


| Basic Information | |
|---|---|
| Family ID | F024920 |
| Family Type | Metagenome |
| Number of Sequences | 204 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIVELLDKYHVDDFDDLLIEIIKHMKEQKETRQENEDE |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 204 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 90.20 % |
| % of genes near scaffold ends (potentially truncated) | 14.22 % |
| % of genes from short scaffolds (< 2000 bps) | 69.12 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (43.137 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.980 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.137 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 204 Family Scaffolds |
|---|---|---|
| PF03819 | MazG | 1.96 |
| PF00145 | DNA_methylase | 1.47 |
| PF11753 | DUF3310 | 1.47 |
| PF03592 | Terminase_2 | 1.47 |
| PF03237 | Terminase_6N | 0.98 |
| PF02599 | CsrA | 0.98 |
| PF12957 | DUF3846 | 0.98 |
| PF13481 | AAA_25 | 0.49 |
| PF13662 | Toprim_4 | 0.49 |
| PF01555 | N6_N4_Mtase | 0.49 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.49 |
| PF00959 | Phage_lysozyme | 0.49 |
| PF11284 | DUF3085 | 0.49 |
| PF13551 | HTH_29 | 0.49 |
| PF03796 | DnaB_C | 0.49 |
| PF01612 | DNA_pol_A_exo1 | 0.49 |
| PF13550 | Phage-tail_3 | 0.49 |
| PF12684 | DUF3799 | 0.49 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.49 |
| PF16786 | RecA_dep_nuc | 0.49 |
| PF01476 | LysM | 0.49 |
| PF11651 | P22_CoatProtein | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.47 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.47 |
| COG1551 | sRNA-binding carbon storage regulator CsrA | Signal transduction mechanisms [T] | 0.98 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.49 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.49 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.49 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.86 % |
| Unclassified | root | N/A | 43.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10014389 | All Organisms → Viruses → Predicted Viral | 4886 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10015032 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4742 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10020579 | All Organisms → Viruses → Predicted Viral | 3861 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10131811 | Not Available | 957 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10019777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 3227 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10020367 | All Organisms → Viruses → Predicted Viral | 3166 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10131277 | Not Available | 887 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10165886 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 740 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10029697 | All Organisms → Viruses → Predicted Viral | 2685 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10052286 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10115365 | Not Available | 950 | Open in IMG/M |
| 3300001450|JGI24006J15134_10072185 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300001450|JGI24006J15134_10251466 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300001460|JGI24003J15210_10010228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 3814 | Open in IMG/M |
| 3300001472|JGI24004J15324_10136308 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300001472|JGI24004J15324_10160971 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 509 | Open in IMG/M |
| 3300001589|JGI24005J15628_10080150 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300002231|KVRMV2_100334703 | Not Available | 546 | Open in IMG/M |
| 3300002482|JGI25127J35165_1013103 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
| 3300005512|Ga0074648_1002015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19265 | Open in IMG/M |
| 3300005611|Ga0074647_1005543 | All Organisms → Viruses → Predicted Viral | 2943 | Open in IMG/M |
| 3300005613|Ga0074649_1008026 | Not Available | 8065 | Open in IMG/M |
| 3300005837|Ga0078893_10261044 | All Organisms → cellular organisms → Bacteria → FCB group | 3425 | Open in IMG/M |
| 3300005941|Ga0070743_10029693 | Not Available | 1887 | Open in IMG/M |
| 3300006024|Ga0066371_10003382 | All Organisms → cellular organisms → Bacteria | 4029 | Open in IMG/M |
| 3300006025|Ga0075474_10024516 | Not Available | 2161 | Open in IMG/M |
| 3300006025|Ga0075474_10078802 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300006027|Ga0075462_10007827 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300006027|Ga0075462_10075752 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300006029|Ga0075466_1016774 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| 3300006735|Ga0098038_1001512 | Not Available | 10026 | Open in IMG/M |
| 3300006735|Ga0098038_1004544 | All Organisms → cellular organisms → Bacteria | 5710 | Open in IMG/M |
| 3300006735|Ga0098038_1004942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 5468 | Open in IMG/M |
| 3300006735|Ga0098038_1010515 | All Organisms → Viruses → Predicted Viral | 3629 | Open in IMG/M |
| 3300006735|Ga0098038_1062754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1326 | Open in IMG/M |
| 3300006735|Ga0098038_1079159 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300006735|Ga0098038_1228363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 594 | Open in IMG/M |
| 3300006737|Ga0098037_1065738 | All Organisms → Viruses → Predicted Viral | 1288 | Open in IMG/M |
| 3300006749|Ga0098042_1004049 | All Organisms → cellular organisms → Bacteria | 5085 | Open in IMG/M |
| 3300006752|Ga0098048_1031633 | All Organisms → Viruses → Predicted Viral | 1721 | Open in IMG/M |
| 3300006752|Ga0098048_1090646 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 929 | Open in IMG/M |
| 3300006752|Ga0098048_1169980 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 647 | Open in IMG/M |
| 3300006789|Ga0098054_1016606 | Not Available | 2964 | Open in IMG/M |
| 3300006789|Ga0098054_1259795 | Not Available | 625 | Open in IMG/M |
| 3300006789|Ga0098054_1355572 | Not Available | 519 | Open in IMG/M |
| 3300006793|Ga0098055_1262677 | Not Available | 648 | Open in IMG/M |
| 3300006793|Ga0098055_1406083 | Not Available | 504 | Open in IMG/M |
| 3300006803|Ga0075467_10250109 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 962 | Open in IMG/M |
| 3300006810|Ga0070754_10120066 | Not Available | 1281 | Open in IMG/M |
| 3300006810|Ga0070754_10313820 | Not Available | 701 | Open in IMG/M |
| 3300006810|Ga0070754_10413084 | Not Available | 589 | Open in IMG/M |
| 3300006810|Ga0070754_10534920 | Not Available | 502 | Open in IMG/M |
| 3300006868|Ga0075481_10329371 | Not Available | 529 | Open in IMG/M |
| 3300006916|Ga0070750_10248123 | Not Available | 774 | Open in IMG/M |
| 3300006916|Ga0070750_10440808 | Not Available | 539 | Open in IMG/M |
| 3300006919|Ga0070746_10391503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300006919|Ga0070746_10499577 | Not Available | 534 | Open in IMG/M |
| 3300006920|Ga0070748_1143407 | Not Available | 891 | Open in IMG/M |
| 3300006920|Ga0070748_1234618 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 663 | Open in IMG/M |
| 3300006922|Ga0098045_1034145 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300006924|Ga0098051_1141091 | Not Available | 639 | Open in IMG/M |
| 3300006925|Ga0098050_1078479 | Not Available | 852 | Open in IMG/M |
| 3300006929|Ga0098036_1172659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300007229|Ga0075468_10159835 | Not Available | 677 | Open in IMG/M |
| 3300007236|Ga0075463_10279672 | Not Available | 535 | Open in IMG/M |
| 3300007539|Ga0099849_1021127 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2832 | Open in IMG/M |
| 3300007540|Ga0099847_1155959 | Not Available | 678 | Open in IMG/M |
| 3300007542|Ga0099846_1254871 | Not Available | 608 | Open in IMG/M |
| 3300007557|Ga0102821_1013153 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2283 | Open in IMG/M |
| 3300007681|Ga0102824_1188823 | Not Available | 543 | Open in IMG/M |
| 3300007862|Ga0105737_1150397 | Not Available | 605 | Open in IMG/M |
| 3300007960|Ga0099850_1225121 | Not Available | 730 | Open in IMG/M |
| 3300008219|Ga0114905_1208774 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 627 | Open in IMG/M |
| 3300008996|Ga0102831_1026483 | Not Available | 1972 | Open in IMG/M |
| 3300009003|Ga0102813_1058168 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300009003|Ga0102813_1123906 | Not Available | 815 | Open in IMG/M |
| 3300009058|Ga0102854_1047594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1233 | Open in IMG/M |
| 3300009071|Ga0115566_10010639 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 6996 | Open in IMG/M |
| 3300009071|Ga0115566_10148423 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300009076|Ga0115550_1000916 | Not Available | 23346 | Open in IMG/M |
| 3300009077|Ga0115552_1314344 | Not Available | 624 | Open in IMG/M |
| 3300009086|Ga0102812_10242157 | Not Available | 982 | Open in IMG/M |
| 3300009086|Ga0102812_10482280 | Not Available | 677 | Open in IMG/M |
| 3300009413|Ga0114902_1082474 | Not Available | 877 | Open in IMG/M |
| 3300009433|Ga0115545_1026412 | All Organisms → Viruses → Predicted Viral | 2363 | Open in IMG/M |
| 3300009467|Ga0115565_10231291 | Not Available | 848 | Open in IMG/M |
| 3300009498|Ga0115568_10025623 | Not Available | 3323 | Open in IMG/M |
| 3300009498|Ga0115568_10297487 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 715 | Open in IMG/M |
| 3300009550|Ga0115013_11066214 | Not Available | 579 | Open in IMG/M |
| 3300010148|Ga0098043_1163444 | Not Available | 626 | Open in IMG/M |
| 3300010318|Ga0136656_1083454 | Not Available | 1130 | Open in IMG/M |
| 3300010354|Ga0129333_11695750 | Not Available | 514 | Open in IMG/M |
| 3300011128|Ga0151669_109863 | All Organisms → Viruses → Predicted Viral | 2293 | Open in IMG/M |
| 3300011129|Ga0151672_115510 | All Organisms → Viruses → Predicted Viral | 2343 | Open in IMG/M |
| 3300012920|Ga0160423_10106120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1984 | Open in IMG/M |
| 3300012920|Ga0160423_10227522 | Not Available | 1294 | Open in IMG/M |
| 3300012920|Ga0160423_10334952 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300012920|Ga0160423_10428914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300017697|Ga0180120_10052123 | All Organisms → Viruses → Predicted Viral | 1843 | Open in IMG/M |
| 3300017697|Ga0180120_10052437 | All Organisms → Viruses → Predicted Viral | 1836 | Open in IMG/M |
| 3300017706|Ga0181377_1048190 | Not Available | 823 | Open in IMG/M |
| 3300017708|Ga0181369_1001571 | All Organisms → cellular organisms → Bacteria | 6445 | Open in IMG/M |
| 3300017708|Ga0181369_1009925 | All Organisms → Viruses → Predicted Viral | 2441 | Open in IMG/M |
| 3300017714|Ga0181412_1022845 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300017737|Ga0187218_1157106 | Not Available | 536 | Open in IMG/M |
| 3300017743|Ga0181402_1133334 | Not Available | 633 | Open in IMG/M |
| 3300017762|Ga0181422_1144995 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 729 | Open in IMG/M |
| 3300017762|Ga0181422_1225301 | Not Available | 559 | Open in IMG/M |
| 3300017763|Ga0181410_1017739 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300017772|Ga0181430_1001858 | Not Available | 8413 | Open in IMG/M |
| 3300017773|Ga0181386_1030361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1777 | Open in IMG/M |
| 3300017782|Ga0181380_1063654 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300017824|Ga0181552_10118307 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| 3300017824|Ga0181552_10135011 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300018416|Ga0181553_10167021 | Not Available | 1296 | Open in IMG/M |
| 3300018416|Ga0181553_10174019 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300018420|Ga0181563_10155117 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
| 3300018421|Ga0181592_10859276 | Not Available | 593 | Open in IMG/M |
| 3300018428|Ga0181568_10284963 | All Organisms → cellular organisms → Bacteria → FCB group | 1351 | Open in IMG/M |
| 3300019717|Ga0193972_1017220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300019751|Ga0194029_1087339 | Not Available | 540 | Open in IMG/M |
| 3300020055|Ga0181575_10162558 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300020365|Ga0211506_1153739 | Not Available | 648 | Open in IMG/M |
| 3300020414|Ga0211523_10004502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 6833 | Open in IMG/M |
| 3300020419|Ga0211512_10000080 | Not Available | 48619 | Open in IMG/M |
| 3300020436|Ga0211708_10007348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 4114 | Open in IMG/M |
| 3300020442|Ga0211559_10109647 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300020442|Ga0211559_10544853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 527 | Open in IMG/M |
| 3300020445|Ga0211564_10154138 | Not Available | 1142 | Open in IMG/M |
| 3300020450|Ga0211641_10070829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1809 | Open in IMG/M |
| 3300020459|Ga0211514_10102263 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
| 3300020472|Ga0211579_10001026 | Not Available | 21895 | Open in IMG/M |
| 3300021085|Ga0206677_10002773 | Not Available | 15120 | Open in IMG/M |
| 3300021085|Ga0206677_10095999 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300021356|Ga0213858_10325054 | Not Available | 731 | Open in IMG/M |
| 3300021364|Ga0213859_10086087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1492 | Open in IMG/M |
| 3300021365|Ga0206123_10052268 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
| 3300021375|Ga0213869_10004252 | Not Available | 9328 | Open in IMG/M |
| 3300021425|Ga0213866_10048741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 2410 | Open in IMG/M |
| 3300021957|Ga0222717_10018770 | All Organisms → Viruses → Predicted Viral | 4659 | Open in IMG/M |
| 3300021958|Ga0222718_10008311 | All Organisms → cellular organisms → Bacteria | 8004 | Open in IMG/M |
| 3300021958|Ga0222718_10016222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 5292 | Open in IMG/M |
| 3300021958|Ga0222718_10463761 | Not Available | 620 | Open in IMG/M |
| 3300021960|Ga0222715_10057948 | All Organisms → Viruses → Predicted Viral | 2641 | Open in IMG/M |
| 3300022050|Ga0196883_1014542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
| 3300022068|Ga0212021_1000668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → unclassified Eubacterium → Eubacterium sp. 14-2 | 3487 | Open in IMG/M |
| 3300022178|Ga0196887_1011000 | Not Available | 2907 | Open in IMG/M |
| 3300022187|Ga0196899_1006987 | Not Available | 4661 | Open in IMG/M |
| 3300022929|Ga0255752_10132097 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10445667 | Not Available | 552 | Open in IMG/M |
| 3300024262|Ga0210003_1042308 | All Organisms → Viruses → Predicted Viral | 2406 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10282847 | Not Available | 805 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10023303 | All Organisms → Viruses → Predicted Viral | 1829 | Open in IMG/M |
| 3300025048|Ga0207905_1020899 | Not Available | 1090 | Open in IMG/M |
| 3300025070|Ga0208667_1005428 | All Organisms → Viruses → Predicted Viral | 3436 | Open in IMG/M |
| 3300025070|Ga0208667_1029252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 998 | Open in IMG/M |
| 3300025070|Ga0208667_1033176 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 910 | Open in IMG/M |
| 3300025070|Ga0208667_1073741 | Not Available | 511 | Open in IMG/M |
| 3300025083|Ga0208791_1003209 | All Organisms → cellular organisms → Bacteria | 5086 | Open in IMG/M |
| 3300025083|Ga0208791_1036687 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 903 | Open in IMG/M |
| 3300025085|Ga0208792_1046986 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 817 | Open in IMG/M |
| 3300025086|Ga0208157_1018038 | All Organisms → Viruses → Predicted Viral | 2188 | Open in IMG/M |
| 3300025086|Ga0208157_1037075 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
| 3300025086|Ga0208157_1064720 | Not Available | 946 | Open in IMG/M |
| 3300025101|Ga0208159_1009710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 2646 | Open in IMG/M |
| 3300025103|Ga0208013_1003921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5590 | Open in IMG/M |
| 3300025108|Ga0208793_1144748 | Not Available | 632 | Open in IMG/M |
| 3300025127|Ga0209348_1000973 | Not Available | 14375 | Open in IMG/M |
| 3300025127|Ga0209348_1006516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 4918 | Open in IMG/M |
| 3300025138|Ga0209634_1203169 | Not Available | 756 | Open in IMG/M |
| 3300025138|Ga0209634_1208804 | Not Available | 740 | Open in IMG/M |
| 3300025151|Ga0209645_1014911 | Not Available | 3046 | Open in IMG/M |
| 3300025151|Ga0209645_1086294 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300025151|Ga0209645_1209759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 568 | Open in IMG/M |
| 3300025168|Ga0209337_1120534 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300025264|Ga0208029_1105306 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 506 | Open in IMG/M |
| 3300025508|Ga0208148_1000044 | Not Available | 44055 | Open in IMG/M |
| 3300025621|Ga0209504_1000481 | Not Available | 34888 | Open in IMG/M |
| 3300025632|Ga0209194_1126850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → unclassified Lentimicrobiaceae → Lentimicrobiaceae bacterium | 621 | Open in IMG/M |
| 3300025645|Ga0208643_1122733 | Not Available | 687 | Open in IMG/M |
| 3300025645|Ga0208643_1174913 | Not Available | 525 | Open in IMG/M |
| 3300025645|Ga0208643_1181709 | Not Available | 510 | Open in IMG/M |
| 3300025646|Ga0208161_1177784 | Not Available | 506 | Open in IMG/M |
| 3300025652|Ga0208134_1178037 | Not Available | 512 | Open in IMG/M |
| 3300025655|Ga0208795_1099872 | Not Available | 778 | Open in IMG/M |
| 3300025671|Ga0208898_1039674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1816 | Open in IMG/M |
| 3300025671|Ga0208898_1059944 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300025701|Ga0209771_1052035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium | 1506 | Open in IMG/M |
| 3300025759|Ga0208899_1007142 | All Organisms → cellular organisms → Bacteria | 6591 | Open in IMG/M |
| 3300025769|Ga0208767_1039671 | All Organisms → Viruses → Predicted Viral | 2313 | Open in IMG/M |
| 3300025769|Ga0208767_1041797 | All Organisms → Viruses → Predicted Viral | 2229 | Open in IMG/M |
| 3300025769|Ga0208767_1239650 | Not Available | 576 | Open in IMG/M |
| 3300025828|Ga0208547_1047351 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300025849|Ga0209603_1348094 | Not Available | 502 | Open in IMG/M |
| 3300025869|Ga0209308_10082020 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
| 3300026077|Ga0208749_1062867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED111 | 779 | Open in IMG/M |
| 3300026187|Ga0209929_1095757 | Not Available | 776 | Open in IMG/M |
| 3300027192|Ga0208673_1018667 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1196 | Open in IMG/M |
| 3300027751|Ga0208304_10216840 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027906|Ga0209404_10195266 | Not Available | 1253 | Open in IMG/M |
| 3300029301|Ga0135222_1015100 | Not Available | 618 | Open in IMG/M |
| 3300031519|Ga0307488_10274090 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300032373|Ga0316204_10535899 | Not Available | 868 | Open in IMG/M |
| 3300033742|Ga0314858_195573 | Not Available | 519 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.88% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.39% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.39% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.41% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.90% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.45% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.47% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.49% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.49% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.49% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.49% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.49% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.49% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.49% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.49% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.49% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.49% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.49% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.49% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.49% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.49% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.49% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.49% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.49% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019717 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027192 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029301 | Marine harbor viral communities from the Indian Ocean - SRH1 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1001438912 | 3300000101 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQENEDE* |
| DelMOSum2010_100150328 | 3300000101 | Marine | MIEELLDKYHVDDFDDLLIEIIKQMQEQKETREED* |
| DelMOSum2010_100205799 | 3300000101 | Marine | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREVEDGE* |
| DelMOSum2010_101318114 | 3300000101 | Marine | MNIIELLDNYHVDDFDDLLIEIIKHMKEQKQTREQD* |
| DelMOSum2011_100197779 | 3300000115 | Marine | MIEELLDKYHVDDFDNLLIEIIKHMQEQKKIREQD* |
| DelMOSum2011_100203679 | 3300000115 | Marine | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREIEDGE* |
| DelMOSpr2010_101312772 | 3300000116 | Marine | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEE* |
| DelMOSpr2010_101658863 | 3300000116 | Marine | MIEELLDKYSVDEFDDLLIEIINRMKERKETESEEEQ* |
| DelMOWin2010_100296973 | 3300000117 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQETEDA* |
| DelMOWin2010_100522862 | 3300000117 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQETEDE* |
| DelMOWin2010_101153652 | 3300000117 | Marine | MIVELLDKYHVDDFDDLLIEIIKHMKEQKETRQENEDE* |
| JGI24006J15134_100721853 | 3300001450 | Marine | MIVELLDKYHVDDFDDLLIKIIKHMKEQKETRQENENESI* |
| JGI24006J15134_102514663 | 3300001450 | Marine | MIEELLDKYHEDDFDKLLIEIINHMIEVKELRKDDREQD* |
| JGI24003J15210_100102287 | 3300001460 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEAKEIREMDREQD* |
| JGI24004J15324_101363082 | 3300001472 | Marine | MNMIEELLDKYHEDDFDKLLIEIINHMIEVKELRKDDREQD* |
| JGI24004J15324_101609713 | 3300001472 | Marine | MNMIEELLDKYHEDDFYKLLIEIINHMIEVKELREDDREQD* |
| JGI24005J15628_100801503 | 3300001589 | Marine | MIVELLDKYHVDDFDDLLIKIIKHMKEQKETRQENEDESI* |
| KVRMV2_1003347032 | 3300002231 | Marine Sediment | MIEELLDKYXVDDFDDLLIXIIKXMKQRKEEEGEE* |
| JGI25127J35165_10131033 | 3300002482 | Marine | MSNASMIVELLDKFHEDDFADLLIEIKKHMEEQKETRRDNE* |
| Ga0074648_10020159 | 3300005512 | Saline Water And Sediment | MIVELLDKYHVDDFDNLLIEIIKHMKEQKELRGEQDDE* |
| Ga0074647_10055436 | 3300005611 | Saline Water And Sediment | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEE*KPLTK* |
| Ga0074649_100802621 | 3300005613 | Saline Water And Sediment | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEK* |
| Ga0078893_102610446 | 3300005837 | Marine Surface Water | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRENEDDTA* |
| Ga0070743_100296932 | 3300005941 | Estuarine | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD* |
| Ga0066371_1000338213 | 3300006024 | Marine | MIVELLDKYHVDDFDDLLIQIIKHMKEQRELRAEEEEE* |
| Ga0075474_100245165 | 3300006025 | Aqueous | MIEELLDKYHVDDFDDLLIEIIKQMQEQKETREQD* |
| Ga0075474_100788022 | 3300006025 | Aqueous | MIVELLDKYHVDDFDDLLIEIIKHMKEQKELREKDDDNN* |
| Ga0075462_100078273 | 3300006027 | Aqueous | MNIVELLDKYDVDDFDNLLIEIINHMIEQKQLRGEEE* |
| Ga0075462_100757523 | 3300006027 | Aqueous | MIVELLDKYHVDEFDDLLIEIIKHMKEQKETRQENED* |
| Ga0075466_10167742 | 3300006029 | Aqueous | MIEELLDKYHVDDFDNLLIEIIKQMQEQKETREQD* |
| Ga0098038_100151214 | 3300006735 | Marine | MIEELLDKYHVDDFDDLLIQIIKHMKERKEEEGEE* |
| Ga0098038_10045445 | 3300006735 | Marine | MKMIVELLDKYHVDEFDDLLIEIIKHMQEQKETRENKDE* |
| Ga0098038_10049426 | 3300006735 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKELREWDREQD* |
| Ga0098038_10105152 | 3300006735 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQEDLNA* |
| Ga0098038_10627543 | 3300006735 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQETEDE* |
| Ga0098038_10791593 | 3300006735 | Marine | MILELLDKYHVDEFDDLLIKIIKHMQEQKETRQETEND* |
| Ga0098038_12283632 | 3300006735 | Marine | MIVELLDKYHVDDFDDLLIKIIQHMKEQKETRQDNEDDS* |
| Ga0098037_10657384 | 3300006737 | Marine | MIVELLDKYHVDDFDDLLIKIIQHMKEQKETRQDNENDS* |
| Ga0098042_10040495 | 3300006749 | Marine | MIVELLDKYHVDEFDDLLIEIIKHMQEQKETRENKDE* |
| Ga0098048_10316335 | 3300006752 | Marine | MIEELLDKYHEDDFDKLLINIINHMIEAKEIRKIDREKYDE* |
| Ga0098048_10906462 | 3300006752 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQEDEDE* |
| Ga0098048_11699802 | 3300006752 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKEIREMDREQD* |
| Ga0098054_10166066 | 3300006789 | Marine | MIVELLDKYHVDEFDDLLIKIIKNMQEQKETRQEDENE* |
| Ga0098054_12597952 | 3300006789 | Marine | MIEELLDKYAVEEFDDLLILIIKKMQERKEEENDNNK* |
| Ga0098054_13555722 | 3300006789 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMKEVKELREWDKEQNQ*NHIKQ* |
| Ga0098055_12626772 | 3300006793 | Marine | MNMIVKLLDKYHVDEFDDLLIEIIKHMKEQKETRQENEDE* |
| Ga0098055_14060833 | 3300006793 | Marine | ELLDKYHVDEFDDLLIKIIKHMQEQKETRQETEND* |
| Ga0075467_102501092 | 3300006803 | Aqueous | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREREDGE* |
| Ga0070754_101200663 | 3300006810 | Aqueous | MYQELILQLLDAVHEDDFDNLLIEIINNMIEQKQTRKE* |
| Ga0070754_103138204 | 3300006810 | Aqueous | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQENEDE* |
| Ga0070754_104130843 | 3300006810 | Aqueous | MIEELLDKYHVDDFDDLLIEIIKHMKEQKETREQD* |
| Ga0070754_105349202 | 3300006810 | Aqueous | MNMIEELLDKYHEDDFDKLLIEIINHMIEVKELREDDREQD* |
| Ga0075481_103293711 | 3300006868 | Aqueous | RMIEELLDKYHVDDFDDLLIEIIKQMQEQKETREQD* |
| Ga0070750_102481232 | 3300006916 | Aqueous | MNIIELLDNYHVDDFDDLLIEIIKNMKEQKQTREQDNE* |
| Ga0070750_104408081 | 3300006916 | Aqueous | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRENEDD* |
| Ga0070746_103915031 | 3300006919 | Aqueous | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRENED |
| Ga0070746_104995772 | 3300006919 | Aqueous | MNIVELLDKYDVDDFDNLLIEIINHMIEQKELRGEEE* |
| Ga0070748_11434072 | 3300006920 | Aqueous | MIVELLDKYHVDDFDDLLIEIIKHMKEQKETRQENEDE*LYSSD* |
| Ga0070748_12346184 | 3300006920 | Aqueous | KLMIEELLDKYHVDDFDDLLINIIKHMQDVKKDREVEDGE* |
| Ga0098045_10341456 | 3300006922 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMKEVKELREMDRE |
| Ga0098051_11410912 | 3300006924 | Marine | MIEELLDKYAVEEFDDLLILIIKKMQERKEEENDNDK* |
| Ga0098050_10784794 | 3300006925 | Marine | MIVELLDKYHVDEFDDLLIKIIKNIQEQKETRQEDENE* |
| Ga0098036_11726593 | 3300006929 | Marine | MIEELLDKYAVEEFDDLLILIIKKMQERKEEENDNNE* |
| Ga0075468_101598352 | 3300007229 | Aqueous | MIEELLNKYHVDDFDDLLIEIIKQMQEQKETREED* |
| Ga0075463_102796722 | 3300007236 | Aqueous | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRENEDES* |
| Ga0099849_10211279 | 3300007539 | Aqueous | MYQELILQLLDAVHEDDFDNLLIEIINNMIEQKQTREE* |
| Ga0099847_11559592 | 3300007540 | Aqueous | MIEELLDKYHGDDFDDLLIEIIKEMQEQKETREQD* |
| Ga0099846_12548713 | 3300007542 | Aqueous | RRRRMNIVELLDKYHVDDFDNLLIEIINHMIEQKELRGEEE* |
| Ga0102821_10131538 | 3300007557 | Estuarine | MNMIGELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD* |
| Ga0102824_11888231 | 3300007681 | Estuarine | ELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD* |
| Ga0105737_11503972 | 3300007862 | Estuary Water | MIEELLDNYSVDEFDNLLIEIIKRMKERKGVLDD* |
| Ga0099850_12251211 | 3300007960 | Aqueous | RRRMNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEE* |
| Ga0114905_12087743 | 3300008219 | Deep Ocean | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREANDD* |
| Ga0102831_10264832 | 3300008996 | Estuarine | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREYDEEQD* |
| Ga0102813_10581685 | 3300009003 | Estuarine | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREY |
| Ga0102813_11239061 | 3300009003 | Estuarine | GARLMNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD* |
| Ga0102854_10475942 | 3300009058 | Estuarine | MIEELLDNYSVDEFDNLLIEIIKRMKERKGDADD* |
| Ga0115566_1001063916 | 3300009071 | Pelagic Marine | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREMDREQD* |
| Ga0115566_101484231 | 3300009071 | Pelagic Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKESREMDREED* |
| Ga0115550_100091617 | 3300009076 | Pelagic Marine | MIEELLDKYHEDDFDDLLIEIIKHMQEQKETREQD* |
| Ga0115552_13143442 | 3300009077 | Pelagic Marine | MKMIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQEDEDE* |
| Ga0102812_102421571 | 3300009086 | Estuarine | MNMIEELLDKYHEDDFDDLLIEIIKHMKDVKELREYDREQD* |
| Ga0102812_104822803 | 3300009086 | Estuarine | IEELLDKYHEDDFDDLLIQIIKHMKEVKELREYDEEQD* |
| Ga0114902_10824742 | 3300009413 | Deep Ocean | MIEELLDKYHVDDFDDLLIEIIKHMKEQKETREQN* |
| Ga0115545_10264125 | 3300009433 | Pelagic Marine | MIEELLDKYSVDEFDNLLIEIIKQMKERKENEKEMV* |
| Ga0115565_102312911 | 3300009467 | Pelagic Marine | MKMIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQE |
| Ga0115568_100256232 | 3300009498 | Pelagic Marine | MIIELLDKYHVDEFDDLLIKIIKHMKEQKETRQEEEL* |
| Ga0115568_102974872 | 3300009498 | Pelagic Marine | MNMIEELLDKYHEDDFDDLLIQIIKHMQEVKESREMDREED* |
| Ga0115013_110662142 | 3300009550 | Marine | MIDELLDKYSVDEFDDLLIEIINRMKERKETESEEEQ* |
| Ga0098043_11634443 | 3300010148 | Marine | VIEELLDKYHVDDFDDLLIEIIKHMQEQKQTRENEDE* |
| Ga0136656_10834544 | 3300010318 | Freshwater To Marine Saline Gradient | MNIVKLLDKYDVDDFDNLLIEIINHMIEQKELRGEEE* |
| Ga0129333_116957503 | 3300010354 | Freshwater To Marine Saline Gradient | MNIVELLDKYDVDDFDNLLIEIINHMIEQKELRGEE |
| Ga0151669_1098637 | 3300011128 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQESEDDS* |
| Ga0151672_1155106 | 3300011129 | Marine | MIIELLDKYHVDEFDDLLIKIIKHMKEQKETRRED* |
| Ga0160423_101061205 | 3300012920 | Surface Seawater | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRQEDSHE* |
| Ga0160423_102275223 | 3300012920 | Surface Seawater | MIEELLDQYHVDDFDKLLIEIINQMIERKEAADEQD* |
| Ga0160423_103349523 | 3300012920 | Surface Seawater | MIEELLDKYHVDDFDDLLIEIIKHMQEQKQTRENEDV* |
| Ga0160423_104289144 | 3300012920 | Surface Seawater | MIEELLDKYHVDDFDDLLIEIIKHMQEQKQTRENEDE* |
| Ga0180120_100521236 | 3300017697 | Freshwater To Marine Saline Gradient | MIEELLDKYSVDEFDDLLIEIINRMKERKEKESEEEQ |
| Ga0180120_100524375 | 3300017697 | Freshwater To Marine Saline Gradient | MNIVELLDKYDVDDFDNLLIEIINHMIEQKELRGEEEXLK |
| Ga0181377_10481902 | 3300017706 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKEIREMDREQN |
| Ga0181369_100157114 | 3300017708 | Marine | MIVELLDKYHVDEFDDLLIEIIKHMQEQKETRENKDE |
| Ga0181369_100992511 | 3300017708 | Marine | MIVELLDKYHVDEFDDLLIEIIKHMKEQKETRQEEEDE |
| Ga0181412_10228456 | 3300017714 | Seawater | MIIELLDKYHVDEFDDLLIKIIKHMKEQKETRQEDENENK |
| Ga0187218_11571061 | 3300017737 | Seawater | NMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREMDREQG |
| Ga0181402_11333342 | 3300017743 | Seawater | MIEELLDKYHEDDFDDLLIQIIKHMQEVKEIREMDREQDNE |
| Ga0181422_11449953 | 3300017762 | Seawater | MNMIEELLDKYHVDDFDKLLIEIINHMIEVKKDREMEDGE |
| Ga0181422_12253011 | 3300017762 | Seawater | MIVELLDKYHVDEFDDLLIKIINHMKEQKETRQEDLDA |
| Ga0181410_10177392 | 3300017763 | Seawater | MIEELLDKYSTDQFDDLLIEIIKKMKERKENNEEEIND |
| Ga0181430_100185810 | 3300017772 | Seawater | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREMEDGE |
| Ga0181386_10303617 | 3300017773 | Seawater | MIEELLDKYAVDEFDDLLIAIIKRMQEKREQDSYDEYDVQ |
| Ga0181380_10636543 | 3300017782 | Seawater | MNMIGELLDKYHEDDFDDLLIQIIKHMKEVKELREYDEEQD |
| Ga0181552_101183073 | 3300017824 | Salt Marsh | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEKXNNTYTK |
| Ga0181552_101350113 | 3300017824 | Salt Marsh | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQEDSDA |
| Ga0181553_101670211 | 3300018416 | Salt Marsh | MIEELLDKYHVDEFDDLLIEIIKHMQEQKQTRQENEDD |
| Ga0181553_101740195 | 3300018416 | Salt Marsh | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEK |
| Ga0181563_101551176 | 3300018420 | Salt Marsh | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEKXKNIYTK |
| Ga0181592_108592762 | 3300018421 | Salt Marsh | MNQEMIIQLLDTIHEDDFDDLLIEIIKNMKEQKELRG |
| Ga0181568_102849635 | 3300018428 | Salt Marsh | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEE |
| Ga0193972_10172202 | 3300019717 | Sediment | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRENEDES |
| Ga0194029_10873391 | 3300019751 | Freshwater | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQESEDE |
| Ga0181575_101625582 | 3300020055 | Salt Marsh | MNIVELLDKYHVDDFDDLLIEIIKHMKEQKELRGED |
| Ga0211506_11537393 | 3300020365 | Marine | MIVELLDKYHVDDFDDLLIEIIKHMKEQRELRMEETKXKDL |
| Ga0211523_100045027 | 3300020414 | Marine | MIVELLDKYHVDDFDDLLIEIIKHMKEQRELRMEETK |
| Ga0211512_1000008062 | 3300020419 | Marine | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREVEDGE |
| Ga0211708_100073484 | 3300020436 | Marine | MRSNTSMIVELLDKFHEDDFADLLIEIIKNMREQKETRGDNDN |
| Ga0211559_101096473 | 3300020442 | Marine | MIEELLDNYHVEDFNDLLIEIIKQMKEQKETREQD |
| Ga0211559_105448533 | 3300020442 | Marine | MIVELLDKYHVDDFDDLLIEIIKHMKEQRELRMEEEA |
| Ga0211564_101541382 | 3300020445 | Marine | MIEELLDKYSVDEFDDLLILIINRMKERKEEEEEE |
| Ga0211641_100708291 | 3300020450 | Marine | MIEELLDNYHVDDFDDLLIEIIKQMKEQKETRGEN |
| Ga0211514_101022631 | 3300020459 | Marine | MIEELLDKYHVDDFDDLLIQIIKHMKERKEEEGEE |
| Ga0211579_100010266 | 3300020472 | Marine | MIEELLDKYHVDDFDDLLIEIIKRMKERKEEEDEK |
| Ga0206677_1000277318 | 3300021085 | Seawater | MNMIEELLDKYHEDAFDDLLIEIIKHMQDVKELRKDDKEQD |
| Ga0206677_100959993 | 3300021085 | Seawater | MNMIEELLDKYHEDDFDDLLIEIIKHMKDVKELREYDMEQD |
| Ga0213858_103250542 | 3300021356 | Seawater | MNIIELLDKYHVDDFDNLLIEIINHMIEQKELRQEES |
| Ga0213859_100860871 | 3300021364 | Seawater | NQEMIIQLLDTVHEDDFDDLLIEIINNMKEQKELRGE |
| Ga0206123_100522685 | 3300021365 | Seawater | MIIELLDKYHVDEFDDLLIKIIKHMKEQKETRQEEEL |
| Ga0213869_1000425216 | 3300021375 | Seawater | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREIEDGE |
| Ga0213866_100487413 | 3300021425 | Seawater | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEE |
| Ga0222717_1001877014 | 3300021957 | Estuarine Water | MIEELLDKYHVDDFDKLLIEIINHMIEVKKDREMEDGE |
| Ga0222718_1000831112 | 3300021958 | Estuarine Water | MIEELLDKYHEDDFDDLLIQIIKHMQEAKEIREMDREQD |
| Ga0222718_100162228 | 3300021958 | Estuarine Water | MIEELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD |
| Ga0222718_104637612 | 3300021958 | Estuarine Water | MIIELLDKYHVDEFDDLLIKIIKHMKEQKEIRQEEEL |
| Ga0222715_1005794810 | 3300021960 | Estuarine Water | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQEDEDE |
| Ga0196883_10145423 | 3300022050 | Aqueous | MIVELLDKYHVDDFDDLLIEIIKHMKEQKELREKDDDNN |
| Ga0212021_10006687 | 3300022068 | Aqueous | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQETEDE |
| Ga0196887_10110008 | 3300022178 | Aqueous | MIEELLDKYHVDDFDNLLIEIIKQMQEQKETREQD |
| Ga0196899_10069878 | 3300022187 | Aqueous | MNIVELLDKYDVDDFDNLLIEIINHMIEQKQLRGEEE |
| Ga0255752_101320972 | 3300022929 | Salt Marsh | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEKK |
| (restricted) Ga0255040_104456673 | 3300024059 | Seawater | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD |
| Ga0210003_10423082 | 3300024262 | Deep Subsurface | MIEELLDKYHVDDFDDLLIEIIKQMQEQKETREQD |
| (restricted) Ga0255048_102828475 | 3300024518 | Seawater | AKLMIEELLDKYHEDDFDDLLIQIIKHMQEAKEIREMDREQD |
| (restricted) Ga0255044_100233034 | 3300024529 | Seawater | MNMIEELLDKYHEDDFDDLLIQIIKHMKGVKELREYEKEQD |
| Ga0207905_10208995 | 3300025048 | Marine | MIVELLDKYHVDDFDDLLIKIIKHMKEQKETRQENENESI |
| Ga0208667_100542811 | 3300025070 | Marine | MIEELLDKYHEDDFDKLLINIINHMIEAKEIRKIDREKYDE |
| Ga0208667_10292524 | 3300025070 | Marine | MIVELLDKYHVDDFDDLLIKIIQHMKEQKETRQDNENDS |
| Ga0208667_10331764 | 3300025070 | Marine | LMIEELLDKYHEDDFDDLLIQIIKHMQEVKEIREMDREQD |
| Ga0208667_10737412 | 3300025070 | Marine | MIEELLDKYAVEEFDDLLILIIKKMQERKEEENDNNK |
| Ga0208791_10032099 | 3300025083 | Marine | MIVELLDKYHVDDFDDLLIKIIQHMKEQKETRQDNEDDS |
| Ga0208791_10366874 | 3300025083 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKEIREMDREQD |
| Ga0208792_10469862 | 3300025085 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKEIREMDREQNQ |
| Ga0208157_10180383 | 3300025086 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQEDLNA |
| Ga0208157_10370752 | 3300025086 | Marine | MKMIVELLDKYHVDEFDDLLIEIIKHMQEQKETRENKDE |
| Ga0208157_10647204 | 3300025086 | Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKELREWDREQD |
| Ga0208159_10097103 | 3300025101 | Marine | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQETEDE |
| Ga0208013_100392111 | 3300025103 | Marine | MIVELLDKYHVDEFDDLLIKIIKNMQEQKETRQEDENE |
| Ga0208793_11447482 | 3300025108 | Marine | MNMIVKLLDKYHVDEFDDLLIEIIKHMKEQKETRQENEDE |
| Ga0209348_10009732 | 3300025127 | Marine | MSNASMIVELLDKFHEDDFADLLIEIKKHMEEQKETRRDNE |
| Ga0209348_10065166 | 3300025127 | Marine | MIEELLDKYHVEDFDDLLIEIIKQMKEQKETREQD |
| Ga0209634_12031691 | 3300025138 | Marine | LDKYHVDDFDDLLIKIIKHMKEQKETRQENEDESI |
| Ga0209634_12088042 | 3300025138 | Marine | MNMIEELLDKYHEDDFDKLLIEIINHMIEVKELREDDREQD |
| Ga0209645_10149118 | 3300025151 | Marine | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQIRENEDEKF |
| Ga0209645_10862943 | 3300025151 | Marine | MIVELLDKYHVDEFDDLLIEIIKHMQEQKQTRENEDETI |
| Ga0209645_12097592 | 3300025151 | Marine | MIVELLDKYHVDEFDDLLIEIIKHMKEQKETRQDNEDDS |
| Ga0209337_11205345 | 3300025168 | Marine | MNMIEELLDKYHEDDFDKLLIEIINHMIEVKELRED |
| Ga0208029_11053062 | 3300025264 | Deep Ocean | MIEELLDKYHVDDFDDLLINIIKHMQDVKKDREANDD |
| Ga0208148_100004413 | 3300025508 | Aqueous | MIEELLDKYHVDDFDNLLIEIIKHMQEQKKIREQD |
| Ga0209504_100048125 | 3300025621 | Pelagic Marine | MIEELLDKYHEDDFDDLLIEIIKHMQEQKETREQD |
| Ga0209194_11268502 | 3300025632 | Pelagic Marine | MIEELLDKYSVDEFDNLLIEIIKQMKERKENEKEMV |
| Ga0208643_11227333 | 3300025645 | Aqueous | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQETEDA |
| Ga0208643_11749132 | 3300025645 | Aqueous | MIVELLDKYHVDDFDDLLIEIIKHMKEQKETRQENEDEXLYSSD |
| Ga0208643_11817093 | 3300025645 | Aqueous | MIEELLDKYHVDDFDDLLIEIIKQMQEQKETREED |
| Ga0208161_11777842 | 3300025646 | Aqueous | MNIVELLDKYDVDDFDNLLIEIINHMIEQKELRGEEE |
| Ga0208134_11780372 | 3300025652 | Aqueous | MIVELLDKYHVDDFDDLLIEIIKHMKEQKETRQENEDE |
| Ga0208795_10998722 | 3300025655 | Aqueous | MNIVELLDKYHVDDFDNLLIEIINHMIEQKQLRGEEEXG |
| Ga0208898_10396742 | 3300025671 | Aqueous | MYQELILQLLDAVHEDDFDNLLIEIINNMIEQKQTRKE |
| Ga0208898_10599444 | 3300025671 | Aqueous | MIVELLDKYHVDEFDDLLIKIIKHMKEQKETRQENEDE |
| Ga0209771_10520351 | 3300025701 | Marine | MNMIEELLDKYHEDDFDDLLIQIIKHMQEVKELREYD |
| Ga0208899_100714217 | 3300025759 | Aqueous | MIVELLDKYHVDEFDDLLIEIIKHMKEQKETRQENED |
| Ga0208767_10396713 | 3300025769 | Aqueous | MIVELLDKYHVDEFDDLLIKIIKHMQEQKETRQETEDEXLYSSD |
| Ga0208767_10417977 | 3300025769 | Aqueous | MNIIELLDNYHVDDFDDLLIEIIKNMKEQKQTREQDNE |
| Ga0208767_12396504 | 3300025769 | Aqueous | KLMIEELLDKYHVDDFDDLLIEIIKQMQEQKETREQD |
| Ga0208547_10473511 | 3300025828 | Aqueous | MIVELLDKYHVDDFDDLLIEIIKHMKEQKELREKDDDNNXKNKRRCKRN |
| Ga0209603_13480942 | 3300025849 | Pelagic Marine | MIEELLDKYHEDDFDDLLIQIIKHMQEVKESREMDREED |
| Ga0209308_100820202 | 3300025869 | Pelagic Marine | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELREMDREQD |
| Ga0208749_10628674 | 3300026077 | Marine | MIVELLDKYHVDDFDDLLIQIIKHMKEQRELRAEEEEEXKK |
| Ga0209929_10957572 | 3300026187 | Pond Water | MIEELLDKYHVDDFDDLLIEIIKHMKEQKETREQD |
| Ga0208673_10186673 | 3300027192 | Estuarine | MNMIGELLDKYHEDDFDDLLIQIIKHMKEVKELREYEKEQD |
| Ga0208304_102168401 | 3300027751 | Estuarine | MNMIEELLDKYHEDDFDDLLIQIIKHMKEVKELRE |
| Ga0209404_101952662 | 3300027906 | Marine | MIEELLDKYSVDEFDDLLLLIINRMKERKEIEEEENDNNE |
| Ga0135222_10151002 | 3300029301 | Marine Harbor | MIVELLDKYHVDEFDDLLIEIIKNMQEQKETRQEDDNE |
| Ga0307488_102740902 | 3300031519 | Sackhole Brine | MIEELLDKYHVDDFDDLLIQIIKHMKDVKKDREVEDGE |
| Ga0316204_105358992 | 3300032373 | Microbial Mat | MNIIELLDNYHVDDLLIEIIKNMKEQKQTREQDNE |
| Ga0314858_195573_188_307 | 3300033742 | Sea-Ice Brine | MIVELLDKYHVDDFDDLLIKIIKHMKEQKETRQENEDEI |
| ⦗Top⦘ |