


| Basic Information | |
|---|---|
| Family ID | F025177 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 44 residues |
| Representative Sequence | NSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Number of Associated Samples | 176 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.49 % |
| % of genes near scaffold ends (potentially truncated) | 97.54 % |
| % of genes from short scaffolds (< 2000 bps) | 86.21 % |
| Associated GOLD sequencing projects | 166 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.340 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.320 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.118 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.34 % |
| All Organisms | root | All Organisms | 22.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10248609 | Not Available | 521 | Open in IMG/M |
| 3300001351|JGI20153J14318_10069524 | Not Available | 1131 | Open in IMG/M |
| 3300001419|JGI11705J14877_10184399 | Not Available | 544 | Open in IMG/M |
| 3300001720|JGI24513J20088_1020688 | Not Available | 717 | Open in IMG/M |
| 3300005512|Ga0074648_1017880 | All Organisms → Viruses → Predicted Viral | 4123 | Open in IMG/M |
| 3300005934|Ga0066377_10016397 | Not Available | 1948 | Open in IMG/M |
| 3300006026|Ga0075478_10250828 | Not Available | 530 | Open in IMG/M |
| 3300006357|Ga0075502_1169047 | Not Available | 529 | Open in IMG/M |
| 3300006383|Ga0075504_1408371 | Not Available | 785 | Open in IMG/M |
| 3300006390|Ga0075509_1522628 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300006392|Ga0075507_1022124 | All Organisms → Viruses → Predicted Viral | 2069 | Open in IMG/M |
| 3300006393|Ga0075517_1575844 | Not Available | 932 | Open in IMG/M |
| 3300006397|Ga0075488_1475005 | Not Available | 525 | Open in IMG/M |
| 3300006400|Ga0075503_1162319 | Not Available | 1296 | Open in IMG/M |
| 3300006401|Ga0075506_1070015 | Not Available | 762 | Open in IMG/M |
| 3300006402|Ga0075511_1771372 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300006405|Ga0075510_10152249 | Not Available | 1242 | Open in IMG/M |
| 3300006405|Ga0075510_10823452 | Not Available | 659 | Open in IMG/M |
| 3300006735|Ga0098038_1148148 | Not Available | 783 | Open in IMG/M |
| 3300006752|Ga0098048_1156318 | Not Available | 679 | Open in IMG/M |
| 3300006752|Ga0098048_1167429 | Not Available | 653 | Open in IMG/M |
| 3300006802|Ga0070749_10285366 | Not Available | 928 | Open in IMG/M |
| 3300006802|Ga0070749_10331655 | Not Available | 848 | Open in IMG/M |
| 3300006868|Ga0075481_10286919 | Not Available | 575 | Open in IMG/M |
| 3300006869|Ga0075477_10211402 | Not Available | 791 | Open in IMG/M |
| 3300006870|Ga0075479_10298971 | Not Available | 632 | Open in IMG/M |
| 3300006919|Ga0070746_10028511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3021 | Open in IMG/M |
| 3300006920|Ga0070748_1177174 | Not Available | 785 | Open in IMG/M |
| 3300007234|Ga0075460_10105538 | Not Available | 1009 | Open in IMG/M |
| 3300007276|Ga0070747_1010217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 4029 | Open in IMG/M |
| 3300007345|Ga0070752_1316606 | Not Available | 591 | Open in IMG/M |
| 3300007538|Ga0099851_1059246 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1495 | Open in IMG/M |
| 3300007538|Ga0099851_1322320 | Not Available | 542 | Open in IMG/M |
| 3300007540|Ga0099847_1060857 | Not Available | 1178 | Open in IMG/M |
| 3300007670|Ga0102862_1072279 | Not Available | 851 | Open in IMG/M |
| 3300008516|Ga0111033_1206263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1640 | Open in IMG/M |
| 3300009079|Ga0102814_10254416 | Not Available | 956 | Open in IMG/M |
| 3300009433|Ga0115545_1082958 | Not Available | 1179 | Open in IMG/M |
| 3300009435|Ga0115546_1069951 | Not Available | 1315 | Open in IMG/M |
| 3300009508|Ga0115567_10043869 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300009599|Ga0115103_1357299 | Not Available | 742 | Open in IMG/M |
| 3300009599|Ga0115103_1552279 | Not Available | 571 | Open in IMG/M |
| 3300009599|Ga0115103_1775633 | Not Available | 1459 | Open in IMG/M |
| 3300009606|Ga0115102_10469356 | Not Available | 518 | Open in IMG/M |
| 3300009608|Ga0115100_10863304 | All Organisms → Viruses → Predicted Viral | 2021 | Open in IMG/M |
| 3300009608|Ga0115100_10948530 | Not Available | 530 | Open in IMG/M |
| 3300009677|Ga0115104_10232602 | Not Available | 1172 | Open in IMG/M |
| 3300009677|Ga0115104_10236638 | Not Available | 799 | Open in IMG/M |
| 3300009677|Ga0115104_10297243 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1147 | Open in IMG/M |
| 3300009750|Ga0123368_1123737 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1722 | Open in IMG/M |
| 3300009753|Ga0123360_1070072 | Not Available | 967 | Open in IMG/M |
| 3300010129|Ga0123376_1075276 | Not Available | 1189 | Open in IMG/M |
| 3300010149|Ga0098049_1022089 | All Organisms → Viruses → Predicted Viral | 2093 | Open in IMG/M |
| 3300010296|Ga0129348_1060100 | Not Available | 1363 | Open in IMG/M |
| 3300010297|Ga0129345_1329946 | Not Available | 526 | Open in IMG/M |
| 3300010300|Ga0129351_1200468 | Not Available | 775 | Open in IMG/M |
| 3300010368|Ga0129324_10070134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1559 | Open in IMG/M |
| 3300010389|Ga0136549_10102426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1347 | Open in IMG/M |
| 3300011258|Ga0151677_1001118 | Not Available | 6849 | Open in IMG/M |
| 3300012419|Ga0138260_10503199 | Not Available | 554 | Open in IMG/M |
| 3300012504|Ga0129347_1009168 | Not Available | 2170 | Open in IMG/M |
| 3300012520|Ga0129344_1376137 | Not Available | 1358 | Open in IMG/M |
| 3300012522|Ga0129326_1081125 | Not Available | 559 | Open in IMG/M |
| 3300012523|Ga0129350_1016008 | Not Available | 1114 | Open in IMG/M |
| 3300012525|Ga0129353_1156226 | Not Available | 2101 | Open in IMG/M |
| 3300012525|Ga0129353_1409032 | Not Available | 750 | Open in IMG/M |
| 3300012953|Ga0163179_10382217 | Not Available | 1137 | Open in IMG/M |
| 3300012963|Ga0129340_1082271 | Not Available | 569 | Open in IMG/M |
| 3300012967|Ga0129343_1284398 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1420 | Open in IMG/M |
| 3300016689|Ga0182050_1064449 | Not Available | 518 | Open in IMG/M |
| 3300016723|Ga0182085_1381608 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1581 | Open in IMG/M |
| 3300016726|Ga0182045_1334920 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300016731|Ga0182094_1335516 | Not Available | 1370 | Open in IMG/M |
| 3300016731|Ga0182094_1405399 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1529 | Open in IMG/M |
| 3300016732|Ga0182057_1334248 | Not Available | 1013 | Open in IMG/M |
| 3300016735|Ga0182074_1145983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1511 | Open in IMG/M |
| 3300016736|Ga0182049_1178572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 2030 | Open in IMG/M |
| 3300016739|Ga0182076_1290324 | Not Available | 775 | Open in IMG/M |
| 3300016741|Ga0182079_1105862 | Not Available | 585 | Open in IMG/M |
| 3300016743|Ga0182083_1520227 | Not Available | 724 | Open in IMG/M |
| 3300016746|Ga0182055_1312946 | Not Available | 874 | Open in IMG/M |
| 3300016747|Ga0182078_10379510 | Not Available | 584 | Open in IMG/M |
| 3300016748|Ga0182043_1212232 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1609 | Open in IMG/M |
| 3300016749|Ga0182053_1132182 | Not Available | 834 | Open in IMG/M |
| 3300016751|Ga0182062_1127018 | Not Available | 2119 | Open in IMG/M |
| 3300016751|Ga0182062_1255478 | Not Available | 1070 | Open in IMG/M |
| 3300016751|Ga0182062_1313007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1566 | Open in IMG/M |
| 3300016758|Ga0182070_1194525 | Not Available | 690 | Open in IMG/M |
| 3300016771|Ga0182082_1057628 | Not Available | 891 | Open in IMG/M |
| 3300016781|Ga0182063_1669548 | Not Available | 668 | Open in IMG/M |
| 3300016791|Ga0182095_1382111 | Not Available | 858 | Open in IMG/M |
| 3300017727|Ga0181401_1052589 | Not Available | 1111 | Open in IMG/M |
| 3300017757|Ga0181420_1067277 | Not Available | 1131 | Open in IMG/M |
| 3300017758|Ga0181409_1058311 | Not Available | 1181 | Open in IMG/M |
| 3300017762|Ga0181422_1018201 | Not Available | 2313 | Open in IMG/M |
| 3300017763|Ga0181410_1017461 | Not Available | 2398 | Open in IMG/M |
| 3300017781|Ga0181423_1383247 | Not Available | 509 | Open in IMG/M |
| 3300017956|Ga0181580_10748464 | Not Available | 619 | Open in IMG/M |
| 3300017962|Ga0181581_10567840 | Not Available | 694 | Open in IMG/M |
| 3300017964|Ga0181589_10191015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1431 | Open in IMG/M |
| 3300017964|Ga0181589_10664297 | Not Available | 657 | Open in IMG/M |
| 3300017968|Ga0181587_10486127 | Not Available | 803 | Open in IMG/M |
| 3300018413|Ga0181560_10133772 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300018415|Ga0181559_10731964 | Not Available | 529 | Open in IMG/M |
| 3300018424|Ga0181591_10372348 | Not Available | 1070 | Open in IMG/M |
| 3300018876|Ga0181564_10220847 | Not Available | 1090 | Open in IMG/M |
| 3300019198|Ga0180033_102332 | Not Available | 1063 | Open in IMG/M |
| 3300019253|Ga0182064_1141152 | Not Available | 970 | Open in IMG/M |
| 3300019261|Ga0182097_1490682 | Not Available | 711 | Open in IMG/M |
| 3300019262|Ga0182066_1443030 | Not Available | 2114 | Open in IMG/M |
| 3300019266|Ga0182061_1153662 | Not Available | 599 | Open in IMG/M |
| 3300019266|Ga0182061_1377786 | All Organisms → Viruses → Predicted Viral | 2117 | Open in IMG/M |
| 3300019271|Ga0182065_1287654 | Not Available | 1210 | Open in IMG/M |
| 3300019272|Ga0182059_1024601 | Not Available | 773 | Open in IMG/M |
| 3300019281|Ga0182077_1031669 | Not Available | 935 | Open in IMG/M |
| 3300019281|Ga0182077_1318429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 2054 | Open in IMG/M |
| 3300019281|Ga0182077_1424256 | Not Available | 982 | Open in IMG/M |
| 3300019282|Ga0182075_1444733 | Not Available | 573 | Open in IMG/M |
| 3300019698|Ga0193986_1031656 | Not Available | 523 | Open in IMG/M |
| 3300019938|Ga0194032_1017127 | Not Available | 769 | Open in IMG/M |
| 3300020013|Ga0182086_1166460 | Not Available | 575 | Open in IMG/M |
| 3300020014|Ga0182044_1171012 | Not Available | 898 | Open in IMG/M |
| 3300020014|Ga0182044_1239583 | Not Available | 878 | Open in IMG/M |
| 3300020014|Ga0182044_1349183 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1850 | Open in IMG/M |
| 3300020056|Ga0181574_10707010 | Not Available | 526 | Open in IMG/M |
| 3300020165|Ga0206125_10081810 | Not Available | 1421 | Open in IMG/M |
| 3300020166|Ga0206128_1141368 | Not Available | 982 | Open in IMG/M |
| 3300020177|Ga0181596_10290744 | Not Available | 662 | Open in IMG/M |
| 3300020184|Ga0181573_10309680 | Not Available | 772 | Open in IMG/M |
| 3300020207|Ga0181570_10512871 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 548 | Open in IMG/M |
| 3300020402|Ga0211499_10191508 | Not Available | 733 | Open in IMG/M |
| 3300020438|Ga0211576_10351635 | Not Available | 759 | Open in IMG/M |
| 3300020442|Ga0211559_10424422 | Not Available | 613 | Open in IMG/M |
| 3300021350|Ga0206692_1093637 | Not Available | 2013 | Open in IMG/M |
| 3300021373|Ga0213865_10020720 | Not Available | 3721 | Open in IMG/M |
| 3300021373|Ga0213865_10237017 | Not Available | 881 | Open in IMG/M |
| 3300021389|Ga0213868_10072225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 2304 | Open in IMG/M |
| 3300021389|Ga0213868_10445697 | Not Available | 706 | Open in IMG/M |
| 3300021425|Ga0213866_10054854 | All Organisms → Viruses → Predicted Viral | 2250 | Open in IMG/M |
| 3300021425|Ga0213866_10066560 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
| 3300021958|Ga0222718_10068646 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
| 3300021958|Ga0222718_10207343 | Not Available | 1066 | Open in IMG/M |
| 3300021959|Ga0222716_10051108 | Not Available | 2928 | Open in IMG/M |
| 3300022068|Ga0212021_1078912 | Not Available | 675 | Open in IMG/M |
| 3300022071|Ga0212028_1113250 | Not Available | 502 | Open in IMG/M |
| 3300022074|Ga0224906_1204333 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 538 | Open in IMG/M |
| 3300022159|Ga0196893_1001872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1675 | Open in IMG/M |
| 3300022176|Ga0212031_1010046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1324 | Open in IMG/M |
| 3300022183|Ga0196891_1081694 | Not Available | 572 | Open in IMG/M |
| 3300022200|Ga0196901_1165798 | Not Available | 727 | Open in IMG/M |
| 3300022206|Ga0224499_10345917 | Not Available | 502 | Open in IMG/M |
| 3300022925|Ga0255773_10385301 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 538 | Open in IMG/M |
| 3300022927|Ga0255769_10099416 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1489 | Open in IMG/M |
| 3300023119|Ga0255762_10232307 | Not Available | 999 | Open in IMG/M |
| 3300023176|Ga0255772_10571100 | Not Available | 528 | Open in IMG/M |
| 3300023178|Ga0255759_10774332 | Not Available | 519 | Open in IMG/M |
| 3300023566|Ga0228679_1019349 | Not Available | 700 | Open in IMG/M |
| 3300023567|Ga0228694_133444 | Not Available | 533 | Open in IMG/M |
| 3300023568|Ga0228696_1011296 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300023683|Ga0228681_1021067 | Not Available | 750 | Open in IMG/M |
| 3300023685|Ga0228686_1002798 | Not Available | 2097 | Open in IMG/M |
| 3300023699|Ga0228695_1039904 | Not Available | 664 | Open in IMG/M |
| 3300023699|Ga0228695_1059930 | Not Available | 540 | Open in IMG/M |
| 3300023706|Ga0232123_1021160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1384 | Open in IMG/M |
| 3300023709|Ga0232122_1032531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1354 | Open in IMG/M |
| 3300023709|Ga0232122_1099420 | Not Available | 674 | Open in IMG/M |
| 3300024329|Ga0228631_1102260 | Not Available | 678 | Open in IMG/M |
| 3300024428|Ga0233396_1055320 | Not Available | 1076 | Open in IMG/M |
| 3300025098|Ga0208434_1079284 | Not Available | 670 | Open in IMG/M |
| 3300025108|Ga0208793_1163151 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 581 | Open in IMG/M |
| 3300025138|Ga0209634_1113908 | Not Available | 1168 | Open in IMG/M |
| 3300025508|Ga0208148_1031082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1436 | Open in IMG/M |
| 3300025543|Ga0208303_1122286 | Not Available | 523 | Open in IMG/M |
| 3300025674|Ga0208162_1075668 | Not Available | 1054 | Open in IMG/M |
| 3300025674|Ga0208162_1123745 | Not Available | 739 | Open in IMG/M |
| 3300025751|Ga0208150_1262393 | Not Available | 519 | Open in IMG/M |
| 3300025771|Ga0208427_1096710 | Not Available | 1025 | Open in IMG/M |
| 3300025818|Ga0208542_1038971 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300025853|Ga0208645_1118190 | Not Available | 1063 | Open in IMG/M |
| 3300025887|Ga0208544_10056039 | Not Available | 1888 | Open in IMG/M |
| 3300026085|Ga0208880_1012869 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300026187|Ga0209929_1156201 | Not Available | 553 | Open in IMG/M |
| 3300026390|Ga0247558_112963 | Not Available | 786 | Open in IMG/M |
| 3300026420|Ga0247581_1061601 | Not Available | 597 | Open in IMG/M |
| 3300026447|Ga0247607_1086058 | Not Available | 557 | Open in IMG/M |
| 3300026460|Ga0247604_1083261 | Not Available | 741 | Open in IMG/M |
| 3300026462|Ga0247568_1103418 | Not Available | 559 | Open in IMG/M |
| 3300026466|Ga0247598_1105775 | Not Available | 716 | Open in IMG/M |
| 3300026500|Ga0247592_1007440 | Not Available | 2463 | Open in IMG/M |
| 3300026503|Ga0247605_1037750 | Not Available | 1207 | Open in IMG/M |
| 3300027672|Ga0209383_1020773 | Not Available | 2820 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10234989 | Not Available | 652 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10733362 | Not Available | 526 | Open in IMG/M |
| 3300028076|Ga0247562_1001208 | Not Available | 2190 | Open in IMG/M |
| 3300028134|Ga0256411_1033313 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1694 | Open in IMG/M |
| 3300028233|Ga0256417_1183664 | Not Available | 560 | Open in IMG/M |
| 3300032136|Ga0316201_11137504 | Not Available | 653 | Open in IMG/M |
| 3300032255|Ga0316209_1089097 | Not Available | 854 | Open in IMG/M |
| 3300032272|Ga0316189_10709650 | Not Available | 767 | Open in IMG/M |
| 3300034374|Ga0348335_061015 | Not Available | 1381 | Open in IMG/M |
| 3300034375|Ga0348336_149082 | Not Available | 698 | Open in IMG/M |
| 3300034375|Ga0348336_164253 | Not Available | 640 | Open in IMG/M |
| 3300034418|Ga0348337_143061 | Not Available | 690 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 28.57% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.62% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 12.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.40% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.40% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.48% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.48% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.99% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.49% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.49% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.49% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.49% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.49% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.49% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.49% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.49% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.49% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.49% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.49% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.49% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.49% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006383 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006390 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006392 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009750 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009753 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_190_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010129 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016689 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011509AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016723 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016731 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016736 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016743 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016746 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016748 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016751 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016758 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019198 | Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019253 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019266 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019271 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019272 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019698 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020013 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023566 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023683 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023699 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026390 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026420 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026462 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028076 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032255 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_102486091 | 3300000117 | Marine | ASDVEAREEAHAILRALTQIEMVLDATIAAETLLDRKQ* |
| JGI20153J14318_100695241 | 3300001351 | Pelagic Marine | AAREEAHAIIRALNQIEVNLDAALAAETLLDRKQRK* |
| JGI11705J14877_101843991 | 3300001419 | Saline Water And Sediment | VQISIFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRHK* |
| JGI24513J20088_10206881 | 3300001720 | Marine | SAAQDIEVREEAHAVLRALTKIEVELDAAIMAETLLDRKQ* |
| Ga0074648_10178809 | 3300005512 | Saline Water And Sediment | QQFVQDVRDVQISIFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRHK* |
| Ga0066377_100163972 | 3300005934 | Marine | MDSAASDVEAREEAHAILRALNQIEMVLDATIAAETLLDRKQ* |
| Ga0075478_102508282 | 3300006026 | Aqueous | SDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN* |
| Ga0075502_11690472 | 3300006357 | Aqueous | VRDVQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0075504_14083711 | 3300006383 | Aqueous | VEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0075509_15226281 | 3300006390 | Aqueous | QISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0075507_10221241 | 3300006392 | Aqueous | VQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0075517_15758442 | 3300006393 | Aqueous | VQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE* |
| Ga0075488_14750051 | 3300006397 | Aqueous | DVFATSDAKDIEAREEAHAVIRALNLIEMNLDAAIAAETFLDLRKG* |
| Ga0075503_11623193 | 3300006400 | Aqueous | FQQFVQDVRDVQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRNKQE |
| Ga0075506_10700151 | 3300006401 | Aqueous | FQQFVQDVRDVQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0075511_17713721 | 3300006402 | Aqueous | FVTSAAEDIERREEAHSIVRALNLIEVNLDAAIAAETLLDRKQGS* |
| Ga0075510_101522493 | 3300006405 | Aqueous | EVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE* |
| Ga0075510_108234522 | 3300006405 | Aqueous | FAASAAEEIERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS* |
| Ga0098038_11481481 | 3300006735 | Marine | EAREEAHAIMRALNQIEMVLDATIAAETLLDRKQ* |
| Ga0098048_11563181 | 3300006752 | Marine | TSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ* |
| Ga0098048_11674292 | 3300006752 | Marine | ANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0070749_102853662 | 3300006802 | Aqueous | EQHRIFADSSAEDVSAREQAHAILRALNQITAKLDAAIVAEKLLDRKR* |
| Ga0070749_103316552 | 3300006802 | Aqueous | FTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRHK* |
| Ga0075481_102869192 | 3300006868 | Aqueous | SNSTASEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSR* |
| Ga0075477_102114021 | 3300006869 | Aqueous | IERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS* |
| Ga0075479_102989712 | 3300006870 | Aqueous | DEIERREEAHAIIRALNQIEVQLDAAIAAERILDRNK* |
| Ga0070746_100285111 | 3300006919 | Aqueous | ERREEAHAIIRALNQIEVNLDAAIAAETLLDHRQGN* |
| Ga0070748_11771741 | 3300006920 | Aqueous | SDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0075460_101055382 | 3300007234 | Aqueous | ADVAAREEAHAIIRALNQIEVNLDAALAAETLLDRKQRK* |
| Ga0070747_10102178 | 3300007276 | Aqueous | FADSSASDVDVREDAHAILRAVNQIEIKLDAALAAELILDRKQRN* |
| Ga0070752_13166061 | 3300007345 | Aqueous | ISIFSNSTASEVEQREEAHAIMRALNQIEMQLDAAIAAERM* |
| Ga0099851_10592461 | 3300007538 | Aqueous | NSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN* |
| Ga0099851_13223201 | 3300007538 | Aqueous | NSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0099847_10608572 | 3300007540 | Aqueous | LRIFADSGVEDVSTREQAHAILRALNQIEGMLDAAIVAERFLDRKLKGTAP* |
| Ga0102862_10722791 | 3300007670 | Estuarine | DVEAREDAHAILRAVNQIEITLDAAITAEVILDRKQRN* |
| Ga0111033_12062631 | 3300008516 | Marine Sediment | SAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0102814_102544162 | 3300009079 | Estuarine | RIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0115545_10829582 | 3300009433 | Pelagic Marine | ASDIEAREEAHAIMRALNQIEMVLDATIAAETLLDRKQ* |
| Ga0115546_10699513 | 3300009435 | Pelagic Marine | IFANSAAQEIEQREEAHAILRALNLIEVNLDAALAAETLLDRKK* |
| Ga0115567_100438691 | 3300009508 | Pelagic Marine | AREEAHAIIRALNQIEVNLDAALAAETLLDRKQRK* |
| Ga0115103_13572992 | 3300009599 | Marine | RIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVI* |
| Ga0115103_15522791 | 3300009599 | Marine | AAREEAHAMIRALNQIEVTLDAALAAETLLDRKQRK* |
| Ga0115103_17756333 | 3300009599 | Marine | IFADSSASDVDVREDAHAILRAVNQIEIKLDAALAAELILDRKQRN* |
| Ga0115102_104693561 | 3300009606 | Marine | RIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN* |
| Ga0115100_108633041 | 3300009608 | Marine | DAREEAHSIVRALNQIEVILDAKVNAETILDHKQRK* |
| Ga0115100_109485301 | 3300009608 | Marine | MRIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN* |
| Ga0115104_102326021 | 3300009677 | Marine | NHEVEKREDAHAIVRAVKEIEVHLDAAIAAETLLQLRRK* |
| Ga0115104_102366381 | 3300009677 | Marine | QFIEDVRNEQIRLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ* |
| Ga0115104_102972432 | 3300009677 | Marine | RIFANSAAQDVEQREEAHAILRALNLIEVNLDAALAAETLLDRKR* |
| Ga0123368_11237373 | 3300009750 | Marine | VQLSIFANSAAKEIEQREEAHAVMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0123360_10700722 | 3300009753 | Marine | SIFANSAAKEIEQREEAHAVMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0123376_10752763 | 3300010129 | Marine | LSIFANSAAKEIEQREEAHAVMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0098049_10220891 | 3300010149 | Marine | RDVQLSIFANSTAKEIEQREEAHAIMRALNQIEMQLDAAITAERMLDRSK* |
| Ga0129348_10601001 | 3300010296 | Freshwater To Marine Saline Gradient | EIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE* |
| Ga0129345_13299461 | 3300010297 | Freshwater To Marine Saline Gradient | FVDDVREEQMRLFANSAASDIEMREEAHAILRALNQIEIRLDAAIAAERILDRKERN* |
| Ga0129351_12004682 | 3300010300 | Freshwater To Marine Saline Gradient | IFANSAASDIEMREEAHAILRALDQIEMQLNAAIAAERILDRKQRN* |
| Ga0129324_100701341 | 3300010368 | Freshwater To Marine Saline Gradient | RLFADSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0136549_101024263 | 3300010389 | Marine Methane Seep Sediment | QEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRHK* |
| Ga0151677_10011185 | 3300011258 | Marine | XASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN* |
| Ga0138260_105031991 | 3300012419 | Polar Marine | DSEVSDVDTRENAHSILRALNQIEFILNAASAAEVILDRKERK* |
| Ga0129347_10091684 | 3300012504 | Aqueous | VQISIFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0129344_13761373 | 3300012520 | Aqueous | QTSIFTNSTADEIERREEAHAIIRALNQIEVQLDAAIAAERILDRNK* |
| Ga0129326_10811251 | 3300012522 | Aqueous | QMRLFANSAASDIEMREEAHAILRALNKIGDTLDAAIAAEVILDRKQRN* |
| Ga0129350_10160082 | 3300012523 | Aqueous | VFATSDAKDIEAREEAHAVIRALNLIEMNLDAAIAAETFLDLRKG* |
| Ga0129353_11562261 | 3300012525 | Aqueous | AHEVERREEAHAIIRALNLIEVNLDAAIAAETLLDRKK* |
| Ga0129353_14090321 | 3300012525 | Aqueous | QISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE* |
| Ga0163179_103822171 | 3300012953 | Seawater | EDVRNEQIRLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ* |
| Ga0129340_10822711 | 3300012963 | Aqueous | KEIEQREEAHAVMRALNQIEMQLDAAIAAERMLDRK* |
| Ga0129343_12843983 | 3300012967 | Aqueous | SIFTNSTADEIERREEAHAIIRALNQIEVQLDAAIAAERILDRNK* |
| Ga0182050_10644491 | 3300016689 | Salt Marsh | QMSIFAGSEASELDVREEAHAILRALNQIEMQLEAAIAAERILDRKQRN |
| Ga0182085_13816084 | 3300016723 | Salt Marsh | QMDIFANSEPQEIEVREQAHAILRALNQIEIRLDAAIAAERILDRKERN |
| Ga0182045_13349201 | 3300016726 | Salt Marsh | TQMSIFAGSEASELDVREEAHAILRALNQIEMQLEAAIAAERILDRKQRN |
| Ga0182094_13355163 | 3300016731 | Salt Marsh | DIFANSEPQEIEVREQAHAILRALNQIEIRLDAAIAAERILDRKERN |
| Ga0182094_14053991 | 3300016731 | Salt Marsh | SIFMNSAAEDIDSREEAHAVLRALDQIEMQLNAAIAAETMLDRKQRN |
| Ga0182057_13342482 | 3300016732 | Salt Marsh | QISIFSNSTAEETKQREEAHAIMRALNQIEMQLDAAIAAERMLDRSR |
| Ga0182074_11459833 | 3300016735 | Salt Marsh | VFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182049_11785723 | 3300016736 | Salt Marsh | LHVFADSAASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0182076_12903242 | 3300016739 | Salt Marsh | FTNSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182079_11058623 | 3300016741 | Salt Marsh | VQLSIFANSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182083_15202271 | 3300016743 | Salt Marsh | SIFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182055_13129462 | 3300016746 | Salt Marsh | VERREEAHAIIRALNLIEVNLDAAIAAETLLDRKK |
| Ga0182078_103795101 | 3300016747 | Salt Marsh | TAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182043_12122321 | 3300016748 | Salt Marsh | VRDTQLHVFADSAASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0182053_11321822 | 3300016749 | Salt Marsh | MSIFAGSEASELDVREEAHAILRALNQIEMQLEAAIAAERILDRKQRN |
| Ga0182062_11270181 | 3300016751 | Salt Marsh | ASDIEAREEAHAIIRALNKIEVSLDAAIGAETLLDRKQ |
| Ga0182062_12554782 | 3300016751 | Salt Marsh | EIERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0182062_13130073 | 3300016751 | Salt Marsh | QISIFSNSAAEETKQREEAHAIMRALNQIEMQLDAAIAAERMLDRNR |
| Ga0182070_11945251 | 3300016758 | Salt Marsh | TNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182082_10576282 | 3300016771 | Salt Marsh | FVQDVRDVQISIFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182063_16695481 | 3300016781 | Salt Marsh | QISIFSNSAASEVEQREEAHAILRALNQIEMQLDAAIAAERMLDRSR |
| Ga0182095_13821111 | 3300016791 | Salt Marsh | FMNSAAEDIDSREEAHAVLRALDQIEMQLNAAIAAETMLDRKQRN |
| Ga0181401_10525892 | 3300017727 | Seawater | ATSDAKDIEAREEAHAVIRALNLIEMNLDAAIAAETFLDLRKG |
| Ga0181420_10672771 | 3300017757 | Seawater | RNEQIRLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ |
| Ga0181409_10583112 | 3300017758 | Seawater | RLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ |
| Ga0181422_10182011 | 3300017762 | Seawater | NEQIRLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ |
| Ga0181410_10174611 | 3300017763 | Seawater | DVFATSDAKDIEAREEAHAVIRALNLIEMNLDAAIAAETFLDLRKG |
| Ga0181423_13832471 | 3300017781 | Seawater | KAFMDSAASDIEAREEAHAIMRALNQIEMVLDATIAAETLLDRKQ |
| Ga0181580_107484641 | 3300017956 | Salt Marsh | NTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSR |
| Ga0181581_105678402 | 3300017962 | Salt Marsh | RIFTNSAASDIEAREEAHAIIRALNKIEVSLDAAIGAETLLDRKQ |
| Ga0181589_101910151 | 3300017964 | Salt Marsh | NSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0181589_106642972 | 3300017964 | Salt Marsh | FFQDVRDVQISIFTNSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRNKQE |
| Ga0181587_104861271 | 3300017968 | Salt Marsh | EVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0181560_101337721 | 3300018413 | Salt Marsh | DSGASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0181559_107319641 | 3300018415 | Salt Marsh | EQMRIFANSAASDIEMREEAHAILRALNQIEMQLEAAIAAERILDRKQRN |
| Ga0181591_103723483 | 3300018424 | Salt Marsh | DVQISIFSNSAAEETTEREEAHAIIRALNQIEMQLDAAIAAGRILDRKK |
| Ga0181564_102208471 | 3300018876 | Salt Marsh | VFADSAASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0180033_1023321 | 3300019198 | Estuarine | EQMRIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0182064_11411521 | 3300019253 | Salt Marsh | SEVEQREEAHAILRALNQIEMQLDAAIAAERMLDRSR |
| Ga0182097_14906822 | 3300019261 | Salt Marsh | QISIFMNSAAEDIDSREEAHAVLRALDQIEMQLNAAIAAETMLDRKQRN |
| Ga0182066_14430301 | 3300019262 | Salt Marsh | QMRIFTNSAASDIEAREEAHAIIRALNKIEVSLDAAIGAETLLDRKQ |
| Ga0182061_11536621 | 3300019266 | Salt Marsh | QISIFANSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0182061_13777863 | 3300019266 | Salt Marsh | FVTSAAEDIERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0182065_12876541 | 3300019271 | Salt Marsh | QISIFTNSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182059_10246012 | 3300019272 | Salt Marsh | FVTSAAEEIERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0182077_10316691 | 3300019281 | Salt Marsh | HEVERREEAHAIIRALNLIEVNLDAAIAAETLLDRKK |
| Ga0182077_13184291 | 3300019281 | Salt Marsh | VQLSIFANSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0182077_14242562 | 3300019281 | Salt Marsh | VQISIFTNSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0182075_14447332 | 3300019282 | Salt Marsh | VQISIFSNSTASEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSR |
| Ga0193986_10316562 | 3300019698 | Sediment | EMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0194032_10171272 | 3300019938 | Freshwater | EHSAAHEIERREEAHSIIRALNQIEVNLDAAIAAETLLDRNKGS |
| Ga0182086_11664601 | 3300020013 | Salt Marsh | ADSEASEVGVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0182044_11710121 | 3300020014 | Salt Marsh | QIRIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0182044_12395831 | 3300020014 | Salt Marsh | HVFADSEASEVGVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0182044_13491833 | 3300020014 | Salt Marsh | FVQDVRDTQLHVFADSAASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0181574_107070102 | 3300020056 | Salt Marsh | TKQREEAHAIMRALNQIEMQLDAAIAAERMLDRNR |
| Ga0206125_100818103 | 3300020165 | Seawater | DVREDAHAILRAVNQIEIKLDASIQAEIILDRKQRN |
| Ga0206128_11413681 | 3300020166 | Seawater | ADDMHAREEAHAMVRALNLIEVNLDAAIAAETLLDRKQRK |
| Ga0181596_102907442 | 3300020177 | Salt Marsh | SREEAHAVLRALDQIEMQLNAAIAAETMLDRKQRN |
| Ga0181573_103096802 | 3300020184 | Salt Marsh | SNSAAEETKQREEAHAIMRALNQIEMQLDAAIAAERMLDRNR |
| Ga0181570_105128711 | 3300020207 | Salt Marsh | AEDIERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0211499_101915082 | 3300020402 | Marine | DVRNEQIRLFTTSGAQDIEVREEAHAVLRALTKIEVELDAAIMAETLLDRKQ |
| Ga0211576_103516351 | 3300020438 | Marine | IQDVRNEQIRLFTTSAAQDIEVREEAHAVLRALTKIEVQLDAAIMAETLLDRKQ |
| Ga0211559_104244222 | 3300020442 | Marine | TSGVQDVEQREEAHAILRALNKIEVQLDAAIAAETLLDRKQ |
| Ga0206692_10936371 | 3300021350 | Seawater | ANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0213865_100207201 | 3300021373 | Seawater | ANSAASDIEMREEAHAILRALNKIGDALDSAIAAEVILDRKQRN |
| Ga0213865_102370171 | 3300021373 | Seawater | ANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0213868_100722254 | 3300021389 | Seawater | ADVAAREEAHAIIRALNQIEVTLDAALAAETLLDRKQRT |
| Ga0213868_104456971 | 3300021389 | Seawater | RIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0213866_100548541 | 3300021425 | Seawater | AAEEIERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0213866_100665601 | 3300021425 | Seawater | QSEVREEAHAILRALNAVEVYLDAVIAAETLLDRKQRK |
| Ga0222718_100686463 | 3300021958 | Estuarine Water | FVQDVRDVQLSIFANSTASEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0222718_102073431 | 3300021958 | Estuarine Water | FVQDVRDVQLSIFANSTASEVEQREEAHAIMRALNQIEMQLEAAIAAERMLDRK |
| Ga0222716_100511086 | 3300021959 | Estuarine Water | IFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0212021_10789122 | 3300022068 | Aqueous | MQFVQDVRDLQTSIFTNSTADEIERREEAHAIIRALNQIEVQLDAAIAAERILDRNK |
| Ga0212028_11132502 | 3300022071 | Aqueous | TAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0224906_12043332 | 3300022074 | Seawater | ADEIERREEAHAIIRALNQIEVNLDAAIAAETLLDHRQGN |
| Ga0196893_10018723 | 3300022159 | Aqueous | NTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0212031_10100461 | 3300022176 | Aqueous | VRELQISIFMNSAAEDIDSREEAHAVLRALDQIEMQLNAAIAAETMLDRKQRN |
| Ga0196891_10816941 | 3300022183 | Aqueous | QEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0196901_11657982 | 3300022200 | Aqueous | ASEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSR |
| Ga0224499_103459172 | 3300022206 | Sediment | MRIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0255773_103853012 | 3300022925 | Salt Marsh | ERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0255769_100994163 | 3300022927 | Salt Marsh | EDIDSREEAHAVLRALDQIEMQLNAAIAAETMLDRKQRN |
| Ga0255762_102323072 | 3300023119 | Salt Marsh | DIEAREEAHAIIRALNKIEVSLDAAIGAETLLDRKQ |
| Ga0255772_105711002 | 3300023176 | Salt Marsh | FANSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRNKQE |
| Ga0255759_107743321 | 3300023178 | Salt Marsh | VQISIFTNTTAQEIEQREEAHAIMRALNQIEMQLDAAIAAERMLDRK |
| Ga0228679_10193491 | 3300023566 | Seawater | LFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ |
| Ga0228694_1334441 | 3300023567 | Seawater | SASDVDVREDAHAILRAVNQIEIKLDASIQAEIILDRKQRK |
| Ga0228696_10112962 | 3300023568 | Seawater | VDAREEAHSIVRALNQIEVILDAKVNAETILDHKQRK |
| Ga0228681_10210671 | 3300023683 | Seawater | RIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0228686_10027981 | 3300023685 | Seawater | QIRLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ |
| Ga0228695_10399042 | 3300023699 | Seawater | AADVAAREEAHAMIRALNQIEVTLDAALAAEALLDRKQRK |
| Ga0228695_10599301 | 3300023699 | Seawater | AASDIEMREEAHAILRALHKIGDALDAAIAAEVILDRKRRN |
| Ga0232123_10211601 | 3300023706 | Salt Marsh | QLHVFADSAASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0232122_10325311 | 3300023709 | Salt Marsh | QDVRDTQLHVFADSAASEVDVREEAHAILRALNQIEIQLDAAIAAERILDRKQRN |
| Ga0232122_10994201 | 3300023709 | Salt Marsh | QIRIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRS |
| Ga0228631_11022602 | 3300024329 | Seawater | FANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0233396_10553201 | 3300024428 | Seawater | IRLFTTSVAEDVEQREEAHAILRALTKIEVQLDACIMAETLLDRKQ |
| Ga0208434_10792842 | 3300025098 | Marine | DVQLSIFANSTAKEIEQREEAHAIMRALNQIEMQLDAAITAERMLDRSK |
| Ga0208793_11631511 | 3300025108 | Marine | RREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0209634_11139082 | 3300025138 | Marine | IEQREEAHAIMRALNLIEAQLDAAIGDEVVLDHSK |
| Ga0208148_10310821 | 3300025508 | Aqueous | IEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0208303_11222862 | 3300025543 | Aqueous | LVADSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0208162_10756682 | 3300025674 | Aqueous | QDVRDVQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0208162_11237451 | 3300025674 | Aqueous | VQMNVFANSAAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRHK |
| Ga0208150_12623932 | 3300025751 | Aqueous | VQDVRDVQMNVFANSAAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRHK |
| Ga0208427_10967101 | 3300025771 | Aqueous | IERREEAHSIIRALNLIEVNLDAAIAAETLLDRKQGS |
| Ga0208542_10389713 | 3300025818 | Aqueous | QQFVQDVRDVQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0208645_11181902 | 3300025853 | Aqueous | QDVEKREEAHAIIRALNLIEVNLDAAIAAETLLDRKK |
| Ga0208544_100560393 | 3300025887 | Aqueous | EMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0208880_10128691 | 3300026085 | Marine | VKAFMDSAASDVEAREEAHAILRALNQIEMVLDATIAAETLLDRKQ |
| Ga0209929_11562012 | 3300026187 | Pond Water | SAASDIEMREEAHAILRALNKIGDTLDAAIAAEVILDRKQRN |
| Ga0247558_1129631 | 3300026390 | Seawater | IEMREEAHAILRALNKIGDTLDAAIAAEVILDRKQRN |
| Ga0247581_10616012 | 3300026420 | Seawater | VDVREDAHAILRAVNQIEIKLDASIQAEIILDRKQRK |
| Ga0247607_10860582 | 3300026447 | Seawater | SDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0247604_10832611 | 3300026460 | Seawater | EQMRIFANSAASDIEMREEAHAILRALNKIGDTLDAAIAAEVILDRKRRN |
| Ga0247568_11034182 | 3300026462 | Seawater | GASDVEAREEAHAIIRALNQIEVNLDAALAAETLLDRKQRK |
| Ga0247598_11057751 | 3300026466 | Seawater | RIFANSAASDIEMREEAHAILRALNKIGDTLDAAIAAEVILDLKRRN |
| Ga0247592_10074401 | 3300026500 | Seawater | IEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0247605_10377501 | 3300026503 | Seawater | VDVREDAHAILRAVNQIEIKLDAALAAEVILDRKQRN |
| Ga0209383_10207736 | 3300027672 | Marine | DVAAREEAHAMLRALNQIQVTLDAALAAETLLDRKQRT |
| (restricted) Ga0255041_102349892 | 3300027837 | Seawater | DVAAREEAHAIIRALNQIEVTLDAALAAETLLDRKQRT |
| (restricted) Ga0255055_107333621 | 3300027881 | Seawater | MRIFANSAASDIEMREEAHAILRALNKIGDTLDAAIAAEVILDRKRRN |
| Ga0247562_10012083 | 3300028076 | Seawater | QMRIFANSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0256411_10333131 | 3300028134 | Seawater | QMRIFANSAASDIEMREEAHAILRALNKIGDTLDAAIAAEVILDRKRRN |
| Ga0256417_11836642 | 3300028233 | Seawater | RIFANSAASDIEMREEAHAILRALNKIGDALDTAIAAEVILDRKQRN |
| Ga0316201_111375041 | 3300032136 | Worm Burrow | AASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKQRN |
| Ga0316209_10890972 | 3300032255 | Microbial Mat | NSAASDIEMREEAHAILRALNKIGDALDAAIAAEVILDRKRRN |
| Ga0316189_107096502 | 3300032272 | Worm Burrow | DIEMREEAHAILRALNKIGDALDAATAAEVILDRKRRN |
| Ga0348335_061015_52_198 | 3300034374 | Aqueous | MDIFANSEPQEIEVREQAHAILRALNQIEIRLDAAIAAERILDRKERN |
| Ga0348336_149082_522_698 | 3300034375 | Aqueous | QFVQDVRDVQISIFTNSTAQEVEQREEAHAIMRALNQIEMQLDAAIAAERMLDRSKQE |
| Ga0348336_164253_479_631 | 3300034375 | Aqueous | VQISIFTNTTAQEVEQREEAHAIMRALNQIEMQLNAAIAAERMLDRSKQE |
| Ga0348337_143061_1_123 | 3300034418 | Aqueous | AADVAAREEAHAMIRALNQIEVTLDAALAAETLLDRKQRK |
| ⦗Top⦘ |