300032063|Ga0318504_10026535 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300032063|Ga0318504_10303606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300032068|Ga0318553_10501568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300032076|Ga0306924_10159266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2586 | Open in IMG/M |
| 3300032076|Ga0306924_10251294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2030 | Open in IMG/M |
| 3300032076|Ga0306924_10373894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1633 | Open in IMG/M |
| 3300032076|Ga0306924_10418295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1533 | Open in IMG/M |
| 3300032076|Ga0306924_10710310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1128 | Open in IMG/M |
| 3300032091|Ga0318577_10068519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1622 | Open in IMG/M |
| 3300032174|Ga0307470_11805186 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032180|Ga0307471_100714464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300032261|Ga0306920_100238339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2714 | Open in IMG/M |
| 3300032261|Ga0306920_100615135 | Not Available | 1606 | Open in IMG/M |
| 3300032261|Ga0306920_100900431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1293 | Open in IMG/M |
| 3300032261|Ga0306920_101636575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300033289|Ga0310914_10291967 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300033289|Ga0310914_11446044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10251732 | 3300000655 | Forest Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFFVG |
| Ga0066388_1080613041 | 3300005332 | Tropical Forest Soil | MGMSNCVVGSGGSWLPCSTIAEHSVEGSDHFSHDGDDDDLG |
| Ga0070660_1014536231 | 3300005339 | Corn Rhizosphere | MSNCVVGSGGSRLPCSTIAKHSVEGCDHFSHDGDDDDLGF |
| Ga0070674_1004810382 | 3300005356 | Miscanthus Rhizosphere | MSNCVVGSGRFRLPFNIVAEHGVEGCDHLSHDRNDDDLGL |
| Ga0070711_1017978822 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCVVGSGGFELPCSIIAEHGVEGSDHFSHDGDDDDLGFLVGVGETI |
| Ga0070708_1013390291 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCVVGSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLGFFVGVGE |
| Ga0070672_1009774382 | 3300005543 | Miscanthus Rhizosphere | MSNCVVGSGRFRLPFNIVAEHGVEGCDHLSHDRNDDDLGLL |
| Ga0066704_107399762 | 3300005557 | Soil | MSNCVVGSGGSRLPRGIIAEHSVEGSDHFSHDGDD |
| Ga0066905_1001978261 | 3300005713 | Tropical Forest Soil | MSNCVVGSGGSWLPCSTIAEHRVEGCDHFSHDGDD |
| Ga0066905_1003947241 | 3300005713 | Tropical Forest Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDLG |
| Ga0066903_1006789391 | 3300005764 | Tropical Forest Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHDDDLG |
| Ga0066903_1016005361 | 3300005764 | Tropical Forest Soil | MSNCVVGSGRSRLPCSTIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0066903_1021080652 | 3300005764 | Tropical Forest Soil | MSNCVVGSGGSLLPCSTIAEHSVEGCDHFSHDGDDDDLGFLVGGG |
| Ga0066903_1081803831 | 3300005764 | Tropical Forest Soil | MSNCVVGSGGSWPPCSTIAEHSVEGCDHFSHDGDDDDLG |
| Ga0070715_100743533 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCVVGSVGLRLPHSIIAEHSVEGSDHFSHDGDD |
| Ga0070716_1001772241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNCVVGSVGLRLPHSIIAEHSVEGSDHFSHDGDDNDLGF |
| Ga0074055_100050813 | 3300006573 | Soil | MSNCVVGSGGLRLPCSIIAEHSVEGCDHFSHDGDDDDLGFL |
| Ga0074062_128902652 | 3300006606 | Soil | MSNCVVGSGGLRLPCSIIAEHSVEGCDHFSHDGDDDDLG |
| Ga0075428_1025712001 | 3300006844 | Populus Rhizosphere | MSNCVVGSDGLRLPHSIIAEHSVEGSDHFSHDGDDNDLGFLVGVGKTVGE |
| Ga0075431_1000448551 | 3300006847 | Populus Rhizosphere | MTPRIQFLGSNCVVGSGGSRLPCSTIAEHSVESCDHFSHDGDDDDLGFF |
| Ga0068865_1010044111 | 3300006881 | Miscanthus Rhizosphere | MSNCVVGSGGFELPCSIIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0126376_102140083 | 3300010359 | Tropical Forest Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDD |
| Ga0182036_107164461 | 3300016270 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGHDDDLGFFVGG |
| Ga0182036_117438332 | 3300016270 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDDLG |
| Ga0182041_103400402 | 3300016294 | Soil | MSNCVVGSGGLRLPCSIIAEHSVESCDHFSHDGDDDDLGFF |
| Ga0182041_106656731 | 3300016294 | Soil | MSNCVVGSDGSQLPCSIIAEHSVEGCDHFSHDGDDDDLG |
| Ga0182041_107820201 | 3300016294 | Soil | MSNCVVGSGGSWLPCSIIAEHSVEGCDHFSHDGDDD |
| Ga0182033_103222702 | 3300016319 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFFVGGG |
| Ga0182033_106386481 | 3300016319 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDDDLG |
| Ga0182033_113072021 | 3300016319 | Soil | VSNCVIGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFFVSGGEA |
| Ga0182033_119126781 | 3300016319 | Soil | MSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDDDDLGFF |
| Ga0182033_119612892 | 3300016319 | Soil | MSNCVVGSGRLRLPCRIIAEHSVEGCDHFSHHGHDDDLGFFVGGG |
| Ga0182032_103877321 | 3300016357 | Soil | MSNCVVGSGGSRPPYSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0182034_102132301 | 3300016371 | Soil | VSNCVVGSGGSRLPCGAIAEHSVEGCDHFSHDGDDDDLG |
| Ga0182034_112915882 | 3300016371 | Soil | MSNCVVGSGGSWLPCSIIAEHSVEGCDHFSHDGDDDDLGFFVGGGEA |
| Ga0182040_101523441 | 3300016387 | Soil | VSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0182040_102369931 | 3300016387 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCNHFLHDGDDDDLGFF |
| Ga0182040_107942121 | 3300016387 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHDDDLGF |
| Ga0182037_103305274 | 3300016404 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHDDD |
| Ga0182037_103738212 | 3300016404 | Soil | MSNCVVRSGGLRLPCSIIAEHSVEGCDHFSHDGDDDDLGFFVGVGEA |
| Ga0182039_100350061 | 3300016422 | Soil | MSNCVVGSGGSRLPCSIIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0182039_109865662 | 3300016422 | Soil | MTPRIQFLGSNCVVGSGGLRLPYSIIAEHSVEGCDHFSHDGDDDDLGFFV |
| Ga0182038_100906781 | 3300016445 | Soil | MSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDDDDFGFFVG |
| Ga0182038_103370291 | 3300016445 | Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDL |
| Ga0184611_11393732 | 3300018067 | Groundwater Sediment | MSNCVVGSGGFRLPFNIVAEHGVEGCDHLSHDRNDDD |
| Ga0184635_100630171 | 3300018072 | Groundwater Sediment | MSNCVVGSGGLGLPCSIIAEHSVEGCDHFSHDGDDDDFG |
| Ga0184635_102325211 | 3300018072 | Groundwater Sediment | MSNCVVGSGGSRLPRGIIAEHGVEGSDHFSHDGDDDDLGF |
| Ga0184625_101418343 | 3300018081 | Groundwater Sediment | MSNCVVGSGGLGLPCSIIAEHGVEGCDHFSHDGDDDDFGF |
| Ga0184625_101500401 | 3300018081 | Groundwater Sediment | MSNCVVGSGGLGLPCSIIAEHSVEGCDHFSHDGDD |
| Ga0184625_104615092 | 3300018081 | Groundwater Sediment | MSNCVVGSGGLRLPCSIIAEHSVEGCYHFSHDGDDD |
| Ga0184628_103530452 | 3300018083 | Groundwater Sediment | VSNCVVGSGGFRLPFNIVAEHDVEGCDHLSHDRNDDD |
| Ga0193707_10893222 | 3300019881 | Soil | MSNCVVGSVGLRLPRSIIAEHSVEGSDHFSHDGDDN |
| Ga0193729_10709504 | 3300019887 | Soil | MSNCVVGSVGLRLPGSIIAEHSVEGSDHFSHDGDDD |
| Ga0193696_10569552 | 3300020016 | Soil | MSNCVVGSVGLRLPGSIIAEHSVEGSDHFSHDGDDDD |
| Ga0193696_11743371 | 3300020016 | Soil | MSNCVVGSGGSQLPRGIIAEHGVEGSDHFSHDGDD |
| Ga0210378_102997102 | 3300021073 | Groundwater Sediment | MSNCVVGSGGLRLPCSIIAEHSVEGCDHFSHDGDDDDFG |
| Ga0210406_102187153 | 3300021168 | Soil | MSNCVVGSVGLRLPRSIIAEHSVEGSDHFSHDGDD |
| Ga0210387_112351791 | 3300021405 | Soil | MSNCVVGSGGSRLPRGIIAEHSVENSDHFSHDGDDD |
| Ga0126371_101073311 | 3300021560 | Tropical Forest Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0126371_106324441 | 3300021560 | Tropical Forest Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDD |
| Ga0222623_102211932 | 3300022694 | Groundwater Sediment | MSNCVVGSGGLRLPCSIIAEHSVEGCYHFSHDGNDDDLGFL |
| Ga0222622_103248891 | 3300022756 | Groundwater Sediment | MSNCVVGSVGMRLPGSIIAEHSVEGSDHFSHDGDDDDLG |
| Ga0179589_100862411 | 3300024288 | Vadose Zone Soil | MSNCVVGSVGLRLPRSIIAEHSVEGSDHFSHDGDDNDLGFLVGVGKTV |
| Ga0207684_109806853 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCVVGSGESRLPCSTIAEHRVEGCDHFSHDGDDDDLGFFVGVGE |
| Ga0207684_116693591 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCVVGLGGLRLPCSIIAEHSVESCDHFSHDGDDDDLGFFV |
| Ga0207693_107030422 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLG |
| Ga0207712_111402471 | 3300025961 | Switchgrass Rhizosphere | MSNCVVGSVGLRLPHSIIAEHSVEGSDHFSHDGDDDDLG |
| Ga0207639_116794611 | 3300026041 | Corn Rhizosphere | MSNCVVGSGGFELPCSIIAEHSVEGCDHFSHDGDDDDLGFLVG |
| Ga0209465_102399362 | 3300027874 | Tropical Forest Soil | MSNCVVGSGGLRLPCSIIAEHSVESCDHFSHDGDDDDLGFFV |
| Ga0307285_100933601 | 3300028712 | Soil | VSNCVVGSGGFELPCSIIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0307297_100677031 | 3300028754 | Soil | MSNCVVGSVGLRLPGSIIAEHGVEGSDHFSHDGDD |
| Ga0307280_100669803 | 3300028768 | Soil | MSNCVVGSVGMRLPGSIIAEHSVEGSDHFSHDGDDD |
| Ga0307280_100831742 | 3300028768 | Soil | MSNCVVGSGGSRLPRGIIAEHGVEGSDHFSHDGDDD |
| Ga0307288_100848352 | 3300028778 | Soil | MSNCVVGSVGMRLPGSIIAEHSVEGSDHFSHDGDDDDLGFLVGVGK |
| Ga0307323_100569351 | 3300028787 | Soil | MSNCVVGSGGSRLPRGIIAEHSVEGSDHFSHDGDNDDLGFLVGVG |
| Ga0307287_101513611 | 3300028796 | Soil | MSNCVVGSGGLGLPCSIIAEHSVEGCDHFSHDGDDDDFGFL |
| Ga0307296_101213071 | 3300028819 | Soil | MSNCVVGSVGLRLPGSIIAEHSVEGSDHFSHDGDDDDLGF |
| Ga0307296_105519991 | 3300028819 | Soil | MSNCVVGSVGLRLPGSIIAEHSVEGSDHFSRDGDDDDLGFFVGTGEA |
| Ga0307312_107321752 | 3300028828 | Soil | VSNCVVGSGGFELPCSIIAEHSVDGCDHFSHDGDDDWG |
| Ga0307289_100804701 | 3300028875 | Soil | MSNCVVGSVGLRLPGSIIAEHSVEGSDHFSHDGDDDDLG |
| Ga0307286_100227281 | 3300028876 | Soil | MSNCVVGSVGMRLPGSIIAEHSVEGSDHFSHDGDD |
| Ga0307286_100249631 | 3300028876 | Soil | MSNCVVGSGGFELPCSVIAEHSVEGCDHFSHDGDDD |
| Ga0307304_101223781 | 3300028885 | Soil | MSNCVVGSVGLRLPRSIIAEHSVEGSDHFSHDGDDDDLGFLVGVGKTI |
| Ga0170820_129341741 | 3300031446 | Forest Soil | MSNCVVGSVGLRLPRSIIAEHSVEGSDHFSHDGDDDDLGFLVG |
| Ga0318516_100242131 | 3300031543 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDLGFFV |
| Ga0318516_101099461 | 3300031543 | Soil | MSNCVVGSDGSRLPCSIIAEHSVEGCDHFSHDGDDDD |
| Ga0318534_100266454 | 3300031544 | Soil | MSNCVVGSDGSRLPCSIIAEHSVEGCDHFSHDGDDDDLGFFV |
| Ga0318541_100238041 | 3300031545 | Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDD |
| Ga0318541_100253941 | 3300031545 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDD |
| Ga0318541_102252292 | 3300031545 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0318538_100411641 | 3300031546 | Soil | MSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDDDDLGF |
| Ga0318538_100895231 | 3300031546 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0310887_104325731 | 3300031547 | Soil | MSNCVVGSGGFELPCSVIVEHSVECCDHFSHDGDDDDLGF |
| Ga0318571_100937481 | 3300031549 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGHDDD |
| Ga0318528_102906642 | 3300031561 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDL |
| Ga0318528_106624461 | 3300031561 | Soil | MSNCVVGSDGSQLPCSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0318515_100544631 | 3300031572 | Soil | VSNCVVGSGGSWLPCSIIAEHSVEGCDHFSHDGDDDDLGFFVGG |
| Ga0318515_103611121 | 3300031572 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDD |
| Ga0310915_100609271 | 3300031573 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0310915_101107075 | 3300031573 | Soil | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDD |
| Ga0310915_101432491 | 3300031573 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDD |
| Ga0310915_101988653 | 3300031573 | Soil | MSNCVVGSGGSRLPRSAIAEHSVEGCEHFSHDGHDDDL |
| Ga0310915_102403321 | 3300031573 | Soil | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLGFF |
| Ga0310915_104812422 | 3300031573 | Soil | MSNCVVGSGGLRLPYSIIAEHSVEGRDHFSHDGDDDDLGFFVGVGEAI |
| Ga0318542_101778662 | 3300031668 | Soil | MSNCVVGSDGSRLPCSIIAEHSVEGCDHFSHDGDDDDL |
| Ga0318561_100942883 | 3300031679 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDD |
| Ga0318561_102466181 | 3300031679 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGHDDDLGFFVGGDEA |
| Ga0318560_100213821 | 3300031682 | Soil | VSNCVVGSGGSWLPCSTIAEHSVEGGDHFSHDGDYDD |
| Ga0306917_103105821 | 3300031719 | Soil | MSNCVVRSGGLRLPCSVIAKHSVEGCDHFSHDGDDDDLGF |
| Ga0306917_103354993 | 3300031719 | Soil | MSNCVVGSGGSRLPCSIIAEHSVEGCDHFSHDGHDDD |
| Ga0318493_108413122 | 3300031723 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDDD |
| Ga0318501_100617811 | 3300031736 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDD |
| Ga0318501_101986791 | 3300031736 | Soil | VSNCVVGSGRSRLPCSIIAEHSVEGCDHFSHHGHDDDLGF |
| Ga0306918_100544295 | 3300031744 | Soil | VSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDD |
| Ga0306918_102266182 | 3300031744 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0306918_102937792 | 3300031744 | Soil | VSNCVVGSGGSRLPCGAIAEHSVEGCDHFSHDGDDDDL |
| Ga0306918_106604441 | 3300031744 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0318502_108342391 | 3300031747 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGDDDD |
| Ga0318492_102791952 | 3300031748 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHDDDLGFF |
| Ga0318537_100442041 | 3300031763 | Soil | MTTRIQFLGSNCVVGSGGLRLPCSTIAEHSVEGCDHFSHDGHDDDLGFFVG |
| Ga0318537_100532404 | 3300031763 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDDDL |
| Ga0318509_100223886 | 3300031768 | Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0318509_105022002 | 3300031768 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDD |
| Ga0318521_105281162 | 3300031770 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDDL |
| Ga0318521_108614301 | 3300031770 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHDDDL |
| Ga0318546_110190102 | 3300031771 | Soil | VSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDH |
| Ga0318543_100076161 | 3300031777 | Soil | MTTRIQFLGSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGHDDD |
| Ga0318543_101265453 | 3300031777 | Soil | MSNCVVGSGGSRLPYSIIAEQSVEGCDHFSHDGDD |
| Ga0318552_105329681 | 3300031782 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGHDDDL |
| Ga0318529_104677332 | 3300031792 | Soil | MSNCVVGSGGLRLPYSIIAEHSVEGCDHFSHDGDDD |
| Ga0318529_105670511 | 3300031792 | Soil | MSNCVVGSGGSRLPRSAIAEHSVEGCEHFSHDGHDD |
| Ga0318503_100280101 | 3300031794 | Soil | MTTRIQFLGSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDDDD |
| Ga0318503_100659232 | 3300031794 | Soil | MSNCVVGSGGSRLPCSTIAEHRGEGCDHFSHDGHDDD |
| Ga0318576_102893001 | 3300031796 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDD |
| Ga0318550_101953411 | 3300031797 | Soil | MSNCVVGSGGLRLPYSIIAEHSVEGCDHFSHDGDDDD |
| Ga0318523_106212591 | 3300031798 | Soil | VSNCVVGSDGSRLPCSIIAEHSVEGCDHFSHDGDDDD |
| Ga0318565_101620972 | 3300031799 | Soil | MSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDD |
| Ga0318497_105900611 | 3300031805 | Soil | MSNCVVGSGGSRLPYSSIAEHSGEGCDHFSHDGDDDD |
| Ga0318568_106061571 | 3300031819 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCNHFSHDGDDDDLGFF |
| Ga0318567_108131711 | 3300031821 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGHD |
| Ga0318499_101558242 | 3300031832 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGHDDDLGF |
| Ga0310917_101625942 | 3300031833 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGHDDDLG |
| Ga0310917_110967412 | 3300031833 | Soil | MSNCVVGSGGSRLPCSTIAEHRVEGGDHFSHDGDDDDLGFF |
| Ga0306919_100217941 | 3300031879 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGHD |
| Ga0306919_100923071 | 3300031879 | Soil | MSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0306919_115158092 | 3300031879 | Soil | MSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0306925_100768135 | 3300031890 | Soil | VSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDDLGFFV |
| Ga0306925_101570911 | 3300031890 | Soil | VSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDD |
| Ga0306925_101791043 | 3300031890 | Soil | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLGFFVGVGE |
| Ga0306925_102006311 | 3300031890 | Soil | MSNCVVGSGGLRLPYSIIAEHSVEGRDHFSHDGDD |
| Ga0306925_103291604 | 3300031890 | Soil | VSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDD |
| Ga0306925_105314432 | 3300031890 | Soil | MSNCAVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLGFFVGVGE |
| Ga0306925_114847122 | 3300031890 | Soil | MSNCVVGSGGSRLPCSTIAEHRVEGCNHFSHDGDD |
| Ga0318536_100816703 | 3300031893 | Soil | MSNCVVGSGGSRLPYSIIAEHSVEGCDHFSHDGDDDD |
| Ga0306923_102280651 | 3300031910 | Soil | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLGF |
| Ga0306923_104567902 | 3300031910 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGHDDDLGFFV |
| Ga0306923_106366422 | 3300031910 | Soil | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDD |
| Ga0306923_106579031 | 3300031910 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHD |
| Ga0306923_106813523 | 3300031910 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCDHFSHDGDDD |
| Ga0306923_110897171 | 3300031910 | Soil | MSNCVVGSGGSRLPCSTIAKHSVEGCDHFSHDGHDDDPAGCVVTH |
| Ga0306923_114439272 | 3300031910 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGDDDDLG |
| Ga0306923_115374361 | 3300031910 | Soil | VSNCVVGSGGLRPPYSIIAEHSVEGCDHFSHDGDDDDLGFFV |
| Ga0306923_119121471 | 3300031910 | Soil | MSNCVVGSGGSRLPCSTIAEHRVEGCNHFSHDGDDDDLGFFVGVGE |
| Ga0306921_103402381 | 3300031912 | Soil | MSNCVVGSDGSQLPCSIIAEHSVEGCDHFSHDGDDDDLGFFVGG |
| Ga0306921_105299961 | 3300031912 | Soil | MSNCVVGSGGSWPPCSTIAEHSVEGCDHFSHDGDDDD |
| Ga0306921_105568921 | 3300031912 | Soil | VSNCAVGSGGSRLPCGAIAEHSVEGCDHFSHDGDDDHLGFFVGG |
| Ga0306921_106927161 | 3300031912 | Soil | MSGRVSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDD |
| Ga0306921_127333171 | 3300031912 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGHDDDLGFFVGG |
| Ga0310912_100961931 | 3300031941 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFFV |
| Ga0310912_108159761 | 3300031941 | Soil | MSNCVVGSGGLRLPYSIIAEHSVEGRDHFSHDGDDDDLGFF |
| Ga0310912_110109661 | 3300031941 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0310916_100829174 | 3300031942 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDDDDLGFFVGGGE |
| Ga0310916_117595942 | 3300031942 | Soil | MSNCVVRSGGLRLPCSIIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0310913_102851562 | 3300031945 | Soil | MSNCVVGSGGSWLPCSTIAEHGVEGCDHFSHDGDDDDLGFF |
| Ga0310910_102599211 | 3300031946 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGDDGDLGFFVG |
| Ga0310910_107839611 | 3300031946 | Soil | MSNCVVGSGGSWLPCSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0310909_100171706 | 3300031947 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGDDDDLGF |
| Ga0310909_112379092 | 3300031947 | Soil | MSNCVVGSGGSRLPCSTIAEHRVEGCDHFSHDGDDDDLG |
| Ga0306922_101471301 | 3300032001 | Soil | MSNCVVRSGGLRLPCSIIAKHSVESCDHFSHDGDD |
| Ga0306922_101809493 | 3300032001 | Soil | MSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDD |
| Ga0318556_100164864 | 3300032043 | Soil | MSNCVVGSDGSRLPCSIIAEHSVEGCDHFSHDGDD |
| Ga0318575_105042761 | 3300032055 | Soil | MYSRLTMKRVSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDD |
| Ga0318533_102500933 | 3300032059 | Soil | VSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDDD |
| Ga0318505_101166771 | 3300032060 | Soil | MSNCVVGSGGSRLPCSIIAEHSVEGCDHFSHDGHDDDL |
| Ga0318504_100265351 | 3300032063 | Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDHFSHDGDDDDLG |
| Ga0318504_103036061 | 3300032063 | Soil | MSNCVVGSGGLRLPCSAIAEHSVEGCDHFSHDGDDDDLG |
| Ga0318553_105015682 | 3300032068 | Soil | MSNCVVGSGGSRLPRSAIAEHSVEGCEHFSHDGHDDDLGFFVGGDEA |
| Ga0306924_101592661 | 3300032076 | Soil | VSNCVVGSGGSWLPCSTIAEHSVEGCDQFSHDGDDDDLGFF |
| Ga0306924_102512941 | 3300032076 | Soil | MSNCVVGSGGSRLPCSTIAEHSVEGCDHFSHDGDD |
| Ga0306924_103738941 | 3300032076 | Soil | MSNCVVGSGGSRLPRSAIAEHSVEGCEHFSHDGHDDDLGFFVGGD |
| Ga0306924_104182951 | 3300032076 | Soil | MSNCVVGSDGSRLPCSTIAEHSVEGCDHFSHDGHDDDLGFFVGGD |
| Ga0306924_107103101 | 3300032076 | Soil | MSNCAVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDD |
| Ga0318577_100685191 | 3300032091 | Soil | VSNCVVGSGGLRLPCTIIAEHSVEGCEHFSHDGHDD |
| Ga0311301_105719213 | 3300032160 | Peatlands Soil | MSNCVVGSGGFRLPINIVAEHGVEGCDHLSYDRND |
| Ga0307470_118051862 | 3300032174 | Hardwood Forest Soil | MSNCVVGSGVSWLPCSTIAEHSVEGCDHFSHDGDDDDLGF |
| Ga0307471_1007144642 | 3300032180 | Hardwood Forest Soil | MSNCVVGSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLG |
| Ga0306920_1002383396 | 3300032261 | Soil | MSNCVVGSDGSQLPCSIIAEHSVEGCDHFSHDGDDDDLGFFVGGGEA |
| Ga0306920_1006151355 | 3300032261 | Soil | VSNCVVRSGGLRLPCSIIAKHSVEGCDHFSHDGDDDDLGF |
| Ga0306920_1009004311 | 3300032261 | Soil | MSNCVVGSGGSRLPCSTIAEHGVEGCDHFSHDGDDDDLGFFV |
| Ga0306920_1016365751 | 3300032261 | Soil | VSNCVVGSDGSRLPCSIIAEHSVEGCDHFSHDGDDDDLGFF |
| Ga0310914_102919671 | 3300033289 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCEHFSHDGDDDDLGFFV |
| Ga0310914_114460442 | 3300033289 | Soil | MSNCVVGSGGSRLPCSAIAEHSVEGCDHFSHDGHDDDLGF |
| ⦗Top⦘ |