


| Basic Information | |
|---|---|
| Family ID | F025016 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAIARKKS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 17.73 % |
| % of genes near scaffold ends (potentially truncated) | 33.99 % |
| % of genes from short scaffolds (< 2000 bps) | 81.77 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (41.379 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (64.532 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.266 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.70% β-sheet: 0.00% Coil/Unstructured: 47.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 13.30 |
| PF13529 | Peptidase_C39_2 | 6.40 |
| PF08291 | Peptidase_M15_3 | 4.93 |
| PF00959 | Phage_lysozyme | 4.93 |
| PF13264 | DUF4055 | 3.94 |
| PF16778 | Phage_tail_APC | 1.97 |
| PF14279 | HNH_5 | 1.97 |
| PF01844 | HNH | 1.97 |
| PF00436 | SSB | 0.99 |
| PF03237 | Terminase_6N | 0.99 |
| PF06559 | DCD | 0.99 |
| PF11753 | DUF3310 | 0.49 |
| PF13884 | Peptidase_S74 | 0.49 |
| PF01391 | Collagen | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.99 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.99 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.62 % |
| Unclassified | root | N/A | 41.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10230201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300006025|Ga0075474_10006653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4591 | Open in IMG/M |
| 3300006025|Ga0075474_10135221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300006025|Ga0075474_10175160 | All Organisms → Viruses | 666 | Open in IMG/M |
| 3300006026|Ga0075478_10000315 | Not Available | 17678 | Open in IMG/M |
| 3300006026|Ga0075478_10028426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1870 | Open in IMG/M |
| 3300006026|Ga0075478_10085809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1012 | Open in IMG/M |
| 3300006026|Ga0075478_10107651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 886 | Open in IMG/M |
| 3300006026|Ga0075478_10192133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300006027|Ga0075462_10148839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300006637|Ga0075461_10076579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1066 | Open in IMG/M |
| 3300006802|Ga0070749_10010364 | Not Available | 6046 | Open in IMG/M |
| 3300006802|Ga0070749_10025362 | Not Available | 3728 | Open in IMG/M |
| 3300006802|Ga0070749_10104360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1674 | Open in IMG/M |
| 3300006802|Ga0070749_10114095 | Not Available | 1590 | Open in IMG/M |
| 3300006802|Ga0070749_10226869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1063 | Open in IMG/M |
| 3300006802|Ga0070749_10233799 | Not Available | 1045 | Open in IMG/M |
| 3300006802|Ga0070749_10308544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 886 | Open in IMG/M |
| 3300006802|Ga0070749_10387149 | Not Available | 773 | Open in IMG/M |
| 3300006802|Ga0070749_10410637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 746 | Open in IMG/M |
| 3300006802|Ga0070749_10448993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300006803|Ga0075467_10559029 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300006810|Ga0070754_10063091 | Not Available | 1914 | Open in IMG/M |
| 3300006810|Ga0070754_10102699 | All Organisms → Viruses | 1411 | Open in IMG/M |
| 3300006810|Ga0070754_10171839 | Not Available | 1024 | Open in IMG/M |
| 3300006810|Ga0070754_10377467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 623 | Open in IMG/M |
| 3300006810|Ga0070754_10407890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300006810|Ga0070754_10530232 | Not Available | 505 | Open in IMG/M |
| 3300006868|Ga0075481_10168926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300006868|Ga0075481_10240553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 640 | Open in IMG/M |
| 3300006869|Ga0075477_10286838 | Not Available | 657 | Open in IMG/M |
| 3300006869|Ga0075477_10370014 | Not Available | 561 | Open in IMG/M |
| 3300006869|Ga0075477_10391806 | All Organisms → Viruses | 541 | Open in IMG/M |
| 3300006870|Ga0075479_10251903 | Not Available | 700 | Open in IMG/M |
| 3300006874|Ga0075475_10292732 | All Organisms → Viruses | 673 | Open in IMG/M |
| 3300006919|Ga0070746_10142464 | Not Available | 1171 | Open in IMG/M |
| 3300006919|Ga0070746_10301462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300007344|Ga0070745_1041356 | Not Available | 1932 | Open in IMG/M |
| 3300007344|Ga0070745_1173493 | Not Available | 807 | Open in IMG/M |
| 3300007344|Ga0070745_1250942 | All Organisms → Viruses | 640 | Open in IMG/M |
| 3300007344|Ga0070745_1322707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300007344|Ga0070745_1353074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300007345|Ga0070752_1007697 | Not Available | 6039 | Open in IMG/M |
| 3300007345|Ga0070752_1132494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300007345|Ga0070752_1237243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 714 | Open in IMG/M |
| 3300007345|Ga0070752_1265621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300007346|Ga0070753_1208748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300007346|Ga0070753_1215911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 705 | Open in IMG/M |
| 3300007346|Ga0070753_1356295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300007538|Ga0099851_1019104 | Not Available | 2773 | Open in IMG/M |
| 3300007538|Ga0099851_1024932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2410 | Open in IMG/M |
| 3300007538|Ga0099851_1299236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300007539|Ga0099849_1020291 | Not Available | 2894 | Open in IMG/M |
| 3300007539|Ga0099849_1082664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1298 | Open in IMG/M |
| 3300007539|Ga0099849_1217391 | Not Available | 713 | Open in IMG/M |
| 3300007539|Ga0099849_1232912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300007539|Ga0099849_1258834 | Not Available | 638 | Open in IMG/M |
| 3300007539|Ga0099849_1332894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300007540|Ga0099847_1054378 | Not Available | 1256 | Open in IMG/M |
| 3300007540|Ga0099847_1185703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300007540|Ga0099847_1199556 | Not Available | 584 | Open in IMG/M |
| 3300007541|Ga0099848_1009099 | Not Available | 4417 | Open in IMG/M |
| 3300007541|Ga0099848_1106539 | Not Available | 1071 | Open in IMG/M |
| 3300007541|Ga0099848_1258573 | Not Available | 607 | Open in IMG/M |
| 3300007542|Ga0099846_1033795 | Not Available | 1964 | Open in IMG/M |
| 3300007542|Ga0099846_1102789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1051 | Open in IMG/M |
| 3300007542|Ga0099846_1148048 | Not Available | 846 | Open in IMG/M |
| 3300007542|Ga0099846_1234533 | Not Available | 640 | Open in IMG/M |
| 3300007542|Ga0099846_1246983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
| 3300007640|Ga0070751_1042476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2028 | Open in IMG/M |
| 3300007640|Ga0070751_1043764 | Not Available | 1993 | Open in IMG/M |
| 3300007640|Ga0070751_1167265 | Not Available | 871 | Open in IMG/M |
| 3300007640|Ga0070751_1240507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 691 | Open in IMG/M |
| 3300007960|Ga0099850_1051530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1755 | Open in IMG/M |
| 3300007960|Ga0099850_1208201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300008012|Ga0075480_10350352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 737 | Open in IMG/M |
| 3300008012|Ga0075480_10536990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300009124|Ga0118687_10126275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300009124|Ga0118687_10156879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300010296|Ga0129348_1004002 | Not Available | 5397 | Open in IMG/M |
| 3300010296|Ga0129348_1068790 | Not Available | 1264 | Open in IMG/M |
| 3300010296|Ga0129348_1111580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300010299|Ga0129342_1144831 | Not Available | 869 | Open in IMG/M |
| 3300010299|Ga0129342_1336121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
| 3300010300|Ga0129351_1090193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1235 | Open in IMG/M |
| 3300010300|Ga0129351_1217641 | Not Available | 737 | Open in IMG/M |
| 3300010300|Ga0129351_1253867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300010300|Ga0129351_1316648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 589 | Open in IMG/M |
| 3300010368|Ga0129324_10114996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1148 | Open in IMG/M |
| 3300010368|Ga0129324_10172763 | Not Available | 889 | Open in IMG/M |
| 3300010368|Ga0129324_10244203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300010389|Ga0136549_10011392 | All Organisms → Viruses | 5914 | Open in IMG/M |
| 3300010389|Ga0136549_10018123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4326 | Open in IMG/M |
| 3300010389|Ga0136549_10127287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1168 | Open in IMG/M |
| 3300010389|Ga0136549_10394411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300010412|Ga0136852_10414043 | Not Available | 1314 | Open in IMG/M |
| 3300013010|Ga0129327_10053678 | Not Available | 2010 | Open in IMG/M |
| 3300017697|Ga0180120_10127713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1089 | Open in IMG/M |
| 3300017949|Ga0181584_10048941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2994 | Open in IMG/M |
| 3300017951|Ga0181577_10002127 | Not Available | 15655 | Open in IMG/M |
| 3300017958|Ga0181582_10394192 | Not Available | 883 | Open in IMG/M |
| 3300017962|Ga0181581_10853313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300017964|Ga0181589_10047390 | All Organisms → cellular organisms → Bacteria | 3234 | Open in IMG/M |
| 3300017967|Ga0181590_10177592 | Not Available | 1613 | Open in IMG/M |
| 3300017967|Ga0181590_10819093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300018421|Ga0181592_10457483 | Not Available | 890 | Open in IMG/M |
| 3300018421|Ga0181592_10719353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300018421|Ga0181592_11007523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300018424|Ga0181591_10661558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 740 | Open in IMG/M |
| 3300019708|Ga0194016_1022214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300019756|Ga0194023_1007160 | Not Available | 2236 | Open in IMG/M |
| 3300019756|Ga0194023_1038228 | Not Available | 969 | Open in IMG/M |
| 3300019756|Ga0194023_1052647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300019756|Ga0194023_1063744 | Not Available | 740 | Open in IMG/M |
| 3300019756|Ga0194023_1110314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300019765|Ga0194024_1021320 | Not Available | 1384 | Open in IMG/M |
| 3300019765|Ga0194024_1023387 | Not Available | 1327 | Open in IMG/M |
| 3300019765|Ga0194024_1077435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300019937|Ga0194022_1019487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 894 | Open in IMG/M |
| 3300020054|Ga0181594_10133734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1351 | Open in IMG/M |
| 3300020054|Ga0181594_10453264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300020439|Ga0211558_10038945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2395 | Open in IMG/M |
| 3300021373|Ga0213865_10109374 | Not Available | 1463 | Open in IMG/M |
| 3300021379|Ga0213864_10305695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 807 | Open in IMG/M |
| 3300021425|Ga0213866_10072434 | Not Available | 1914 | Open in IMG/M |
| 3300021958|Ga0222718_10011444 | Not Available | 6563 | Open in IMG/M |
| 3300021958|Ga0222718_10054525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2519 | Open in IMG/M |
| 3300021959|Ga0222716_10261899 | Not Available | 1062 | Open in IMG/M |
| 3300021959|Ga0222716_10697859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300021960|Ga0222715_10001475 | Not Available | 22421 | Open in IMG/M |
| 3300021960|Ga0222715_10097517 | Not Available | 1905 | Open in IMG/M |
| 3300021960|Ga0222715_10263604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300021960|Ga0222715_10385183 | Not Available | 771 | Open in IMG/M |
| 3300021960|Ga0222715_10428100 | Not Available | 717 | Open in IMG/M |
| 3300021962|Ga0222713_10731769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300021964|Ga0222719_10060081 | Not Available | 2869 | Open in IMG/M |
| 3300021964|Ga0222719_10394951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 862 | Open in IMG/M |
| 3300021964|Ga0222719_10430282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 812 | Open in IMG/M |
| 3300022053|Ga0212030_1038397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300022057|Ga0212025_1042810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300022057|Ga0212025_1054506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300022069|Ga0212026_1065065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300022176|Ga0212031_1014052 | Not Available | 1180 | Open in IMG/M |
| 3300022176|Ga0212031_1091093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300022187|Ga0196899_1037640 | All Organisms → Viruses | 1656 | Open in IMG/M |
| 3300022198|Ga0196905_1021720 | Not Available | 2001 | Open in IMG/M |
| 3300022198|Ga0196905_1028054 | All Organisms → Viruses | 1708 | Open in IMG/M |
| 3300022198|Ga0196905_1157767 | Not Available | 581 | Open in IMG/M |
| 3300022200|Ga0196901_1064013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1345 | Open in IMG/M |
| 3300022200|Ga0196901_1152356 | Not Available | 769 | Open in IMG/M |
| 3300022200|Ga0196901_1184118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300022213|Ga0224500_10012892 | Not Available | 3739 | Open in IMG/M |
| 3300023115|Ga0255760_10332063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300024502|Ga0255181_1021266 | Not Available | 1261 | Open in IMG/M |
| 3300024857|Ga0256339_1098573 | Not Available | 601 | Open in IMG/M |
| 3300025543|Ga0208303_1091142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300025610|Ga0208149_1020832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1871 | Open in IMG/M |
| 3300025630|Ga0208004_1017471 | Not Available | 2279 | Open in IMG/M |
| 3300025630|Ga0208004_1021528 | Not Available | 1996 | Open in IMG/M |
| 3300025646|Ga0208161_1004301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6713 | Open in IMG/M |
| 3300025647|Ga0208160_1079596 | Not Available | 880 | Open in IMG/M |
| 3300025647|Ga0208160_1127203 | Not Available | 638 | Open in IMG/M |
| 3300025653|Ga0208428_1058856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1149 | Open in IMG/M |
| 3300025653|Ga0208428_1142214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300025655|Ga0208795_1063085 | Not Available | 1065 | Open in IMG/M |
| 3300025655|Ga0208795_1152701 | Not Available | 575 | Open in IMG/M |
| 3300025671|Ga0208898_1006993 | Not Available | 6052 | Open in IMG/M |
| 3300025671|Ga0208898_1029398 | Not Available | 2268 | Open in IMG/M |
| 3300025671|Ga0208898_1032068 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
| 3300025671|Ga0208898_1035017 | Not Available | 1995 | Open in IMG/M |
| 3300025671|Ga0208898_1049178 | Not Available | 1545 | Open in IMG/M |
| 3300025671|Ga0208898_1070353 | All Organisms → Viruses | 1167 | Open in IMG/M |
| 3300025671|Ga0208898_1088676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 973 | Open in IMG/M |
| 3300025671|Ga0208898_1095326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300025671|Ga0208898_1131055 | Not Available | 707 | Open in IMG/M |
| 3300025671|Ga0208898_1134350 | Not Available | 692 | Open in IMG/M |
| 3300025671|Ga0208898_1186207 | Not Available | 518 | Open in IMG/M |
| 3300025674|Ga0208162_1023387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2345 | Open in IMG/M |
| 3300025674|Ga0208162_1044844 | Not Available | 1519 | Open in IMG/M |
| 3300025751|Ga0208150_1084198 | Not Available | 1051 | Open in IMG/M |
| 3300025759|Ga0208899_1182302 | All Organisms → Viruses | 685 | Open in IMG/M |
| 3300025769|Ga0208767_1038348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2369 | Open in IMG/M |
| 3300025771|Ga0208427_1066876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1291 | Open in IMG/M |
| 3300025818|Ga0208542_1120495 | All Organisms → Viruses | 736 | Open in IMG/M |
| 3300025889|Ga0208644_1004740 | Not Available | 10171 | Open in IMG/M |
| 3300025889|Ga0208644_1039742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2713 | Open in IMG/M |
| 3300026566|Ga0256334_1114542 | Not Available | 613 | Open in IMG/M |
| 3300027917|Ga0209536_101197413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 932 | Open in IMG/M |
| 3300028286|Ga0256331_1121930 | Not Available | 589 | Open in IMG/M |
| 3300031565|Ga0307379_11129803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 656 | Open in IMG/M |
| 3300031673|Ga0307377_10818896 | Not Available | 642 | Open in IMG/M |
| 3300032136|Ga0316201_11430520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 574 | Open in IMG/M |
| 3300034374|Ga0348335_003194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10969 | Open in IMG/M |
| 3300034374|Ga0348335_005556 | Not Available | 7785 | Open in IMG/M |
| 3300034374|Ga0348335_050878 | All Organisms → Viruses | 1599 | Open in IMG/M |
| 3300034374|Ga0348335_062979 | All Organisms → Viruses | 1346 | Open in IMG/M |
| 3300034374|Ga0348335_063146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1344 | Open in IMG/M |
| 3300034374|Ga0348335_085839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300034374|Ga0348335_106443 | All Organisms → Viruses | 866 | Open in IMG/M |
| 3300034374|Ga0348335_167355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300034375|Ga0348336_093272 | Not Available | 1045 | Open in IMG/M |
| 3300034418|Ga0348337_039579 | Not Available | 2034 | Open in IMG/M |
| 3300034418|Ga0348337_077942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1171 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 64.53% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.90% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.40% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.43% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.97% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.97% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.48% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.49% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.49% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.49% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.49% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.49% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.49% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_102302011 | 3300000116 | Marine | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLIN |
| Ga0075474_100066539 | 3300006025 | Aqueous | MDPTTIAVIAILAAAGSEIITLLPMRENSWIQLLIKVLNAIAQKK* |
| Ga0075474_101352211 | 3300006025 | Aqueous | MDPTVLAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNVIAKKK* |
| Ga0075474_101751602 | 3300006025 | Aqueous | MDPSTLAVVAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0075478_100003157 | 3300006026 | Aqueous | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK* |
| Ga0075478_100284262 | 3300006026 | Aqueous | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKLLNVIAKKK* |
| Ga0075478_100858092 | 3300006026 | Aqueous | MMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK* |
| Ga0075478_101076513 | 3300006026 | Aqueous | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK* |
| Ga0075478_101921331 | 3300006026 | Aqueous | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK* |
| Ga0075462_101488392 | 3300006027 | Aqueous | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK* |
| Ga0075461_100765794 | 3300006637 | Aqueous | LARILIYMDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLLINVLNAVARKKS* |
| Ga0070749_100103646 | 3300006802 | Aqueous | MDPTTIAVVAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0070749_1002536210 | 3300006802 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTVLKVIARKKS* |
| Ga0070749_101043602 | 3300006802 | Aqueous | MDPTLIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIAKKK* |
| Ga0070749_101140952 | 3300006802 | Aqueous | MDPTALATIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0070749_102268692 | 3300006802 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLLVTFLKVIARKKS* |
| Ga0070749_102337992 | 3300006802 | Aqueous | MDPTNVAVVAILAAAGSEILALLPIRSNSWVQFLVTFLKVIARKKS* |
| Ga0070749_103085442 | 3300006802 | Aqueous | MDPTTIAIIAILAAAGSEIITLLPMRENSWIQLLIKVLNAIAQKK* |
| Ga0070749_103871492 | 3300006802 | Aqueous | MDPTTLATVAILAAAGSEILTLLPIRSNSWVQLVISVLNAIARKKS* |
| Ga0070749_104106372 | 3300006802 | Aqueous | MDPTTLAVFAILAAAGSEILTLLPIRSNSWVQLVINVLNVISRKKS* |
| Ga0070749_104489932 | 3300006802 | Aqueous | MDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0075467_105590293 | 3300006803 | Aqueous | MDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0070754_100630913 | 3300006810 | Aqueous | MDATTIAVVAILAAAGSEILTLLPIRSNSWIQLVISLLNAISRKKS* |
| Ga0070754_101026992 | 3300006810 | Aqueous | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK* |
| Ga0070754_101718391 | 3300006810 | Aqueous | AIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS* |
| Ga0070754_103774673 | 3300006810 | Aqueous | MDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLLINALNVISRKKS* |
| Ga0070754_104078901 | 3300006810 | Aqueous | MDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLMISVLNAISRKKS* |
| Ga0070754_105302322 | 3300006810 | Aqueous | MDPTTLAALAILAAAGSGILTLLPIRSNSWVQLVISLLNAI |
| Ga0075481_101689261 | 3300006868 | Aqueous | MDPTTIAIIAILAAAGSEIITLLPMRENSWIQLLIKVLN |
| Ga0075481_102405532 | 3300006868 | Aqueous | LAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0075477_102868383 | 3300006869 | Aqueous | MDPTTLAVVAVLAAAGSEILTLLPIRSNSWVQLVINVLNAI |
| Ga0075477_103700141 | 3300006869 | Aqueous | QYFMDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTVLKVIARKKS* |
| Ga0075477_103918063 | 3300006869 | Aqueous | VLLMDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS* |
| Ga0075479_102519032 | 3300006870 | Aqueous | AAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0075475_102927321 | 3300006874 | Aqueous | LARILIYMDPTTIATIAILAAAGSEILTLLPIRSNSWVQLLINVLNAVARKKS* |
| Ga0070746_101424642 | 3300006919 | Aqueous | LAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0070746_103014624 | 3300006919 | Aqueous | MDPTVIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIAKKK* |
| Ga0070745_10413564 | 3300007344 | Aqueous | MDPTTLAAIAILAAAGSEILTLLPIRSNSWVRLVISVLNAISRKKS* |
| Ga0070745_11734931 | 3300007344 | Aqueous | TLAAIAILAAAGSEILTLLPIRSNSWIQLVISILNAIARKKS* |
| Ga0070745_12509422 | 3300007344 | Aqueous | MDPTTLAVVAVLAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS* |
| Ga0070745_13227073 | 3300007344 | Aqueous | MDPTVIAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK* |
| Ga0070745_13530741 | 3300007344 | Aqueous | LAVVAILAAAGSEILTLLPIRSNSWVQLVINALNVISRKKS* |
| Ga0070752_100769711 | 3300007345 | Aqueous | MDPTTLAVVAVLAAAGSEILTLLPIRSNSWVQLVINVLNAISRKKS* |
| Ga0070752_11324943 | 3300007345 | Aqueous | IAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK* |
| Ga0070752_12372433 | 3300007345 | Aqueous | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS* |
| Ga0070752_12656213 | 3300007345 | Aqueous | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINILNVVARKK* |
| Ga0070753_12087483 | 3300007346 | Aqueous | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLIISVLNAISRKKS* |
| Ga0070753_12159113 | 3300007346 | Aqueous | LMMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINILNVVARKK* |
| Ga0070753_13562952 | 3300007346 | Aqueous | MDPTVLAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK* |
| Ga0099851_10191043 | 3300007538 | Aqueous | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS* |
| Ga0099851_10249325 | 3300007538 | Aqueous | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLIISVLNAIARKKS* |
| Ga0099851_12992361 | 3300007538 | Aqueous | MDPTTLATVAILAAAGSEILTLLPIRSNSWVQLVISLLNAIARKKS* |
| Ga0099849_10202912 | 3300007539 | Aqueous | MDPTTIAVVAIVAAAGSEILTLLPIRSNSWVQLLINILNVIARKK* |
| Ga0099849_10826645 | 3300007539 | Aqueous | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINILNVIARKK* |
| Ga0099849_12173912 | 3300007539 | Aqueous | AIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0099849_12329121 | 3300007539 | Aqueous | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLI |
| Ga0099849_12588341 | 3300007539 | Aqueous | PTTLAAIAILAAAGSEILTLLPIRSNSWIQLVISILNAIARKKP* |
| Ga0099849_13328942 | 3300007539 | Aqueous | MDPTVLAAIAIIAAAGSEIITLLPIRENSWVQLLIKVLNVIAKKK* |
| Ga0099847_10543781 | 3300007540 | Aqueous | MDPTVIAVVAIVAAAGSEIITLLPMRENSWIQLLVKVLNV |
| Ga0099847_11857032 | 3300007540 | Aqueous | MDPTVVAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK* |
| Ga0099847_11995561 | 3300007540 | Aqueous | TTLAAIAILAAAGSEILTLLPIRSNSWVQLIVTVLNVIARKKR* |
| Ga0099848_10090994 | 3300007541 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTVLKVVARKKP* |
| Ga0099848_11065392 | 3300007541 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTILKVIARKKS* |
| Ga0099848_12585731 | 3300007541 | Aqueous | LAALAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0099846_10337952 | 3300007542 | Aqueous | MDPTSLAAIAILAAAGSEILTLLPIRSNSWIQLVISILNAIARKKP* |
| Ga0099846_11027894 | 3300007542 | Aqueous | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNVIAKKK* |
| Ga0099846_11480481 | 3300007542 | Aqueous | TLAAIAILAAAGSEILTLLPIRSNSWVQLIVTVLNVIARKKR* |
| Ga0099846_12345333 | 3300007542 | Aqueous | MDPTTDAVVAVLAAAGSEILTLLPIRSNSWIQLLVMVLKVVARKKP* |
| Ga0099846_12469832 | 3300007542 | Aqueous | TIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK* |
| Ga0070751_10424763 | 3300007640 | Aqueous | MDPTTIAVIAILAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK* |
| Ga0070751_10437643 | 3300007640 | Aqueous | MDPTTLAVVAVLAAAGSEILTLLPIRSNSWVQLVINVLN |
| Ga0070751_11672651 | 3300007640 | Aqueous | MDPTALAVIAILAAAGSEILTLLPIRSNSWVQLFISVLNAISRKKS* |
| Ga0070751_12405071 | 3300007640 | Aqueous | TTVAVVAILAAAGSEILTLLPIRSNSWVQLLVTFLKVIARKKS* |
| Ga0099850_10515307 | 3300007960 | Aqueous | MDPTLIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVI |
| Ga0099850_12082012 | 3300007960 | Aqueous | MDPTVIAVVAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK* |
| Ga0075480_103503521 | 3300008012 | Aqueous | AIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK* |
| Ga0075480_105369903 | 3300008012 | Aqueous | MMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIA |
| Ga0118687_101262752 | 3300009124 | Sediment | MDPTVIAVVAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIARKK* |
| Ga0118687_101568792 | 3300009124 | Sediment | MMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK* |
| Ga0129348_10040026 | 3300010296 | Freshwater To Marine Saline Gradient | MDPTVLAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNVIGKKK* |
| Ga0129348_10687901 | 3300010296 | Freshwater To Marine Saline Gradient | MDPTTLAALAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0129348_11115804 | 3300010296 | Freshwater To Marine Saline Gradient | MDPIVLAAIAIVAAAGSEIITLLPIRENSWVQLLVKVLNVIAKKK* |
| Ga0129342_11448311 | 3300010299 | Freshwater To Marine Saline Gradient | AAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAIARKKS* |
| Ga0129342_13361212 | 3300010299 | Freshwater To Marine Saline Gradient | MDSTVIASVAIAAAAGSEIIGMMPVRENSWIQLLLKVLQIIARKK* |
| Ga0129351_10901932 | 3300010300 | Freshwater To Marine Saline Gradient | TVIAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK* |
| Ga0129351_12176412 | 3300010300 | Freshwater To Marine Saline Gradient | MDPTTLATIAILAAAGSEILTLLPIRSNSWVQLVISLLNAIARKKS* |
| Ga0129351_12538674 | 3300010300 | Freshwater To Marine Saline Gradient | MDPTTIAVIAILAAAGSEIITLLPIRENSWVQLLVKVLNVIAKKK* |
| Ga0129351_13166481 | 3300010300 | Freshwater To Marine Saline Gradient | QMDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK* |
| Ga0129324_101149961 | 3300010368 | Freshwater To Marine Saline Gradient | TFARFQYSMDPTALAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS* |
| Ga0129324_101727631 | 3300010368 | Freshwater To Marine Saline Gradient | MDPTLIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLN |
| Ga0129324_102442034 | 3300010368 | Freshwater To Marine Saline Gradient | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKK |
| Ga0136549_100113927 | 3300010389 | Marine Methane Seep Sediment | MDPTTIAAIAILAAAGSEIITLLPIRENSWVQLLVKVLNVIAKKK* |
| Ga0136549_100181234 | 3300010389 | Marine Methane Seep Sediment | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKKS* |
| Ga0136549_101272872 | 3300010389 | Marine Methane Seep Sediment | MDPTLIAVIAIAAAAGSEIITLLPMRENSWIQLLVKVLNVIAKKK* |
| Ga0136549_103944112 | 3300010389 | Marine Methane Seep Sediment | MDPTVLAAIAIIAAAGSEIITLLPIRENSWVQLLIKVLNVIGKKK* |
| Ga0136852_104140431 | 3300010412 | Mangrove Sediment | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAIARKKS* |
| Ga0129327_100536784 | 3300013010 | Freshwater To Marine Saline Gradient | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLIVTVLNVIARKKR* |
| Ga0180120_101277132 | 3300017697 | Freshwater To Marine Saline Gradient | MMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK |
| Ga0181584_100489416 | 3300017949 | Salt Marsh | MDPTVIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIARKK |
| Ga0181577_100021277 | 3300017951 | Salt Marsh | MDPTTLAALAILAAAGSEILTLLPIRSNSWVQLVISILNAISRKKS |
| Ga0181582_103941923 | 3300017958 | Salt Marsh | MDPTTLAAIAILAAAGSEILTLLPIRSISWVQLVISVLNAIARKKS |
| Ga0181581_108533131 | 3300017962 | Salt Marsh | DPTTLAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAIARKKS |
| Ga0181589_100473909 | 3300017964 | Salt Marsh | MDPTVIAVIAIVAAAGSEIITLLPMRENSWIQLLVKV |
| Ga0181590_101775923 | 3300017967 | Salt Marsh | MDPTTIAVIAIVAAAGSEILTLLPIRENSWVQLLVKLLNVIAKKK |
| Ga0181590_108190933 | 3300017967 | Salt Marsh | MDPTALAALAIIAAAGSEIITLLPIRENSWVQLVISVLNAIARKKS |
| Ga0181592_104574834 | 3300018421 | Salt Marsh | MDPTTIAAIAILAAAGSEIITLLPIRENSWVQQLVKVLN |
| Ga0181592_107193533 | 3300018421 | Salt Marsh | MDPTTLAAIAILAAAGSEIITLLPIREDSWVQLLVKMLNIIAKKK |
| Ga0181592_110075232 | 3300018421 | Salt Marsh | MDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0181591_106615582 | 3300018424 | Salt Marsh | MDPTTIAAIAILAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK |
| Ga0194016_10222142 | 3300019708 | Sediment | MDSTTLAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0194023_10071604 | 3300019756 | Freshwater | MDPTTLAALAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0194023_10382281 | 3300019756 | Freshwater | MDPTTLAALAILAAAGSEILTLLPIRSNSWVQLAISLLNAIARKKS |
| Ga0194023_10526472 | 3300019756 | Freshwater | MDPTTIAIIAILAAAGSEIITLLPMRENSWIQLLIKVLNAIAQKK |
| Ga0194023_10637441 | 3300019756 | Freshwater | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAIARKKS |
| Ga0194023_11103141 | 3300019756 | Freshwater | SQSLMMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK |
| Ga0194024_10213203 | 3300019765 | Freshwater | MDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLVISILNAISRKKS |
| Ga0194024_10233872 | 3300019765 | Freshwater | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0194024_10774352 | 3300019765 | Freshwater | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK |
| Ga0194022_10194872 | 3300019937 | Freshwater | MDPTTIAVIAILAAAGSEIITLLPMRENSWIQLLIKVLNAIAQKK |
| Ga0181594_101337342 | 3300020054 | Salt Marsh | MDPTTIAAIAILAAAGSEIITLLPIRENSWVQLLVKVLNVIAKKK |
| Ga0181594_104532642 | 3300020054 | Salt Marsh | RFQYSMDPTALAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0211558_100389452 | 3300020439 | Marine | MDPTALAAIAILAAAGSEILTLLPIRENSWVQLLVKILNVVSKKK |
| Ga0213865_101093742 | 3300021373 | Seawater | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0213864_103056951 | 3300021379 | Seawater | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINILNVIARKK |
| Ga0213866_100724343 | 3300021425 | Seawater | MDATTLAAIAILAAAGSEILTLLPIRSNSWVQLVISLLNAIARKKS |
| Ga0222718_100114444 | 3300021958 | Estuarine Water | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK |
| Ga0222718_100545252 | 3300021958 | Estuarine Water | MDPTALAAIAIIAAAGSEIITLLPIRENSWMQLLVKVLNIVAKKK |
| Ga0222716_102618991 | 3300021959 | Estuarine Water | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLLVTFLKVIARKKS |
| Ga0222716_106978592 | 3300021959 | Estuarine Water | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLIVTVLNVVARKKR |
| Ga0222715_100014753 | 3300021960 | Estuarine Water | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLIVTVLNVIARKKR |
| Ga0222715_100975172 | 3300021960 | Estuarine Water | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLVISLLNAISRKKS |
| Ga0222715_102636042 | 3300021960 | Estuarine Water | MDPTLIAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK |
| Ga0222715_103851834 | 3300021960 | Estuarine Water | MDPTLIAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVA |
| Ga0222715_104281001 | 3300021960 | Estuarine Water | AIAILAAAGSEILTLLPIRSNSWVQLVISILNAISRKKS |
| Ga0222713_107317692 | 3300021962 | Estuarine Water | ILAAAGSEILTLLPIRSNSWVQLVISVLNAVARKKS |
| Ga0222719_100600815 | 3300021964 | Estuarine Water | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVRLLNVIAKKK |
| Ga0222719_103949512 | 3300021964 | Estuarine Water | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIGAKKK |
| Ga0222719_104302821 | 3300021964 | Estuarine Water | HQMDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK |
| Ga0212030_10383973 | 3300022053 | Aqueous | MDPTVIAVVAIVAAAGSEIITLLPMRENSWIQLLVKVS |
| Ga0212025_10428102 | 3300022057 | Aqueous | MDATTIAVVAILAAAGSEILTLLPIRSNSWIQLVISLLNAISRKKS |
| Ga0212025_10545062 | 3300022057 | Aqueous | IAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIAKKK |
| Ga0212026_10650652 | 3300022069 | Aqueous | MDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0212031_10140522 | 3300022176 | Aqueous | AIAILAAAGSEILTLLPIRSNSWVQLLINVLNAVARKKS |
| Ga0212031_10910932 | 3300022176 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTILKVIARKKS |
| Ga0196899_10376403 | 3300022187 | Aqueous | MDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLMISVLNAISRKKS |
| Ga0196905_10217205 | 3300022198 | Aqueous | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLIISVLNAIARKKS |
| Ga0196905_10280541 | 3300022198 | Aqueous | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLIISLLNAVARKKS |
| Ga0196905_11577671 | 3300022198 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTVLKVVARKKP |
| Ga0196901_10640134 | 3300022200 | Aqueous | LARILIYMDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLIISLLNAVARKKS |
| Ga0196901_11523562 | 3300022200 | Aqueous | MDPTTLATVAILAAAGSEILTLLPIRSNSWVQLVISLLNAIARKKS |
| Ga0196901_11841181 | 3300022200 | Aqueous | MDPTVIAVVAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIARKK |
| Ga0224500_100128926 | 3300022213 | Sediment | MDPTTVAVVAILAAAGSEILALLPIRSNSWVQFLVTFLKVIARKKS |
| Ga0255760_103320631 | 3300023115 | Salt Marsh | VIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIARKK |
| Ga0255181_10212661 | 3300024502 | Freshwater | AILAAAGSEIIALLPIRSNSWIQLLVMVLKVVARKKP |
| Ga0256339_10985732 | 3300024857 | Freshwater | TTIAVIAILAAAGSEIIALLPIRSNSWIQLLTLVLKVIARKKP |
| Ga0208303_10911421 | 3300025543 | Aqueous | IAVVAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIARKK |
| Ga0208149_10208323 | 3300025610 | Aqueous | MDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKLLNVIAKKK |
| Ga0208004_10174712 | 3300025630 | Aqueous | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK |
| Ga0208004_10215282 | 3300025630 | Aqueous | LARILIYMDPTTIATIAILAAAGSEILTLLPIRSNSWVQLLINVLNAVARKKS |
| Ga0208161_10043019 | 3300025646 | Aqueous | MDPTTIATIAILAAAGSEILTLLPIRSNSWVQLLINVLNAVARKKS |
| Ga0208160_10795962 | 3300025647 | Aqueous | DPTTLAAIAILAAAGSEILTLLPIRSNSWIQLVISILNAIARKKP |
| Ga0208160_11272031 | 3300025647 | Aqueous | VVAIIAAAGSEILTLLPIRSNSWIQLLVMVLKVVARKKP |
| Ga0208428_10588565 | 3300025653 | Aqueous | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVVARKK |
| Ga0208428_11422143 | 3300025653 | Aqueous | MDPTVLAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNVIA |
| Ga0208795_10630852 | 3300025655 | Aqueous | MDPTALATIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0208795_11527011 | 3300025655 | Aqueous | PTTLAAIAILAAAGSEILTLLPIRSNSWIQLVISILNAIARKKP |
| Ga0208898_10069935 | 3300025671 | Aqueous | MDPTTIAVVAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK |
| Ga0208898_10293982 | 3300025671 | Aqueous | LARILIYMDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLLINVLNAVARKKS |
| Ga0208898_10320681 | 3300025671 | Aqueous | MDPTVIAVIAIVAAAGSEIITLLPMRENSWIQLLVKLLNVVAGKK |
| Ga0208898_10350172 | 3300025671 | Aqueous | MDPTTLATVAILAAAGSEILTLLPIRSNSWVQLVISVLNAIARKKS |
| Ga0208898_10491781 | 3300025671 | Aqueous | ALAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0208898_10703533 | 3300025671 | Aqueous | MDPTTLAVFAILAAAGSEILTLLPIRSNSWVQLVINVLNVISRKKS |
| Ga0208898_10886762 | 3300025671 | Aqueous | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0208898_10953261 | 3300025671 | Aqueous | MDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLLINALNVISRKKS |
| Ga0208898_11310551 | 3300025671 | Aqueous | MDPTTLAVVAVLAAAGSEILTLLPIRSNSWVQLVINVLNAISRKKS |
| Ga0208898_11343501 | 3300025671 | Aqueous | MDPSTLAVVAILAAAGSEILTLLPIRSNSWVQLLINALNVISRKKS |
| Ga0208898_11862072 | 3300025671 | Aqueous | MDPTNVAVVAILAAAGSEILALLPIRSNSWVQFLVTFLKVIARKKS |
| Ga0208162_10233872 | 3300025674 | Aqueous | MDPTTIAVVAIVAAAGSEILTLLPIRSNSWVQLLINILNVIARKK |
| Ga0208162_10448441 | 3300025674 | Aqueous | SMDPTALAAIAILAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0208150_10841981 | 3300025751 | Aqueous | MDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLMISVLNA |
| Ga0208899_11823021 | 3300025759 | Aqueous | VTSQVLLMDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLMISVLNAISRKKS |
| Ga0208767_10383484 | 3300025769 | Aqueous | IIAILAAAGSEIITLLPMRENSWIQLLIKVLNAIAQKK |
| Ga0208427_10668762 | 3300025771 | Aqueous | AVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIAKKK |
| Ga0208542_11204953 | 3300025818 | Aqueous | MDPTTVAVVAILAAAGSEILTLLPIRSNSWVQLIVTVLKVIARKKS |
| Ga0208644_100474014 | 3300025889 | Aqueous | MDPTTIAVVAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0208644_10397422 | 3300025889 | Aqueous | MDPTTIATIAILAAAGSEILTLLPIRSNSWVQLIISLLNAVARKKS |
| Ga0256334_11145422 | 3300026566 | Freshwater | TIAVVAIIAAAGSEIIALLPIRSNSWIQLLTLVLKVIARKKP |
| Ga0209536_1011974134 | 3300027917 | Marine Sediment | MDPTVIAVVAILAAAGSEIITLLPMRENSWIQLLVKVLNVIARKK |
| Ga0256331_11219302 | 3300028286 | Freshwater | LRAITFTTIAVVAIIAAAGSEIIALLPIRSNSWIQLLTLVLKVIARKKP |
| Ga0307379_111298031 | 3300031565 | Soil | SGSQRLQMDPTALAAIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK |
| Ga0307377_108188962 | 3300031673 | Soil | RFQYSMDPTALAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0316201_114305202 | 3300032136 | Worm Burrow | AIAIIAAAGSEIITLLPIRENSWVQLLVKVLNIVAKKK |
| Ga0348335_003194_5274_5411 | 3300034374 | Aqueous | MDPTLIAVIAIVAAAGSEIITLLPMRENSWIQLLVKVLNVIAKKK |
| Ga0348335_005556_493_633 | 3300034374 | Aqueous | MDPSTLAVIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0348335_050878_478_618 | 3300034374 | Aqueous | MMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARKK |
| Ga0348335_062979_682_822 | 3300034374 | Aqueous | MDPATLAVVAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKA |
| Ga0348335_063146_683_820 | 3300034374 | Aqueous | MDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVSARKK |
| Ga0348335_085839_3_137 | 3300034374 | Aqueous | MMDPTTIAVIAIVAAAGSEVLTLLPIRSNSWVQLLINVLNVIARK |
| Ga0348335_106443_357_497 | 3300034374 | Aqueous | MDPTTIAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKA |
| Ga0348335_167355_256_396 | 3300034374 | Aqueous | MDPTALAAIAILAAAGSEILTLLPIRSNSWVQLIISVLNAISRKKS |
| Ga0348336_093272_917_1045 | 3300034375 | Aqueous | TLAAIAILAAAGSEILTLLPIRSNSWVQLVISVLNAISRKKS |
| Ga0348337_039579_48_188 | 3300034418 | Aqueous | MDPTTLAVVAVLAAAGSEILTLLPIRSNSWVQLAISLLNAISRKKS |
| Ga0348337_077942_647_787 | 3300034418 | Aqueous | MDPTTLAVVAILAAAGSEILTLLPIRSNSWVQLFISVLNAISRKKS |
| ⦗Top⦘ |