


| Basic Information | |
|---|---|
| Family ID | F025238 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 202 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRINIWIVLVVLIALLAVTRLLRYQQDTQRICADDPSASVCGR |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.96 % |
| % of genes near scaffold ends (potentially truncated) | 65.84 % |
| % of genes from short scaffolds (< 2000 bps) | 87.62 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.495 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.634 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.980 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF05050 | Methyltransf_21 | 2.97 |
| PF04392 | ABC_sub_bind | 1.98 |
| PF08379 | Bact_transglu_N | 1.98 |
| PF08734 | GYD | 1.98 |
| PF02371 | Transposase_20 | 1.49 |
| PF00005 | ABC_tran | 1.49 |
| PF00656 | Peptidase_C14 | 1.49 |
| PF00239 | Resolvase | 1.49 |
| PF01527 | HTH_Tnp_1 | 1.49 |
| PF03551 | PadR | 0.99 |
| PF03401 | TctC | 0.50 |
| PF00550 | PP-binding | 0.50 |
| PF11146 | DUF2905 | 0.50 |
| PF09834 | DUF2061 | 0.50 |
| PF08281 | Sigma70_r4_2 | 0.50 |
| PF13412 | HTH_24 | 0.50 |
| PF05598 | DUF772 | 0.50 |
| PF01042 | Ribonuc_L-PSP | 0.50 |
| PF03767 | Acid_phosphat_B | 0.50 |
| PF04966 | OprB | 0.50 |
| PF07992 | Pyr_redox_2 | 0.50 |
| PF13701 | DDE_Tnp_1_4 | 0.50 |
| PF01494 | FAD_binding_3 | 0.50 |
| PF07045 | DUF1330 | 0.50 |
| PF01740 | STAS | 0.50 |
| PF08867 | FRG | 0.50 |
| PF13683 | rve_3 | 0.50 |
| PF04519 | Bactofilin | 0.50 |
| PF09339 | HTH_IclR | 0.50 |
| PF01068 | DNA_ligase_A_M | 0.50 |
| PF01841 | Transglut_core | 0.50 |
| PF13185 | GAF_2 | 0.50 |
| PF10028 | DUF2270 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
|---|---|---|---|
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 1.98 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.98 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.98 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.49 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.49 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.49 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 1.49 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.99 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.99 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.99 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.99 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.50 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.50 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.50 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.50 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.50 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.50 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.50 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.50 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.50 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.50 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.50 % |
| Unclassified | root | N/A | 49.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10176731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1060427 | Not Available | 505 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1003074 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1039392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300002906|JGI25614J43888_10034408 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300002917|JGI25616J43925_10175072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300004633|Ga0066395_10052352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae → Afifella → unclassified Afifella → Afifella sp. IM 167 | 1812 | Open in IMG/M |
| 3300004633|Ga0066395_10178271 | Not Available | 1097 | Open in IMG/M |
| 3300004633|Ga0066395_10443771 | Not Available | 739 | Open in IMG/M |
| 3300005174|Ga0066680_10148430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1465 | Open in IMG/M |
| 3300005174|Ga0066680_10733201 | Not Available | 603 | Open in IMG/M |
| 3300005176|Ga0066679_10789403 | Not Available | 607 | Open in IMG/M |
| 3300005178|Ga0066688_10680936 | Not Available | 655 | Open in IMG/M |
| 3300005332|Ga0066388_101029679 | Not Available | 1383 | Open in IMG/M |
| 3300005332|Ga0066388_101353695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1232 | Open in IMG/M |
| 3300005332|Ga0066388_101749090 | Not Available | 1103 | Open in IMG/M |
| 3300005332|Ga0066388_104931736 | Not Available | 678 | Open in IMG/M |
| 3300005332|Ga0066388_107369573 | Not Available | 552 | Open in IMG/M |
| 3300005332|Ga0066388_108147188 | Not Available | 523 | Open in IMG/M |
| 3300005363|Ga0008090_10020087 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300005363|Ga0008090_10080794 | Not Available | 641 | Open in IMG/M |
| 3300005434|Ga0070709_10069244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2272 | Open in IMG/M |
| 3300005447|Ga0066689_10420549 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005450|Ga0066682_10978383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300005467|Ga0070706_100026112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5374 | Open in IMG/M |
| 3300005468|Ga0070707_100591994 | Not Available | 1071 | Open in IMG/M |
| 3300005713|Ga0066905_100434845 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005713|Ga0066905_101051743 | Not Available | 720 | Open in IMG/M |
| 3300005764|Ga0066903_100438700 | Not Available | 2174 | Open in IMG/M |
| 3300005764|Ga0066903_102037592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1103 | Open in IMG/M |
| 3300005764|Ga0066903_105274683 | Not Available | 683 | Open in IMG/M |
| 3300005764|Ga0066903_105431592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 672 | Open in IMG/M |
| 3300005764|Ga0066903_105598587 | Not Available | 661 | Open in IMG/M |
| 3300005764|Ga0066903_106304520 | Not Available | 619 | Open in IMG/M |
| 3300005764|Ga0066903_106397686 | Not Available | 614 | Open in IMG/M |
| 3300005764|Ga0066903_106511561 | Not Available | 608 | Open in IMG/M |
| 3300005764|Ga0066903_106858004 | Not Available | 591 | Open in IMG/M |
| 3300005764|Ga0066903_107347006 | Not Available | 569 | Open in IMG/M |
| 3300005764|Ga0066903_107998487 | Not Available | 542 | Open in IMG/M |
| 3300005764|Ga0066903_108580928 | Not Available | 520 | Open in IMG/M |
| 3300006797|Ga0066659_10189013 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300006847|Ga0075431_102091215 | Not Available | 521 | Open in IMG/M |
| 3300006854|Ga0075425_100365378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1661 | Open in IMG/M |
| 3300009143|Ga0099792_10024972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2710 | Open in IMG/M |
| 3300010046|Ga0126384_10197350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
| 3300010046|Ga0126384_10576332 | Not Available | 982 | Open in IMG/M |
| 3300010047|Ga0126382_10047821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2484 | Open in IMG/M |
| 3300010048|Ga0126373_10064389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3294 | Open in IMG/M |
| 3300010048|Ga0126373_10333462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1524 | Open in IMG/M |
| 3300010048|Ga0126373_11957223 | Not Available | 649 | Open in IMG/M |
| 3300010048|Ga0126373_12839202 | Not Available | 541 | Open in IMG/M |
| 3300010323|Ga0134086_10119469 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300010358|Ga0126370_12320770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010359|Ga0126376_11533451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300010359|Ga0126376_11932363 | Not Available | 630 | Open in IMG/M |
| 3300010360|Ga0126372_10306462 | Not Available | 1399 | Open in IMG/M |
| 3300010360|Ga0126372_13025883 | Not Available | 522 | Open in IMG/M |
| 3300010361|Ga0126378_10956119 | Not Available | 962 | Open in IMG/M |
| 3300010361|Ga0126378_10995417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300010366|Ga0126379_11719022 | Not Available | 732 | Open in IMG/M |
| 3300010366|Ga0126379_11805406 | Not Available | 715 | Open in IMG/M |
| 3300010376|Ga0126381_101032260 | Not Available | 1187 | Open in IMG/M |
| 3300010376|Ga0126381_101107137 | Not Available | 1144 | Open in IMG/M |
| 3300010376|Ga0126381_102664820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 715 | Open in IMG/M |
| 3300010376|Ga0126381_102925486 | Not Available | 680 | Open in IMG/M |
| 3300010376|Ga0126381_103765560 | Not Available | 593 | Open in IMG/M |
| 3300010398|Ga0126383_12062219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300010863|Ga0124850_1064367 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300010868|Ga0124844_1075853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ERR14 | 1247 | Open in IMG/M |
| 3300012189|Ga0137388_12003706 | Not Available | 507 | Open in IMG/M |
| 3300012360|Ga0137375_10567861 | Not Available | 951 | Open in IMG/M |
| 3300012362|Ga0137361_11860488 | Not Available | 519 | Open in IMG/M |
| 3300012582|Ga0137358_10205247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
| 3300012923|Ga0137359_10434316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
| 3300012971|Ga0126369_10175541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2042 | Open in IMG/M |
| 3300012971|Ga0126369_11201599 | Not Available | 848 | Open in IMG/M |
| 3300012971|Ga0126369_11812269 | Not Available | 699 | Open in IMG/M |
| 3300012971|Ga0126369_12268731 | Not Available | 630 | Open in IMG/M |
| 3300016270|Ga0182036_10266457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
| 3300016270|Ga0182036_10900022 | Not Available | 725 | Open in IMG/M |
| 3300016294|Ga0182041_10629268 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300016294|Ga0182041_11417643 | Not Available | 638 | Open in IMG/M |
| 3300016294|Ga0182041_12006979 | Not Available | 539 | Open in IMG/M |
| 3300016341|Ga0182035_10626356 | Not Available | 932 | Open in IMG/M |
| 3300016341|Ga0182035_11044329 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300016357|Ga0182032_11219213 | Not Available | 648 | Open in IMG/M |
| 3300016357|Ga0182032_11249099 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300016357|Ga0182032_11481538 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300016371|Ga0182034_10361434 | Not Available | 1181 | Open in IMG/M |
| 3300016387|Ga0182040_11469276 | Not Available | 578 | Open in IMG/M |
| 3300016387|Ga0182040_11628840 | Not Available | 550 | Open in IMG/M |
| 3300016404|Ga0182037_10153087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1740 | Open in IMG/M |
| 3300016404|Ga0182037_11084416 | Not Available | 700 | Open in IMG/M |
| 3300016404|Ga0182037_11342685 | Not Available | 631 | Open in IMG/M |
| 3300016422|Ga0182039_11313052 | Not Available | 656 | Open in IMG/M |
| 3300016422|Ga0182039_11585728 | Not Available | 597 | Open in IMG/M |
| 3300018431|Ga0066655_10864359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300021178|Ga0210408_10195320 | Not Available | 1609 | Open in IMG/M |
| 3300021560|Ga0126371_10102809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2850 | Open in IMG/M |
| 3300021560|Ga0126371_10423741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1475 | Open in IMG/M |
| 3300021560|Ga0126371_10644394 | Not Available | 1208 | Open in IMG/M |
| 3300021560|Ga0126371_10708265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1155 | Open in IMG/M |
| 3300021560|Ga0126371_10936242 | Not Available | 1009 | Open in IMG/M |
| 3300021560|Ga0126371_12060081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 687 | Open in IMG/M |
| 3300021560|Ga0126371_12607973 | Not Available | 612 | Open in IMG/M |
| 3300021560|Ga0126371_12672018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300021560|Ga0126371_13281876 | Not Available | 547 | Open in IMG/M |
| 3300025922|Ga0207646_10255058 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300025939|Ga0207665_10043240 | All Organisms → cellular organisms → Bacteria | 3012 | Open in IMG/M |
| 3300026313|Ga0209761_1096428 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300026325|Ga0209152_10030369 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300026343|Ga0209159_1246902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300027874|Ga0209465_10293205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300027874|Ga0209465_10529169 | Not Available | 588 | Open in IMG/M |
| 3300031544|Ga0318534_10132584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1434 | Open in IMG/M |
| 3300031544|Ga0318534_10462825 | Not Available | 726 | Open in IMG/M |
| 3300031545|Ga0318541_10005069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5501 | Open in IMG/M |
| 3300031545|Ga0318541_10030323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2674 | Open in IMG/M |
| 3300031545|Ga0318541_10053530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2079 | Open in IMG/M |
| 3300031545|Ga0318541_10195639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1118 | Open in IMG/M |
| 3300031549|Ga0318571_10199786 | Not Available | 715 | Open in IMG/M |
| 3300031561|Ga0318528_10167151 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031564|Ga0318573_10314590 | Not Available | 839 | Open in IMG/M |
| 3300031572|Ga0318515_10365177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300031572|Ga0318515_10433770 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031573|Ga0310915_10068336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2335 | Open in IMG/M |
| 3300031573|Ga0310915_10106642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1899 | Open in IMG/M |
| 3300031573|Ga0310915_10375090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300031573|Ga0310915_10436412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300031668|Ga0318542_10511723 | Not Available | 624 | Open in IMG/M |
| 3300031679|Ga0318561_10180978 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300031682|Ga0318560_10517693 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031713|Ga0318496_10181858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1153 | Open in IMG/M |
| 3300031724|Ga0318500_10002491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5328 | Open in IMG/M |
| 3300031724|Ga0318500_10408848 | Not Available | 675 | Open in IMG/M |
| 3300031747|Ga0318502_10294940 | Not Available | 953 | Open in IMG/M |
| 3300031754|Ga0307475_10435586 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300031763|Ga0318537_10129787 | Not Available | 937 | Open in IMG/M |
| 3300031764|Ga0318535_10534665 | Not Available | 520 | Open in IMG/M |
| 3300031768|Ga0318509_10336047 | Not Available | 845 | Open in IMG/M |
| 3300031770|Ga0318521_10020364 | Not Available | 3087 | Open in IMG/M |
| 3300031771|Ga0318546_10137515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1637 | Open in IMG/M |
| 3300031792|Ga0318529_10287912 | Not Available | 765 | Open in IMG/M |
| 3300031795|Ga0318557_10262381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300031798|Ga0318523_10169257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300031799|Ga0318565_10616223 | Not Available | 521 | Open in IMG/M |
| 3300031805|Ga0318497_10234621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1016 | Open in IMG/M |
| 3300031821|Ga0318567_10035147 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2521 | Open in IMG/M |
| 3300031831|Ga0318564_10305550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 702 | Open in IMG/M |
| 3300031832|Ga0318499_10391518 | Not Available | 532 | Open in IMG/M |
| 3300031833|Ga0310917_10300666 | Not Available | 1085 | Open in IMG/M |
| 3300031835|Ga0318517_10375891 | Not Available | 642 | Open in IMG/M |
| 3300031879|Ga0306919_10627112 | Not Available | 829 | Open in IMG/M |
| 3300031880|Ga0318544_10147592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
| 3300031880|Ga0318544_10349315 | Not Available | 574 | Open in IMG/M |
| 3300031890|Ga0306925_10531922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1248 | Open in IMG/M |
| 3300031890|Ga0306925_11702914 | Not Available | 608 | Open in IMG/M |
| 3300031894|Ga0318522_10139220 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031896|Ga0318551_10335355 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031897|Ga0318520_10202151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1172 | Open in IMG/M |
| 3300031897|Ga0318520_10554201 | Not Available | 713 | Open in IMG/M |
| 3300031897|Ga0318520_10877074 | Not Available | 564 | Open in IMG/M |
| 3300031910|Ga0306923_10141687 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300031910|Ga0306923_10144695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2710 | Open in IMG/M |
| 3300031912|Ga0306921_10359920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1700 | Open in IMG/M |
| 3300031941|Ga0310912_10404462 | Not Available | 1063 | Open in IMG/M |
| 3300031942|Ga0310916_10041835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3452 | Open in IMG/M |
| 3300031942|Ga0310916_10049442 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300031942|Ga0310916_10824072 | Not Available | 780 | Open in IMG/M |
| 3300031942|Ga0310916_11369504 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031945|Ga0310913_11116345 | Not Available | 550 | Open in IMG/M |
| 3300031945|Ga0310913_11127233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300031946|Ga0310910_10007179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6756 | Open in IMG/M |
| 3300031946|Ga0310910_11305749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031946|Ga0310910_11369015 | Not Available | 545 | Open in IMG/M |
| 3300031947|Ga0310909_10032774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3873 | Open in IMG/M |
| 3300031947|Ga0310909_11061699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031947|Ga0310909_11593756 | Not Available | 518 | Open in IMG/M |
| 3300031959|Ga0318530_10261655 | Not Available | 713 | Open in IMG/M |
| 3300032001|Ga0306922_11016578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300032001|Ga0306922_11041354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300032001|Ga0306922_11520762 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300032008|Ga0318562_10865857 | Not Available | 516 | Open in IMG/M |
| 3300032010|Ga0318569_10255802 | Not Available | 814 | Open in IMG/M |
| 3300032035|Ga0310911_10006279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 5174 | Open in IMG/M |
| 3300032035|Ga0310911_10447097 | Not Available | 748 | Open in IMG/M |
| 3300032043|Ga0318556_10240409 | Not Available | 945 | Open in IMG/M |
| 3300032051|Ga0318532_10265891 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032054|Ga0318570_10452232 | Not Available | 586 | Open in IMG/M |
| 3300032059|Ga0318533_10464652 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 926 | Open in IMG/M |
| 3300032059|Ga0318533_10541766 | Not Available | 853 | Open in IMG/M |
| 3300032063|Ga0318504_10480623 | Not Available | 594 | Open in IMG/M |
| 3300032065|Ga0318513_10380733 | Not Available | 688 | Open in IMG/M |
| 3300032065|Ga0318513_10573119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300032065|Ga0318513_10584162 | Not Available | 547 | Open in IMG/M |
| 3300032076|Ga0306924_11405139 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300032261|Ga0306920_100095185 | All Organisms → cellular organisms → Bacteria | 4404 | Open in IMG/M |
| 3300032261|Ga0306920_100897024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300032261|Ga0306920_101634294 | Not Available | 915 | Open in IMG/M |
| 3300032261|Ga0306920_102145138 | Not Available | 778 | Open in IMG/M |
| 3300033289|Ga0310914_10984588 | Not Available | 743 | Open in IMG/M |
| 3300033290|Ga0318519_10276723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 977 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101767311 | 3300000597 | Forest Soil | MRINIWIVLVVLLALLAVTRLWHYQHDTQRICADDPSASVCG |
| AP72_2010_repI_A10DRAFT_10604271 | 3300000651 | Forest Soil | MRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALV |
| AF_2010_repII_A100DRAFT_10030746 | 3300000655 | Forest Soil | MRINVWIVVIVLIALFAVTRLLRYQQDTQRICADDPSASVCQR* |
| AF_2010_repII_A100DRAFT_10393922 | 3300000655 | Forest Soil | MRINIWIIVAVLLALLATTRLLQYQHETQRICADDPSASVCGR* |
| JGI25614J43888_100344084 | 3300002906 | Grasslands Soil | MRINIWIVLAILLVLLAVTRYAQYQRDTQERICVDDPSASVCERM* |
| JGI25616J43925_101750722 | 3300002917 | Grasslands Soil | MRINIWIVLVVLLALLAVTRLWRYQHDTQRICADDPSASVCGR* |
| Ga0066395_100523522 | 3300004633 | Tropical Forest Soil | MRINIWIVLAVLLALLAVTRLSQYQHETQRICADDPSASVCVR* |
| Ga0066395_101782712 | 3300004633 | Tropical Forest Soil | MRINIWIVLIVLIALFAVTRLLRYQQDTQRICADDPSASVCEGH* |
| Ga0066395_104437712 | 3300004633 | Tropical Forest Soil | MRVNIWIVLMVLIALFAVTRLLRYYQDTQRICADDPTASVCRR* |
| Ga0066680_101484301 | 3300005174 | Soil | QRGGRAALMRINIWIVLAVLLALLATTRLLQYQHETQRICADDSD* |
| Ga0066680_107332012 | 3300005174 | Soil | MRINIWIVLAILLVLLAVTRYAQYQRDTQERICVDDPSASVC |
| Ga0066679_107894031 | 3300005176 | Soil | MRINIWIVLAILLVLLAVTRYAQYQRDTQERICVDDPSASVCERI* |
| Ga0066688_106809363 | 3300005178 | Soil | MRINIWIVLIVLIALLAVTRLWRYQHDTQRICADDPSASVCGR*ASRF |
| Ga0066388_1010296792 | 3300005332 | Tropical Forest Soil | MRINVWIVLIVLIALFAATRLLRYHQDTQRICADDPSASVCER* |
| Ga0066388_1013536952 | 3300005332 | Tropical Forest Soil | MRINIWIVLAALLALLAVTRLLQYQRDTQRICADDPSAPVCER* |
| Ga0066388_1017490901 | 3300005332 | Tropical Forest Soil | ALMRINIWIVLVVLIALFAVTRFLRYQQDQDQRICVEDPSASMCER* |
| Ga0066388_1049317362 | 3300005332 | Tropical Forest Soil | MRINVWIVLVVLISLFAVTRLLRYHQDTQRICADDPTASVCVRLRASRLA* |
| Ga0066388_1073695732 | 3300005332 | Tropical Forest Soil | MRINIWIVLIVLIALFAVTRLLRYQQDTQRICADDPSASVCER* |
| Ga0066388_1081471882 | 3300005332 | Tropical Forest Soil | MRINVWIVLIVLIALFAVTRLLRYQQDTQRICADDPSASVCAR* |
| Ga0008090_100200871 | 3300005363 | Tropical Rainforest Soil | VGTNQRQGAALMRVNIWIVLIVLIALFAVTRLLRYYEDTQRICADDPSASACER* |
| Ga0008090_100807942 | 3300005363 | Tropical Rainforest Soil | GAALMRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASACGR* |
| Ga0070709_100692443 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRINIWTILVVLLALLAVMAVTRLSRYQHDTQRICNDDPGASVWAR* |
| Ga0066689_104205492 | 3300005447 | Soil | IVAALMRINIWIVLGVLLVLLAVTRLWRYQQDTQRICADDPSASVCGR* |
| Ga0066682_109783832 | 3300005450 | Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADDPSASVCGR* |
| Ga0070706_1000261129 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | INIWIVLGVLLVLLAVTRLWRYQQDTQRICADDPSASVCGR* |
| Ga0070707_1005919942 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASVCGR* |
| Ga0066905_1004348453 | 3300005713 | Tropical Forest Soil | MRINIWIVVIVLIALWAVTWLVRHQQDTNRICADD |
| Ga0066905_1010517431 | 3300005713 | Tropical Forest Soil | LMRINIWIVVIVLIALWAVTWLVRHQQDTHRICADDPSASVCGR* |
| Ga0066903_1004387003 | 3300005764 | Tropical Forest Soil | MRVNIWIVLMVLIALFAVTRLLRYYQDTQRICADDPTASVCGR* |
| Ga0066903_1020375922 | 3300005764 | Tropical Forest Soil | MMRFNVLIVLVVLIALFAVTRLLRYHQDTQRICADDPSASVCAR* |
| Ga0066903_1052746832 | 3300005764 | Tropical Forest Soil | RAALMRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSASVCGR* |
| Ga0066903_1054315922 | 3300005764 | Tropical Forest Soil | MRINIWIVLAVLLALFAITRLLQYQHETQRICADDPSASVCRR* |
| Ga0066903_1055985871 | 3300005764 | Tropical Forest Soil | MRINIWIVLIVLIVLFAVTRLLQYQRDTQRICADDPSASVCAR* |
| Ga0066903_1063045202 | 3300005764 | Tropical Forest Soil | ALMRINVWVVLIVLIALFAVTRLLRYHQDTQRICADDPSVSVCVR* |
| Ga0066903_1063976862 | 3300005764 | Tropical Forest Soil | MRINVWIVLVVLIALFALTRFLRYQQDTQRICADDPSASVCER* |
| Ga0066903_1065115613 | 3300005764 | Tropical Forest Soil | FALMRINIWIVLIVLIVLFAVTRLLQYQGDTRRICADDPSASVCAR* |
| Ga0066903_1068580041 | 3300005764 | Tropical Forest Soil | KAALMRINIWIVLAVLLALLAITRLSQYQHDTQRICADDPSASVCRR* |
| Ga0066903_1073470062 | 3300005764 | Tropical Forest Soil | MRINVWIVLIVLIALFAVTRLLRYQQDTQRICADDPS |
| Ga0066903_1079984871 | 3300005764 | Tropical Forest Soil | LIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR* |
| Ga0066903_1085809281 | 3300005764 | Tropical Forest Soil | MHINIWIVLAVLLALLAITRLSQYQHETQRICADDPSASVCRR* |
| Ga0066659_101890132 | 3300006797 | Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADGSD* |
| Ga0075431_1020912153 | 3300006847 | Populus Rhizosphere | MRINIWIVLAVLLALLAVTRLSQYQQDTRRICADYPSASVCE |
| Ga0075425_1003653784 | 3300006854 | Populus Rhizosphere | MRINIWIVLAVLLALLATTQLLQYQHETQRICADDPSASVCGR* |
| Ga0099792_100249722 | 3300009143 | Vadose Zone Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADDSD* |
| Ga0126384_101973502 | 3300010046 | Tropical Forest Soil | MRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSASVCGR* |
| Ga0126384_105763322 | 3300010046 | Tropical Forest Soil | MRINVWIVVIALIALFAVTRLLRYQQDTQRICADDPSASVCQR* |
| Ga0126382_100478212 | 3300010047 | Tropical Forest Soil | MRINIWIVVIVLIALWAVTWLVRHQQDTHRICADDPSASVCGR* |
| Ga0126373_100643897 | 3300010048 | Tropical Forest Soil | MRLNIWIVLVVLMALLAVTQLLRYQQDTQRICADDPSASACQR* |
| Ga0126373_103334623 | 3300010048 | Tropical Forest Soil | MRINVWVVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCVR* |
| Ga0126373_119572231 | 3300010048 | Tropical Forest Soil | MRINVWIVLIVLIALFAATRLLRYHQDTQRICADDPSASVC |
| Ga0126373_128392022 | 3300010048 | Tropical Forest Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADDLSASVCGR* |
| Ga0134086_101194691 | 3300010323 | Grasslands Soil | NIWIVLAVLLALLATTRLLQYQHETQRICADDSD* |
| Ga0126370_123207701 | 3300010358 | Tropical Forest Soil | MRINVWIVLVFLIALFALTRFLRYQQDTQRICADDPSASV |
| Ga0126376_115334511 | 3300010359 | Tropical Forest Soil | MRINIWIVLAVLLALLATTRLLRDQHETQRICADD |
| Ga0126376_119323631 | 3300010359 | Tropical Forest Soil | LMRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSALVCGR* |
| Ga0126372_103064622 | 3300010360 | Tropical Forest Soil | MRVNIWIVLIVLISLFAVTRLLRYYQDTQRICADDP |
| Ga0126372_130258831 | 3300010360 | Tropical Forest Soil | LIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR* |
| Ga0126378_109561191 | 3300010361 | Tropical Forest Soil | RIRTAALMRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSASVCRR* |
| Ga0126378_109954171 | 3300010361 | Tropical Forest Soil | GKAALMRINIWIVLAVLLALLAITRLSQYQHDTQRICADDPSASVCRR* |
| Ga0126379_117190222 | 3300010366 | Tropical Forest Soil | MRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR* |
| Ga0126379_118054061 | 3300010366 | Tropical Forest Soil | MRINVWIVVIVLIALFAVTRLLRYQQDTQRICADDPSASVCA |
| Ga0126381_1010322602 | 3300010376 | Tropical Forest Soil | MRINIWIVLAVLLALLAITRLSQYQHETQRICADDP |
| Ga0126381_1011071373 | 3300010376 | Tropical Forest Soil | PALMRINVWIVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCGR* |
| Ga0126381_1026648201 | 3300010376 | Tropical Forest Soil | IVLAVLLALLAITRLSQYKHETQRICADDPSASVCGR* |
| Ga0126381_1029254861 | 3300010376 | Tropical Forest Soil | RRQEPALMRINVWIVLIVLIALFAVTRLLRYQQDTQRICADDPSASVCAR* |
| Ga0126381_1037655602 | 3300010376 | Tropical Forest Soil | MRINVWVVFIVLIALFAVTRLLRYHQDTQRICADDPSVSVCVR* |
| Ga0126383_120622192 | 3300010398 | Tropical Forest Soil | MRINVWIVLIVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCAR* |
| Ga0124850_10643673 | 3300010863 | Tropical Forest Soil | IVLAVLLALLAITRLSQYQHETQRICADDPSALVCGR* |
| Ga0124844_10758532 | 3300010868 | Tropical Forest Soil | MRINVWIVLIVLIALFAVTRLLRHHQDTQRICADDPSASVCAR* |
| Ga0137388_120037061 | 3300012189 | Vadose Zone Soil | MRINIWIVLVVLLALLAVTRLWRYQHDTQRICADDPSASVC |
| Ga0137375_105678612 | 3300012360 | Vadose Zone Soil | MMRINIWIVLAVLLALLATTRLLQYQHETQRICADDPSASVCGR* |
| Ga0137361_118604881 | 3300012362 | Vadose Zone Soil | GGRAALMRINIWIVLAVLLALLATTRLFQYQHETQRICADDPSASVCGP* |
| Ga0137358_102052472 | 3300012582 | Vadose Zone Soil | MRINVWIVLIVLIALFAATRLLRYHQDTQRICADDPSVSVCER* |
| Ga0137359_104343161 | 3300012923 | Vadose Zone Soil | LMRINVWIVLIVLIALFAATRLLRYHQDTQRICADDPSVSVCER* |
| Ga0126369_101755413 | 3300012971 | Tropical Forest Soil | MRINVWIVLVFLIALFALTRFLRYQQDTQRICADDPSASVCGR* |
| Ga0126369_112015991 | 3300012971 | Tropical Forest Soil | MRINIWIVLALLLALLDVTLLSQYQHEAQCIGADDRSAS |
| Ga0126369_118122692 | 3300012971 | Tropical Forest Soil | MRFNVLIVLVVLIALFAVTRLLRYHQDTQRICADDPSASVC |
| Ga0126369_122687312 | 3300012971 | Tropical Forest Soil | GAKTPVARTRRRQESALMRINIWIVLIVLIVLFAVTRLLQYQRDTQHICADDPSASVCAR |
| Ga0182036_102664571 | 3300016270 | Soil | IWIVLIVLIALFAVTRLLRYYGDTQRICADDPSASACER |
| Ga0182036_109000222 | 3300016270 | Soil | MRINVWIILIVLIAPFAVTRLLRYHQDTQRICADDPSASV |
| Ga0182041_106292682 | 3300016294 | Soil | AGAALMRVNIWIVLIVLIALFAVTRLLRYYGDTQRICADDPSASACER |
| Ga0182041_114176431 | 3300016294 | Soil | VLIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0182041_120069791 | 3300016294 | Soil | LIVLIALLAVTRVWRYQHDTQLICADDPSALVCGR |
| Ga0182035_106263562 | 3300016341 | Soil | GRAALMRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0182035_110443294 | 3300016341 | Soil | VNIWVVLIVLIAPFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0182032_112192131 | 3300016357 | Soil | MRINIWIVLIVLIALLAVTRVWRYQHDTQRICADDPS |
| Ga0182032_112490992 | 3300016357 | Soil | NLWIVLVVLMALLAVTQLLRYRQDTQRICADDPSASVCGR |
| Ga0182032_114815382 | 3300016357 | Soil | DPALMRINVWIVLIVLIALFAVTRLLRYHQDTQRICSDDPSASVCGR |
| Ga0182034_103614342 | 3300016371 | Soil | ALMRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0182040_114692761 | 3300016387 | Soil | MRINIWIVLAVLLALLAITRLSQYQHDTQRICADDPSASV |
| Ga0182040_116288401 | 3300016387 | Soil | VRINVWIVLIVLIALFAVTRLLRYHQDTQRICADDPSASV |
| Ga0182037_101530871 | 3300016404 | Soil | GGRQPTKKAALMRVNIWIVLIVLIALFAVTRLLRYYGDTQRICADDPSASACER |
| Ga0182037_110844162 | 3300016404 | Soil | ALMRINIWIVLIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0182037_113426852 | 3300016404 | Soil | WIVLAVLLALLAITRLSQYQHDTQRICADDPSASVCRR |
| Ga0182039_113130521 | 3300016422 | Soil | LIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0182039_115857281 | 3300016422 | Soil | MRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSAS |
| Ga0066655_108643591 | 3300018431 | Grasslands Soil | MRINIWIVLAVLLALLATTRLFQYQHETQRICADDPSASVCGP |
| Ga0210408_101953201 | 3300021178 | Soil | RRWEPALMRINVWIVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCTR |
| Ga0126371_101028095 | 3300021560 | Tropical Forest Soil | MRISLWIVLVLLMALLAVTQLLRYRQDTQRICADDPSALVCSR |
| Ga0126371_104237411 | 3300021560 | Tropical Forest Soil | MRINIWIVLGVLLVLLAVTRLWRYQQDTQRICADDPSASVCGR |
| Ga0126371_106443943 | 3300021560 | Tropical Forest Soil | MRINVWIVLIVLIALFAVTRLLRYHQDTQRICADDPSASLCAR |
| Ga0126371_107082652 | 3300021560 | Tropical Forest Soil | MRINIWIILDVLLVLFAITRLWRHQQDIQRICADDPSASVCER |
| Ga0126371_109362422 | 3300021560 | Tropical Forest Soil | MRINIWIVLGVLLVLLAVTRLWRYQQDTQRICADD |
| Ga0126371_120600812 | 3300021560 | Tropical Forest Soil | RINIWIALIVLIALLAVTGVWRYQHDTQRICADDPSALVCGR |
| Ga0126371_126079731 | 3300021560 | Tropical Forest Soil | MRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSA |
| Ga0126371_126720182 | 3300021560 | Tropical Forest Soil | ALMRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSASVCGR |
| Ga0126371_132818761 | 3300021560 | Tropical Forest Soil | RPPAHTHPRQESALMRINIWIVLIVLIVLFAVTRLLQYQRDTQHNCADDPSASVCVR |
| Ga0207646_102550584 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHRTGGRAALMRINIWIVLVVLLALLAVTRLWRYQHDTQRICADDPS |
| Ga0207665_100432405 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRINIWIVFAVLLALLATTPRGSSNISRTQRICADDPSASVCGR |
| Ga0209761_10964282 | 3300026313 | Grasslands Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADDSD |
| Ga0209152_100303692 | 3300026325 | Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADGSD |
| Ga0209159_12469022 | 3300026343 | Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADDPSASV |
| Ga0209465_102932051 | 3300027874 | Tropical Forest Soil | MRINVWIVVIVLIALFAVTRLLRYQQDTQRICADDPSAS |
| Ga0209465_105291692 | 3300027874 | Tropical Forest Soil | MRINIWIVLIVLIVLFAVTRLLQYQRDTQHICADDPSASVCVR |
| Ga0318534_101325842 | 3300031544 | Soil | MRINIWIVLAVLLAFLAITRLSQYQHDTQRICADDPSASVCGR |
| Ga0318534_104628251 | 3300031544 | Soil | VWIVLIVVIALFAITRLLRYQQDTQRICTDDPSASVCAR |
| Ga0318541_100050694 | 3300031545 | Soil | MRVNIWIVLIVLIALFAVTRLLRYQQDRQRICADDPSASVCGR |
| Ga0318541_100303234 | 3300031545 | Soil | MRINIWIVLAVLLALFAVTRLSQYQHERQRICADDPSASVCVR |
| Ga0318541_100535302 | 3300031545 | Soil | MRINIWIVLAVLLALLAVTRLSQYQHETQRICADDPSASVCVR |
| Ga0318541_101956392 | 3300031545 | Soil | MRINIWIVLIVVIALFAITRLLRYQQDTQRICTDDPSASVRAR |
| Ga0318571_101997861 | 3300031549 | Soil | MLGIVLIVLIALFAVTRLLRYHQETQRICADDPSAPVCARGD |
| Ga0318528_101671513 | 3300031561 | Soil | MRVNIWVVLIVLIALFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0318573_103145903 | 3300031564 | Soil | MRINVWVVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCAQ |
| Ga0318515_103651772 | 3300031572 | Soil | MRINIWIVLVVLIALLAVTRLLRYQQDTQRICADDPSASVCGR |
| Ga0318515_104337701 | 3300031572 | Soil | VWIVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCAR |
| Ga0310915_100683364 | 3300031573 | Soil | IAGHEPTAGAALMRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASACGR |
| Ga0310915_101066423 | 3300031573 | Soil | MRINVWIFFIVLIALFAVTRLLRYQQDTQRICADDPSASVCARWASRATPCAN |
| Ga0310915_103750903 | 3300031573 | Soil | MRVNIWVVLIVLIAPFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0310915_104364122 | 3300031573 | Soil | MRINIWIVLAVLLALLAITRLSQYQHDTQPICADDPSASV |
| Ga0318542_105117231 | 3300031668 | Soil | MLGIVLIVLIALFAVTRLLRYHQETQRICADDPSAPV |
| Ga0318561_101809782 | 3300031679 | Soil | MRVNIWIVLIVLIALFAVTRLLRYYGDTQRICADDPSASACER |
| Ga0318560_105176931 | 3300031682 | Soil | MRINLWIVLVVLMALLAVTQLLRYRQDTQRICADDPSASVCGR |
| Ga0318496_101818581 | 3300031713 | Soil | WAQTPRQGAALMRVNIWIVLIVLIALFAVTRLLRYQQDRQRICADDPSASVCGR |
| Ga0318500_100024914 | 3300031724 | Soil | MRINIWIVLAVLLALLATTRLLQYQHETQRICADDPSASVCGR |
| Ga0318500_104088482 | 3300031724 | Soil | MRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSA |
| Ga0318502_102949402 | 3300031747 | Soil | ALMRINIWIVLVVLLALLAVTRLWHYQHDTQRICADDPSASVCGR |
| Ga0307475_104355862 | 3300031754 | Hardwood Forest Soil | MRINIWIVLAVLLALLAITRLLQYQHETQRICADDPSASVCGR |
| Ga0318537_101297872 | 3300031763 | Soil | MRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0318535_105346651 | 3300031764 | Soil | INIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0318509_103360471 | 3300031768 | Soil | IWIALIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0318521_100203645 | 3300031770 | Soil | MRLNIWIVLVVLMALLAVTQLLRYQQDTQRICADDPSASACQR |
| Ga0318546_101375152 | 3300031771 | Soil | MRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0318529_102879122 | 3300031792 | Soil | MRVNIWVVLIVLIAPFAVTRLLRYYQDTQRICADDP |
| Ga0318557_102623812 | 3300031795 | Soil | MRINIWIVLVVLIALLAVTRLLRYQQDTQRICADDPSASVCG |
| Ga0318523_101692574 | 3300031798 | Soil | MRVNIWIVLIVLIALFAVTRLLRYYGDTQRICADDPSA |
| Ga0318565_106162232 | 3300031799 | Soil | INIWIVLIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0318497_102346212 | 3300031805 | Soil | MRINIWIVLIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0318567_100351471 | 3300031821 | Soil | LMRINIWIVLAVLLALLAITRLSQYQHETQRICADDPSATVWQR |
| Ga0318564_103055501 | 3300031831 | Soil | MRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0318499_103915181 | 3300031832 | Soil | IWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0310917_103006661 | 3300031833 | Soil | GAALMRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASACGR |
| Ga0318517_103758912 | 3300031835 | Soil | MRINVWVVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCARWASRATPCAN |
| Ga0306919_106271122 | 3300031879 | Soil | MRINIWIVLAVLLALLAITRLSQYQHDTQRICADDPSASVCRR |
| Ga0318544_101475922 | 3300031880 | Soil | MRINIWIVLAVLLALLALTRLSQYQNETQRICADDPSASVCRR |
| Ga0318544_103493151 | 3300031880 | Soil | AALMRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0306925_105319221 | 3300031890 | Soil | GTNHRQGAALMRVNIWVVLIVLIAPFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0306925_117029141 | 3300031890 | Soil | MRINVWIVLIVVIALFAITRLLRYQQDTQRICTDDPSASVCAR |
| Ga0318522_101392202 | 3300031894 | Soil | GRAALMRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0318551_103353551 | 3300031896 | Soil | MRINIWIVLVVLIALLAVTRLSRYQQDAQRICADDPTASVCG |
| Ga0318520_102021511 | 3300031897 | Soil | IWIVLIVLIALFAVTRLLRYQQDRQRICADDPSASVCGR |
| Ga0318520_105542011 | 3300031897 | Soil | PKRRQGALMRINIWIVLIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0318520_108770742 | 3300031897 | Soil | MRINVWIVLIVLIALFAVTRLLRYHQDTQRICSDDPS |
| Ga0306923_101416871 | 3300031910 | Soil | MRINIWIVLVVLLALLAVTRLWHYQHDTQRICADDPSAS |
| Ga0306923_101446951 | 3300031910 | Soil | RINIWIVLAVLLALLATTRLLQDQHETQRICADDPSASVCGR |
| Ga0306921_103599205 | 3300031912 | Soil | TPRQGAALMRVNIWIVLIVLIALFAVTRLLRYQQDRQRICADDPSASVCGR |
| Ga0310912_104044621 | 3300031941 | Soil | MRINVWIVLIVLIALFAVTRLLRYHQDTQRICADDPSASVCAR |
| Ga0310916_100418351 | 3300031942 | Soil | GHEPTAGAALMRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASACGR |
| Ga0310916_100494426 | 3300031942 | Soil | MRINIWIVVIVLIALWAVTWLVRHQQDTNRICADDPSASVCGR |
| Ga0310916_108240721 | 3300031942 | Soil | WIVLPVLLALLATTRLLQDQHETQRICADDPSASVCGR |
| Ga0310916_113695041 | 3300031942 | Soil | GRNRRRDPALMRINVWIVLIVLIALFAVTRLLRYHQDTQRICSDDPSASVCGR |
| Ga0310913_111163452 | 3300031945 | Soil | MRINLWIVLVVLMALLAVTQLLRYRQDTQRICADDP |
| Ga0310913_111272331 | 3300031945 | Soil | QGAALMRVNIWVVLIVLIAPFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0310910_100071792 | 3300031946 | Soil | MRVNIWIVLIVLIALFAVTRLLRYYQDTQRICADDPSASACGR |
| Ga0310910_113057492 | 3300031946 | Soil | MRINIWIVLAVLLAFLAITRLSQYQHDTQRICADDPSASVCG |
| Ga0310910_113690151 | 3300031946 | Soil | ALMRINVWIVLIVLIALFAATRLLRYHQDTQRICADDPSASVCER |
| Ga0310909_100327749 | 3300031947 | Soil | MRINIWIVLAVLLALLATTRLLRDQHETQRICADDPSASVCGR |
| Ga0310909_110616992 | 3300031947 | Soil | ALMRVNIWVVLIVLIALFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0310909_115937561 | 3300031947 | Soil | MRISIWIVLIVLIALLAVTRFSRYLQDTQRICADDLSASVC |
| Ga0318530_102616552 | 3300031959 | Soil | INIWIALIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| Ga0306922_110165783 | 3300032001 | Soil | MRINIWIVLAVLLALLATTRLLRDQHETRRICADDPSASVC |
| Ga0306922_110413542 | 3300032001 | Soil | MRINIWIVLIVVIALFAITRLLRYQQDTQRICTDDPSA |
| Ga0306922_115207623 | 3300032001 | Soil | VNIWVVLIVLIALFAVTRLLRYYQDTQRICADDPSASVRGR |
| Ga0318562_108658571 | 3300032008 | Soil | MRINIWIVLGVLLVLLAVTRLWRYQQDTQRICADDPSASVCLR |
| Ga0318569_102558021 | 3300032010 | Soil | MRINIWIALIVLIALLAVTRVWRYQHDTQRICADDP |
| Ga0310911_100062791 | 3300032035 | Soil | IVLVVLMALLAVTQLLRYRQDTQRICADDPSASVCGR |
| Ga0310911_104470971 | 3300032035 | Soil | GRAALMRSNIWIVLAVLLALLALTRLSQYQNETQRICADDPSASVCRR |
| Ga0318556_102404092 | 3300032043 | Soil | AALMRINIWIVLVVLIALLAVTRLLRYQQDTQRICADDPSASVCGR |
| Ga0318532_102658911 | 3300032051 | Soil | MRINIWIVLAVLLAFLAITRLSQYQHDTQRICADDPSA |
| Ga0318570_104522321 | 3300032054 | Soil | MRINVWIVLVVLIALLAVTRLLRYQQDTQRICADDPSASV |
| Ga0318533_104646521 | 3300032059 | Soil | RAALMRINIWIALIVLIALLAVTRVWRYQHDTQRICADDPSALVCGR |
| Ga0318533_105417661 | 3300032059 | Soil | QRGGKAALMRINIWIVLAVLLALLAITRLSQYQHDTQPICADDPSASVCRR |
| Ga0318504_104806231 | 3300032063 | Soil | MRINIWIVLIVLIALLAVTRVWRYQHDTQRICADDP |
| Ga0318513_103807332 | 3300032065 | Soil | VLIVLIALFAVTRLLRYQQDRQRICADDPSASVCGR |
| Ga0318513_105731191 | 3300032065 | Soil | MRINIWIVLVVLLALLAVTRLWHYQHDTQRICADDPSA |
| Ga0318513_105841621 | 3300032065 | Soil | LSAGRNRRQDPALMRINVWIVLIVLIALFAVTRLLRYHQDTQRICSDDPSASVCGR |
| Ga0306924_114051391 | 3300032076 | Soil | MRINIWIVLIVVIALFAITRLLRYQQDTQRICTDDPSASV |
| Ga0306920_10009518512 | 3300032261 | Soil | AALMRINIWIVLAVLLALLATTRLLQDQHETHLCG |
| Ga0306920_1008970242 | 3300032261 | Soil | MRINIWIVLIVVIALFAITRLLRYQQDTQRICTDDPSASVCAR |
| Ga0306920_1016342941 | 3300032261 | Soil | IVLAVLLALLAITRLSQYQHDTQRICADNPSASVCGR |
| Ga0306920_1021451382 | 3300032261 | Soil | MRINIWIVLGVLLVLLAVTRLWRYQQDTQRICADDPSASVC |
| Ga0310914_109845881 | 3300033289 | Soil | RINIWIVLAVLLALLAITRLSQYQHDTQPICADDPSASVCRR |
| Ga0318519_102767231 | 3300033290 | Soil | AALMRINIWIVLIVLIALLAVTRVWRYQHDTQRICADDPSASVCGR |
| ⦗Top⦘ |