


| Basic Information | |
|---|---|
| Family ID | F024116 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 207 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNEDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 207 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.24 % |
| % of genes near scaffold ends (potentially truncated) | 21.26 % |
| % of genes from short scaffolds (< 2000 bps) | 74.88 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.343 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (27.053 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.643 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.754 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 5.97% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 207 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 7.73 |
| PF13539 | Peptidase_M15_4 | 2.90 |
| PF01391 | Collagen | 1.93 |
| PF13884 | Peptidase_S74 | 1.93 |
| PF09374 | PG_binding_3 | 1.45 |
| PF00589 | Phage_integrase | 1.45 |
| PF12850 | Metallophos_2 | 0.97 |
| PF05838 | Glyco_hydro_108 | 0.97 |
| PF01381 | HTH_3 | 0.48 |
| PF05866 | RusA | 0.48 |
| PF12728 | HTH_17 | 0.48 |
| PF01844 | HNH | 0.48 |
| PF10145 | PhageMin_Tail | 0.48 |
| PF12705 | PDDEXK_1 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
|---|---|---|---|
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.97 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.66 % |
| Unclassified | root | N/A | 47.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10224291 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 611 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10225087 | Not Available | 609 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10057711 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10141167 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 727 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10006725 | All Organisms → cellular organisms → Bacteria | 6868 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10014865 | Not Available | 4259 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10020293 | All Organisms → Viruses → Predicted Viral | 3477 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10152854 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 760 | Open in IMG/M |
| 3300000947|BBAY92_10093305 | Not Available | 803 | Open in IMG/M |
| 3300000947|BBAY92_10142555 | Not Available | 631 | Open in IMG/M |
| 3300000947|BBAY92_10151275 | Not Available | 610 | Open in IMG/M |
| 3300001450|JGI24006J15134_10012037 | Not Available | 4208 | Open in IMG/M |
| 3300001460|JGI24003J15210_10102918 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 813 | Open in IMG/M |
| 3300001472|JGI24004J15324_10035804 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1571 | Open in IMG/M |
| 3300001589|JGI24005J15628_10000604 | Not Available | 20499 | Open in IMG/M |
| 3300001974|GOS2246_10035271 | Not Available | 1370 | Open in IMG/M |
| 3300002483|JGI25132J35274_1000492 | Not Available | 10544 | Open in IMG/M |
| 3300003474|NAP4_1140106 | Not Available | 514 | Open in IMG/M |
| 3300003645|NAP1_1049898 | Not Available | 562 | Open in IMG/M |
| 3300005057|Ga0068511_1088247 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 544 | Open in IMG/M |
| 3300005239|Ga0073579_1058594 | Not Available | 1176 | Open in IMG/M |
| 3300006025|Ga0075474_10167704 | Not Available | 684 | Open in IMG/M |
| 3300006026|Ga0075478_10002338 | Not Available | 6874 | Open in IMG/M |
| 3300006026|Ga0075478_10129730 | Not Available | 793 | Open in IMG/M |
| 3300006027|Ga0075462_10027816 | Not Available | 1825 | Open in IMG/M |
| 3300006027|Ga0075462_10068769 | Not Available | 1115 | Open in IMG/M |
| 3300006027|Ga0075462_10109413 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 856 | Open in IMG/M |
| 3300006027|Ga0075462_10141198 | Not Available | 738 | Open in IMG/M |
| 3300006029|Ga0075466_1060791 | Not Available | 1090 | Open in IMG/M |
| 3300006402|Ga0075511_1195802 | Not Available | 2613 | Open in IMG/M |
| 3300006402|Ga0075511_1746508 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 523 | Open in IMG/M |
| 3300006403|Ga0075514_1143421 | All Organisms → Viruses → Predicted Viral | 3907 | Open in IMG/M |
| 3300006735|Ga0098038_1006954 | All Organisms → Viruses → Predicted Viral | 4563 | Open in IMG/M |
| 3300006735|Ga0098038_1026123 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2199 | Open in IMG/M |
| 3300006735|Ga0098038_1150535 | Not Available | 775 | Open in IMG/M |
| 3300006737|Ga0098037_1116310 | Not Available | 917 | Open in IMG/M |
| 3300006749|Ga0098042_1054624 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300006752|Ga0098048_1237579 | Not Available | 534 | Open in IMG/M |
| 3300006789|Ga0098054_1342606 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 531 | Open in IMG/M |
| 3300006790|Ga0098074_1005788 | All Organisms → Viruses → Predicted Viral | 4552 | Open in IMG/M |
| 3300006790|Ga0098074_1016812 | All Organisms → Viruses → Predicted Viral | 2261 | Open in IMG/M |
| 3300006790|Ga0098074_1063763 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1012 | Open in IMG/M |
| 3300006793|Ga0098055_1077733 | Not Available | 1308 | Open in IMG/M |
| 3300006793|Ga0098055_1218179 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 722 | Open in IMG/M |
| 3300006802|Ga0070749_10076895 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
| 3300006802|Ga0070749_10674660 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 553 | Open in IMG/M |
| 3300006802|Ga0070749_10714828 | Not Available | 535 | Open in IMG/M |
| 3300006810|Ga0070754_10012408 | Not Available | 5278 | Open in IMG/M |
| 3300006810|Ga0070754_10061385 | All Organisms → Viruses → Predicted Viral | 1946 | Open in IMG/M |
| 3300006810|Ga0070754_10064130 | Not Available | 1895 | Open in IMG/M |
| 3300006810|Ga0070754_10141290 | Not Available | 1158 | Open in IMG/M |
| 3300006810|Ga0070754_10316011 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 697 | Open in IMG/M |
| 3300006810|Ga0070754_10344941 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 660 | Open in IMG/M |
| 3300006810|Ga0070754_10345793 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 659 | Open in IMG/M |
| 3300006869|Ga0075477_10008469 | All Organisms → Viruses → Predicted Viral | 4872 | Open in IMG/M |
| 3300006916|Ga0070750_10000866 | Not Available | 16809 | Open in IMG/M |
| 3300006916|Ga0070750_10046677 | All Organisms → Viruses → Predicted Viral | 2109 | Open in IMG/M |
| 3300006916|Ga0070750_10058378 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1853 | Open in IMG/M |
| 3300006916|Ga0070750_10072555 | Not Available | 1628 | Open in IMG/M |
| 3300006916|Ga0070750_10241850 | Not Available | 786 | Open in IMG/M |
| 3300006916|Ga0070750_10294706 | Not Available | 695 | Open in IMG/M |
| 3300006919|Ga0070746_10218950 | Not Available | 900 | Open in IMG/M |
| 3300006919|Ga0070746_10335320 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 688 | Open in IMG/M |
| 3300006921|Ga0098060_1014433 | All Organisms → Viruses → Predicted Viral | 2529 | Open in IMG/M |
| 3300006928|Ga0098041_1089917 | Not Available | 991 | Open in IMG/M |
| 3300007229|Ga0075468_10095221 | Not Available | 950 | Open in IMG/M |
| 3300007229|Ga0075468_10168725 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 653 | Open in IMG/M |
| 3300007276|Ga0070747_1109852 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300007346|Ga0070753_1152306 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 875 | Open in IMG/M |
| 3300007539|Ga0099849_1054359 | Not Available | 1659 | Open in IMG/M |
| 3300007555|Ga0102817_1098894 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 641 | Open in IMG/M |
| 3300007647|Ga0102855_1095077 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 799 | Open in IMG/M |
| 3300007963|Ga0110931_1235104 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 545 | Open in IMG/M |
| 3300008012|Ga0075480_10377113 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 703 | Open in IMG/M |
| 3300008216|Ga0114898_1116780 | Not Available | 787 | Open in IMG/M |
| 3300008217|Ga0114899_1187907 | Not Available | 660 | Open in IMG/M |
| 3300008220|Ga0114910_1044037 | Not Available | 1452 | Open in IMG/M |
| 3300009071|Ga0115566_10079202 | Not Available | 2150 | Open in IMG/M |
| 3300009074|Ga0115549_1060796 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1320 | Open in IMG/M |
| 3300009077|Ga0115552_1169431 | Not Available | 908 | Open in IMG/M |
| 3300009077|Ga0115552_1213783 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 787 | Open in IMG/M |
| 3300009193|Ga0115551_1458936 | Not Available | 545 | Open in IMG/M |
| 3300009426|Ga0115547_1061019 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300009428|Ga0114915_1078193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1015 | Open in IMG/M |
| 3300009476|Ga0115555_1023100 | Not Available | 3081 | Open in IMG/M |
| 3300009481|Ga0114932_10020419 | All Organisms → Viruses → Predicted Viral | 4593 | Open in IMG/M |
| 3300009496|Ga0115570_10288655 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 714 | Open in IMG/M |
| 3300009508|Ga0115567_10492495 | Not Available | 747 | Open in IMG/M |
| 3300009550|Ga0115013_10297474 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 998 | Open in IMG/M |
| 3300009593|Ga0115011_10249611 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300009603|Ga0114911_1077811 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300009603|Ga0114911_1100220 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 845 | Open in IMG/M |
| 3300009620|Ga0114912_1118691 | Not Available | 627 | Open in IMG/M |
| 3300009757|Ga0123367_1023785 | Not Available | 753 | Open in IMG/M |
| 3300009790|Ga0115012_10707640 | Not Available | 808 | Open in IMG/M |
| 3300010149|Ga0098049_1238349 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 554 | Open in IMG/M |
| 3300010153|Ga0098059_1045856 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1762 | Open in IMG/M |
| 3300010368|Ga0129324_10271079 | Not Available | 673 | Open in IMG/M |
| 3300011129|Ga0151672_176973 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 519 | Open in IMG/M |
| 3300012919|Ga0160422_10635465 | Not Available | 678 | Open in IMG/M |
| 3300012920|Ga0160423_10125085 | All Organisms → Viruses → Predicted Viral | 1811 | Open in IMG/M |
| 3300017697|Ga0180120_10052585 | Not Available | 1833 | Open in IMG/M |
| 3300017708|Ga0181369_1060091 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 836 | Open in IMG/M |
| 3300017713|Ga0181391_1149781 | Not Available | 516 | Open in IMG/M |
| 3300017728|Ga0181419_1078324 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 829 | Open in IMG/M |
| 3300017730|Ga0181417_1000079 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 29029 | Open in IMG/M |
| 3300017731|Ga0181416_1005612 | All Organisms → Viruses → Predicted Viral | 3006 | Open in IMG/M |
| 3300017731|Ga0181416_1024323 | Not Available | 1421 | Open in IMG/M |
| 3300017732|Ga0181415_1002373 | All Organisms → Viruses → Predicted Viral | 4866 | Open in IMG/M |
| 3300017738|Ga0181428_1058977 | Not Available | 895 | Open in IMG/M |
| 3300017744|Ga0181397_1095729 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 783 | Open in IMG/M |
| 3300017750|Ga0181405_1004489 | Not Available | 4227 | Open in IMG/M |
| 3300017753|Ga0181407_1157917 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300017755|Ga0181411_1001719 | All Organisms → cellular organisms → Bacteria | 8019 | Open in IMG/M |
| 3300017755|Ga0181411_1187362 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 585 | Open in IMG/M |
| 3300017760|Ga0181408_1021435 | Not Available | 1783 | Open in IMG/M |
| 3300017760|Ga0181408_1024064 | All Organisms → Viruses | 1676 | Open in IMG/M |
| 3300017760|Ga0181408_1087024 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300017763|Ga0181410_1043221 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300017763|Ga0181410_1115434 | Not Available | 770 | Open in IMG/M |
| 3300017764|Ga0181385_1249387 | Not Available | 532 | Open in IMG/M |
| 3300017765|Ga0181413_1000011 | Not Available | 43340 | Open in IMG/M |
| 3300017770|Ga0187217_1117069 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 901 | Open in IMG/M |
| 3300017770|Ga0187217_1288454 | Not Available | 530 | Open in IMG/M |
| 3300017773|Ga0181386_1123510 | Not Available | 800 | Open in IMG/M |
| 3300017773|Ga0181386_1246764 | Not Available | 528 | Open in IMG/M |
| 3300017779|Ga0181395_1060949 | Not Available | 1234 | Open in IMG/M |
| 3300017781|Ga0181423_1009632 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4107 | Open in IMG/M |
| 3300017782|Ga0181380_1000027 | Not Available | 53402 | Open in IMG/M |
| 3300017967|Ga0181590_10611199 | Not Available | 745 | Open in IMG/M |
| 3300018416|Ga0181553_10060805 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
| 3300018416|Ga0181553_10193107 | Not Available | 1182 | Open in IMG/M |
| 3300018416|Ga0181553_10308406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 879 | Open in IMG/M |
| 3300018420|Ga0181563_10450515 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300018420|Ga0181563_10590576 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 618 | Open in IMG/M |
| 3300019699|Ga0193985_1054734 | Not Available | 501 | Open in IMG/M |
| 3300019717|Ga0193972_1006689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter | 1030 | Open in IMG/M |
| 3300019723|Ga0194004_1040913 | Not Available | 599 | Open in IMG/M |
| 3300019730|Ga0194001_1000265 | All Organisms → Viruses → Predicted Viral | 3901 | Open in IMG/M |
| 3300019730|Ga0194001_1001592 | Not Available | 1795 | Open in IMG/M |
| 3300019734|Ga0193970_1002424 | Not Available | 1737 | Open in IMG/M |
| 3300020392|Ga0211666_10003674 | Not Available | 8953 | Open in IMG/M |
| 3300020394|Ga0211497_10364900 | Not Available | 530 | Open in IMG/M |
| 3300020431|Ga0211554_10191485 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300020436|Ga0211708_10044763 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300020439|Ga0211558_10000545 | All Organisms → cellular organisms → Bacteria | 20135 | Open in IMG/M |
| 3300020439|Ga0211558_10038138 | Not Available | 2424 | Open in IMG/M |
| 3300020439|Ga0211558_10164438 | Not Available | 1067 | Open in IMG/M |
| 3300020453|Ga0211550_10037444 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2344 | Open in IMG/M |
| 3300021356|Ga0213858_10063424 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1796 | Open in IMG/M |
| 3300021957|Ga0222717_10079099 | Not Available | 2082 | Open in IMG/M |
| 3300021957|Ga0222717_10247433 | Not Available | 1037 | Open in IMG/M |
| 3300021957|Ga0222717_10252683 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1023 | Open in IMG/M |
| 3300021957|Ga0222717_10327417 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 867 | Open in IMG/M |
| 3300021959|Ga0222716_10301147 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 968 | Open in IMG/M |
| 3300022065|Ga0212024_1005825 | All Organisms → Viruses → Predicted Viral | 1677 | Open in IMG/M |
| 3300022068|Ga0212021_1060393 | Not Available | 774 | Open in IMG/M |
| 3300022068|Ga0212021_1125015 | Not Available | 526 | Open in IMG/M |
| 3300022178|Ga0196887_1042131 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300022187|Ga0196899_1040074 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1590 | Open in IMG/M |
| 3300022187|Ga0196899_1155814 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 632 | Open in IMG/M |
| 3300023116|Ga0255751_10412519 | Not Available | 664 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10346361 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 628 | Open in IMG/M |
| 3300024344|Ga0209992_10139482 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1062 | Open in IMG/M |
| 3300025070|Ga0208667_1008308 | Not Available | 2522 | Open in IMG/M |
| 3300025071|Ga0207896_1006555 | Not Available | 2114 | Open in IMG/M |
| 3300025084|Ga0208298_1080160 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 607 | Open in IMG/M |
| 3300025093|Ga0208794_1003191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5725 | Open in IMG/M |
| 3300025093|Ga0208794_1003229 | All Organisms → cellular organisms → Bacteria | 5688 | Open in IMG/M |
| 3300025093|Ga0208794_1019912 | Not Available | 1420 | Open in IMG/M |
| 3300025098|Ga0208434_1096326 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 584 | Open in IMG/M |
| 3300025099|Ga0208669_1000333 | Not Available | 19022 | Open in IMG/M |
| 3300025099|Ga0208669_1004511 | Not Available | 4404 | Open in IMG/M |
| 3300025099|Ga0208669_1080174 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 702 | Open in IMG/M |
| 3300025101|Ga0208159_1006652 | Not Available | 3391 | Open in IMG/M |
| 3300025110|Ga0208158_1036352 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1244 | Open in IMG/M |
| 3300025120|Ga0209535_1097302 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300025132|Ga0209232_1002232 | Not Available | 9680 | Open in IMG/M |
| 3300025137|Ga0209336_10061198 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300025151|Ga0209645_1001151 | Not Available | 13376 | Open in IMG/M |
| 3300025151|Ga0209645_1016326 | All Organisms → Viruses → Predicted Viral | 2886 | Open in IMG/M |
| 3300025151|Ga0209645_1158749 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 692 | Open in IMG/M |
| 3300025168|Ga0209337_1000331 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 37464 | Open in IMG/M |
| 3300025168|Ga0209337_1026468 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3280 | Open in IMG/M |
| 3300025508|Ga0208148_1030301 | Not Available | 1461 | Open in IMG/M |
| 3300025508|Ga0208148_1048469 | Not Available | 1059 | Open in IMG/M |
| 3300025594|Ga0209094_1084828 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 742 | Open in IMG/M |
| 3300025610|Ga0208149_1077046 | Not Available | 825 | Open in IMG/M |
| 3300025630|Ga0208004_1110272 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 641 | Open in IMG/M |
| 3300025759|Ga0208899_1046044 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1903 | Open in IMG/M |
| 3300025759|Ga0208899_1134396 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 869 | Open in IMG/M |
| 3300025769|Ga0208767_1164975 | Not Available | 787 | Open in IMG/M |
| 3300025769|Ga0208767_1165435 | Not Available | 785 | Open in IMG/M |
| 3300025769|Ga0208767_1204948 | Not Available | 658 | Open in IMG/M |
| 3300025803|Ga0208425_1083644 | Not Available | 759 | Open in IMG/M |
| 3300025853|Ga0208645_1039260 | All Organisms → Viruses → Predicted Viral | 2359 | Open in IMG/M |
| 3300025889|Ga0208644_1144559 | Not Available | 1100 | Open in IMG/M |
| 3300025889|Ga0208644_1157717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter | 1032 | Open in IMG/M |
| 3300027859|Ga0209503_10235013 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 885 | Open in IMG/M |
| 3300027906|Ga0209404_10352061 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 950 | Open in IMG/M |
| 3300029309|Ga0183683_1015994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium | 1679 | Open in IMG/M |
| 3300029448|Ga0183755_1018996 | Not Available | 2334 | Open in IMG/M |
| 3300029787|Ga0183757_1000958 | Not Available | 13496 | Open in IMG/M |
| 3300029792|Ga0183826_1053032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 622 | Open in IMG/M |
| 3300032073|Ga0315315_10321943 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon HGW-Euryarchaeota-1 | 1440 | Open in IMG/M |
| 3300032254|Ga0316208_1053819 | Not Available | 1186 | Open in IMG/M |
| 3300034375|Ga0348336_001743 | Not Available | 18939 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 27.05% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.86% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.38% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.38% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.42% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.97% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.97% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.48% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.48% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.48% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.48% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.48% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.48% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.48% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.48% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003645 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 1 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019699 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019717 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MG | Environmental | Open in IMG/M |
| 3300019723 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_0-1_MG | Environmental | Open in IMG/M |
| 3300019730 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG | Environmental | Open in IMG/M |
| 3300019734 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MG | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102242912 | 3300000101 | Marine | MNEDLKDYITIIAFLVIVLGGLVLFGSCDGGWSVAGYEV* |
| DelMOSum2010_102250872 | 3300000101 | Marine | MNEDLKDYLTIIAFLVIVLGGLVLFGSCDSGWSVSGYEV* |
| DelMOSum2011_100577114 | 3300000115 | Marine | VSDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| DelMOSum2011_101411673 | 3300000115 | Marine | MNEDLKDYLTIIAFLVIVLGGLVFFGSCDSGWSVSGYEV* |
| DelMOWin2010_100067253 | 3300000117 | Marine | MQEDWTDYLKIILFLLFVLGGLVFLGSCDSGWSISGYEI* |
| DelMOWin2010_100148651 | 3300000117 | Marine | MVSDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| DelMOWin2010_100202934 | 3300000117 | Marine | MNDDLKDYLSIIAFLIVVLGGLVLIGSCDGGWSVAGYEV* |
| DelMOWin2010_101528543 | 3300000117 | Marine | MNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| BBAY92_100933052 | 3300000947 | Macroalgal Surface | MNEDWKDYISIVVFLILVLGGLILIGSCDSGWSVAGYEV* |
| BBAY92_101425552 | 3300000947 | Macroalgal Surface | MNGLVNEDWKDYVSIIAFLFIVLGGLILIGSCDSGW |
| BBAY92_101512752 | 3300000947 | Macroalgal Surface | MNEDFTDYIKIIIFLFLVLGGLVFLGSCDSGWSVAGYEV* |
| JGI24006J15134_100120379 | 3300001450 | Marine | MNEDFKDYLIIIAFLVFVLGGLVFFGSCDSGWSVVGYEV* |
| JGI24003J15210_101029183 | 3300001460 | Marine | MNEDLKDYLTIIAFLVIVLGGLVLLGSCDGGWSVVGYEV* |
| JGI24004J15324_100358045 | 3300001472 | Marine | VDGFISEDLKDYLTIIGFLVIVLGGLVFFGSCDSGWSVSGYEV* |
| JGI24005J15628_100006043 | 3300001589 | Marine | MSEDLKDYLTIIGFLVIVLGGLVFFGSCDGGWSVSGYEV* |
| GOS2246_100352713 | 3300001974 | Marine | LNEDWTDYLKIIIFLFLVLGGLVLLGSCDGGWSIAGYEV* |
| JGI25132J35274_10004926 | 3300002483 | Marine | MNEDWKDYVTIIAFLIIVLGGLVLLGSCDGGWSIAGYEV* |
| NAP4_11401062 | 3300003474 | Estuarine | MSGLVNEDWKDYVSIIAFLVIVLGGLVLLGSCDSGWSVAGYEV* |
| NAP1_10498981 | 3300003645 | Estuarine | VNEDWKDYVSIIAFLVIVLGGLVLLGSCDSGWSVAGYEV* |
| Ga0068511_10882472 | 3300005057 | Marine Water | MNEDFKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV* |
| Ga0073579_10585941 | 3300005239 | Marine | MNEDLKDYITIIGFLVIVLGGLVLFGSCDSGWSVAGYEV* |
| Ga0075474_101677043 | 3300006025 | Aqueous | MNEDWTDYLKIIVFLFLILGGLVFFGSCDSGWSVGSLDL* |
| Ga0075478_100023384 | 3300006026 | Aqueous | MNEDWKDYVSIIAFLIIVLGGLVLLGSCDGGWSIAGYEV* |
| Ga0075478_101297303 | 3300006026 | Aqueous | MNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV* |
| Ga0075462_100278162 | 3300006027 | Aqueous | MNEDWKDYITIIAFLIIVLGGLVLLGSCDGGWSIAGYEV* |
| Ga0075462_100687693 | 3300006027 | Aqueous | LNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV* |
| Ga0075462_101094133 | 3300006027 | Aqueous | DFTDYIKILVFLFLVLGGLGFFGRSDAGWSIAGYEV* |
| Ga0075462_101411981 | 3300006027 | Aqueous | YRKHRRFLQVLQAMNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV* |
| Ga0075466_10607911 | 3300006029 | Aqueous | MNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDNGWSVVGYEV* |
| Ga0075511_11958021 | 3300006402 | Aqueous | NEDFKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV* |
| Ga0075511_17465082 | 3300006402 | Aqueous | MNEDFTDYIKILVFLFLVLGGLVFFGSCDAGWSIAGYDI* |
| Ga0075514_11434211 | 3300006403 | Aqueous | VLQTMNEDFKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV* |
| Ga0098038_10069542 | 3300006735 | Marine | MNEDLKDYLTIIAFLVIILGGLVLLGSCDGGWSVAGYEV* |
| Ga0098038_10261232 | 3300006735 | Marine | MNEDLKDYISIIIFLIIVLGGLVLIGSCDGGWSIAGYEV* |
| Ga0098038_11505353 | 3300006735 | Marine | VDGIVNEDLKDYISIIVFLIVVLGGLVLIGSCDGGWSIAGYEV* |
| Ga0098037_11163103 | 3300006737 | Marine | VNEDLKDYISIIVFLIVVLGGLVLIGSCDGGWSIAGYEV* |
| Ga0098042_10546243 | 3300006749 | Marine | VNEDWKDYVSIMAFLFIVLGGLILIGSCDSGWSIAGYEV* |
| Ga0098048_12375792 | 3300006752 | Marine | VNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSIAGYEV* |
| Ga0098054_13426062 | 3300006789 | Marine | VNDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| Ga0098074_100578810 | 3300006790 | Marine | MNEDIKDVIKVIAFITVILGGLVLLGSCDSGWSVAGWEV* |
| Ga0098074_10168126 | 3300006790 | Marine | MSEDIKDVIKVIAFITVILGGLVLLGSCDSGWSVAGWEV* |
| Ga0098074_10637633 | 3300006790 | Marine | MNEDFTDYIKILVFLFLVLGGLVFFGSCDAGWSIAGYEV* |
| Ga0098055_10777333 | 3300006793 | Marine | MNEDWKDYVSIIAFLFIVLGGLVLIGSCDSGWSIAGYEV* |
| Ga0098055_12181793 | 3300006793 | Marine | MNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSVVGYEV* |
| Ga0070749_100768952 | 3300006802 | Aqueous | MFLKKMMSEDIKDVIKVIAFITVILGGLVLLGSCDSGWSVAGWEV* |
| Ga0070749_106746602 | 3300006802 | Aqueous | MNEDFKDYIQIILFLLFVLGGLILGSCDGGWSIAGYEV* |
| Ga0070749_107148281 | 3300006802 | Aqueous | DFKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV* |
| Ga0070754_100124087 | 3300006810 | Aqueous | MNDDLKDYISILIFLFIVLGGLVFLGSCDAGWSIAGYKV* |
| Ga0070754_100613855 | 3300006810 | Aqueous | MNEDWKDYVTIIAFLIIVLGGLILLGSCDGGWSIAGYEV* |
| Ga0070754_100641302 | 3300006810 | Aqueous | MNEDLKDYLTIIAFLVIVLGGLVLFGSCDSGWSISGYEV* |
| Ga0070754_101412901 | 3300006810 | Aqueous | VLQAMNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV* |
| Ga0070754_103160112 | 3300006810 | Aqueous | MNDDLKDYISILIFLFIVLGGLVFLGSCDAGWSIAGYEV* |
| Ga0070754_103449411 | 3300006810 | Aqueous | DFTDYIKILVFLFLVLGGLVFFGSCDAGWSIAGYEV* |
| Ga0070754_103457932 | 3300006810 | Aqueous | MNEDLKDYITIIVFLVIVLGGLVLFGSCDGGWSVAGYEV* |
| Ga0075477_100084691 | 3300006869 | Aqueous | KDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV* |
| Ga0070750_1000086610 | 3300006916 | Aqueous | MMSEDIKDVIKVIAFITVILGGLVLLGSCDSGWSVAGWEV* |
| Ga0070750_100466773 | 3300006916 | Aqueous | VNEDWKDYLSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV* |
| Ga0070750_100583782 | 3300006916 | Aqueous | MSGLVNEDWKDYATILAFLVIVLGGLVLLGSCDAGWSVAGYEV* |
| Ga0070750_100725558 | 3300006916 | Aqueous | MSKDLKDIIKVIVFLVVVLGGLVLVGSCDSGWSVAGYEV* |
| Ga0070750_102418503 | 3300006916 | Aqueous | MNEDFTDYIKILVFLFLVLGGLVFFGSCDAGWSIAGYEI* |
| Ga0070750_102947062 | 3300006916 | Aqueous | LNEDWKDYVSIIAFLVIVLGGLVLLGSCDGGWSIAGYEV* |
| Ga0070746_102189503 | 3300006919 | Aqueous | MNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGY |
| Ga0070746_103353202 | 3300006919 | Aqueous | MSDLVNEDWKDYATILAFLVIVLGGLVLLGSCDAGWSVAGYEV* |
| Ga0098060_10144333 | 3300006921 | Marine | MNGLVNDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSVVGYEV* |
| Ga0098041_10899173 | 3300006928 | Marine | VDGIVNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSIAGYEV* |
| Ga0075468_100952213 | 3300007229 | Aqueous | VSDDLKDYITIIAFLVIVLGGLVLLGSCDNGWSVVGYEV* |
| Ga0075468_101687252 | 3300007229 | Aqueous | MNEDLKDYISIVVFLIIVLGGLILIGSCDSGWSVAGYEV* |
| Ga0070747_11098523 | 3300007276 | Aqueous | VNEDWKDYVSIIAFLVIVLGGLMLLGSCDSGWSIAGYEV* |
| Ga0070753_11523063 | 3300007346 | Aqueous | MNEDLKDYLTIIAFLVIVLGGLVLFRSCDSGWSVSGYEV* |
| Ga0099849_10543596 | 3300007539 | Aqueous | MSEDLKDYLTIIGFLVIILGGLVFFGSCDSGWSVSGYEV* |
| Ga0102817_10988941 | 3300007555 | Estuarine | VDGIMNEDLKDYLTIIAFLVIVLGGLVFFESCDGGWSVAGYEV* |
| Ga0102855_10950772 | 3300007647 | Estuarine | MNEDLKDYLTIIAFLVIVLGGLVLFGSCDGGWSVAGYEV* |
| Ga0110931_12351042 | 3300007963 | Marine | MNEDLKDYLTIIAFLVIVLGSLVLFGSCDGGWSVAGYEV* |
| Ga0075480_103771131 | 3300008012 | Aqueous | EDFKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV* |
| Ga0114898_11167803 | 3300008216 | Deep Ocean | LNEDLKDYISIVVFLILVLGGLILIGSCDSGWSVAGYEV* |
| Ga0114899_11879073 | 3300008217 | Deep Ocean | VNEDLKDYISIVVFLILVLGGLILIGSCDGGWSVAGYEV* |
| Ga0114910_10440374 | 3300008220 | Deep Ocean | VNEDLKDYISIVVFLIIVLGGLILIGSCDSGWSVAGYEV* |
| Ga0115566_100792029 | 3300009071 | Pelagic Marine | MNEDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| Ga0115549_10607963 | 3300009074 | Pelagic Marine | MNEDLKDYIAIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| Ga0115552_11694312 | 3300009077 | Pelagic Marine | MNEDLKDYLTIIGFLVIVLGGLVFFGSCDSGWSVSGYEV* |
| Ga0115552_12137832 | 3300009077 | Pelagic Marine | MNDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV* |
| Ga0115551_14589362 | 3300009193 | Pelagic Marine | MNDDLKDYITIIAFLVIVLGGLVLFGSCDGGWSVAGYEV* |
| Ga0115547_10610192 | 3300009426 | Pelagic Marine | MNEDLKDYLTIIAFLLMVLGSLVIFGSCDGGWSVAGYEV* |
| Ga0114915_10781934 | 3300009428 | Deep Ocean | VNEDLKDYLTIIGFLIIILGGLVLFGSCDGEWSVVGYEA* |
| Ga0115555_10231007 | 3300009476 | Pelagic Marine | MNEDLKDYLTIIGFLVIVLGGLVFFGSCDSGWSVSVMRYE* |
| Ga0114932_100204192 | 3300009481 | Deep Subsurface | MNEDFTDYIKIIIFLFLVLGGLIFLGGCDGGWSVAGYEI* |
| Ga0115570_102886552 | 3300009496 | Pelagic Marine | MNEDLKDYLTIIAFLVIVLGSLVLFGSCDSGWSVSGYEV* |
| Ga0115567_104924952 | 3300009508 | Pelagic Marine | MNEDLKDYLTIIAFLVIVLGGLVFFGSCDGGWSVAGYKV* |
| Ga0115013_102974743 | 3300009550 | Marine | MNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSIAGYEV* |
| Ga0115011_102496113 | 3300009593 | Marine | MNEDWKDYLSIILFLFIVLGGLIILGSCDSGWSIAGYEV* |
| Ga0114911_10778111 | 3300009603 | Deep Ocean | DLKDYISIVVFLILVLGGLILIGSCDSGWSVAGYEV* |
| Ga0114911_11002203 | 3300009603 | Deep Ocean | VDGTLNEDLKDYISIVVFLIIVLGGLILIGSCDGGWSVAGYEV* |
| Ga0114912_11186912 | 3300009620 | Deep Ocean | VNEDLKDYISIVVFLILVLGGLILIGSCDSGWSVAGYEV* |
| Ga0123367_10237853 | 3300009757 | Marine | MNGLVNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGW |
| Ga0115012_107076403 | 3300009790 | Marine | MNEDWKDYLSIILFLFIVLGGLIILGSCDSGWSIAGY |
| Ga0098049_12383492 | 3300010149 | Marine | LKDYISIIVFLIVVLGGLVLIGSCDGGWSIAGYEV* |
| Ga0098059_10458566 | 3300010153 | Marine | VNDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSVVGYEV* |
| Ga0129324_102710792 | 3300010368 | Freshwater To Marine Saline Gradient | MNEDFKDYIQIILFLLFVLGGIILLGSCDGGWSIAGYEV* |
| Ga0151672_1769732 | 3300011129 | Marine | MSEDLKDYLTIIGFLVIILGGLVFFGSCDSGWSRSGYEV* |
| Ga0160422_106354651 | 3300012919 | Seawater | ILFRTILIVLAFYLFLFIVLGGLVFFGSCDSGWSVAGYEV* |
| Ga0160423_101250855 | 3300012920 | Surface Seawater | MNDDLKDYISILIFLFIVLGGLVLLGSCDAGWSIAGYEV* |
| Ga0180120_100525855 | 3300017697 | Freshwater To Marine Saline Gradient | MNEDLKDYLTIIAFLVIVLGGLVFFGSCDSGWSVSGYEV |
| Ga0181369_10600913 | 3300017708 | Marine | MNEDLKDYISIIIFLIIVLGGLVLIGSCDGGWSIAGYEV |
| Ga0181391_11497812 | 3300017713 | Seawater | MSEDLKDIIKVVTFLVVILGGLVLVGSCNSGWSVVGYEI |
| Ga0181419_10783242 | 3300017728 | Seawater | MNEDLKDYISIVVFLIIVLGGLVLIGSCDGSCSVAGYEV |
| Ga0181417_100007952 | 3300017730 | Seawater | MSGLVSEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0181416_100561210 | 3300017731 | Seawater | SSCLVDGIMNEDLKDYLTIIAFLVIVLGGLVLFGSCDGGWSVAGYEV |
| Ga0181416_10243234 | 3300017731 | Seawater | LNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0181415_10023735 | 3300017732 | Seawater | MNEDLKDYLTIIAFLVIVLGGLVLLGSCDGGWSVAGYEV |
| Ga0181428_10589774 | 3300017738 | Seawater | MNGLVNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGLEI |
| Ga0181397_10957292 | 3300017744 | Seawater | VNEDLKDYLTIIAFLVIVLGGLVLLGSCDSGWSVVGYEV |
| Ga0181405_10044899 | 3300017750 | Seawater | MNGLVNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0181407_11579172 | 3300017753 | Seawater | VNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0181411_10017192 | 3300017755 | Seawater | MNGLVSDDLKDYITIIVFLVIVLGGLVLLGSCDEGWSVAGYEV |
| Ga0181411_11873623 | 3300017755 | Seawater | VDGIMNEDLKDYITIIAFLIIVLGGLVLFGSCDGGWSVAGYEV |
| Ga0181408_10214351 | 3300017760 | Seawater | DWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0181408_10240642 | 3300017760 | Seawater | VNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGLEI |
| Ga0181408_10870244 | 3300017760 | Seawater | GLVNEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0181410_10432213 | 3300017763 | Seawater | VSDDLKDYITIIVFLVIVLGGLVLLGSCDSGWSVVGYEV |
| Ga0181410_11154345 | 3300017763 | Seawater | VSDDLKDYITIIVFLVIVLGGLVLLGSCDEGWSVAGYEV |
| Ga0181385_12493872 | 3300017764 | Seawater | MNEDWKDYLSIIAFLVIVLGGLVILGSCDSGWSIVGYEV |
| Ga0181413_10000112 | 3300017765 | Seawater | MNEDLKDYITIIAFLIIVLGGLVLFGSCDGGWSVAGYEV |
| Ga0187217_11170692 | 3300017770 | Seawater | MNDDLKDYLSIIAFLVVVLGGLVLIGSCDGGWSVAGYKV |
| Ga0187217_12884541 | 3300017770 | Seawater | MNEDLKDYLTIIAFLVIVLGGLVLFGSCDGGWSVA |
| Ga0181386_11235104 | 3300017773 | Seawater | VNEDWKDYISIIVFLFIVLGGLILIGSCNGGWAVAGWEITPSDSSNIF |
| Ga0181386_12467642 | 3300017773 | Seawater | MNEDFTDYIKIIIFLFLVLGSLVFIGGCDGGWSVAGYKLDRI |
| Ga0181395_10609491 | 3300017779 | Seawater | KRMNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV |
| Ga0181423_10096322 | 3300017781 | Seawater | MSGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSIVGYEV |
| Ga0181380_100002764 | 3300017782 | Seawater | MSEDLKDIIKVVTFLVVILGGLVLVGSCNSGCSVVGYEI |
| Ga0181590_106111992 | 3300017967 | Salt Marsh | LNEDWKDYITILAFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0181553_100608052 | 3300018416 | Salt Marsh | LNEDWKDYAIILAFLVIVLGGLVLLGSCDSGWSVAGHEV |
| Ga0181553_101931074 | 3300018416 | Salt Marsh | MNEDWKDYAIILAFLIIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0181553_103084062 | 3300018416 | Salt Marsh | LNEDWKDYITILAFLVIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0181563_104505153 | 3300018420 | Salt Marsh | NEDWKDYAIILAFLVIVLGGLVLLGSCDSGWSVAGHEV |
| Ga0181563_105905762 | 3300018420 | Salt Marsh | MNEDWKDYVSIIAFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0193985_10547341 | 3300019699 | Sediment | MNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0193972_10066895 | 3300019717 | Sediment | MQEDWTDYLKIILFLLFVLGGLVFLGSCDSGWSISGYEI |
| Ga0194004_10409131 | 3300019723 | Sediment | SSRYRKHRRFLQVLQAMNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0194001_10002651 | 3300019730 | Sediment | NWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0194001_10015924 | 3300019730 | Sediment | MQEDWTDYLKIILFLLFVLGGLVFLGSCDSEWSISGYEI |
| Ga0193970_10024248 | 3300019734 | Sediment | FLQVLQAMNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0211666_1000367412 | 3300020392 | Marine | LNEDWKDYLSIILFLIVILGGLVILGSCDGGWSIAGYEV |
| Ga0211497_103649002 | 3300020394 | Marine | MNEDWKDYVSILAFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0211554_101914852 | 3300020431 | Marine | LNEDLKDYISIVVFLILVLGGLILIGSCDSGWSVAGYEV |
| Ga0211708_100447635 | 3300020436 | Marine | MNEDWTDYLKILAFLFIVLGGLVFFGSCDSGWSIAGYEV |
| Ga0211558_100005457 | 3300020439 | Marine | MNEDWTDYLKIIVFLFLILGGLVFFGSCDSGWSVGSLDL |
| Ga0211558_100381383 | 3300020439 | Marine | MNEDFKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV |
| Ga0211558_101644382 | 3300020439 | Marine | MNEDWKDYISVILFLIIVLGGLVLLGSCDGGWSIAGYEI |
| Ga0211550_100374442 | 3300020453 | Marine | MNEDFTDYIKIIIFLFLVLGGLIFLGGCDGGWSVAGYEI |
| Ga0213858_100634242 | 3300021356 | Seawater | MNEDLKDYIQIILFLLFVLGGLILLGSCDGGWSIAGYEV |
| Ga0222717_100790996 | 3300021957 | Estuarine Water | MNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV |
| Ga0222717_102474332 | 3300021957 | Estuarine Water | MNEDFKDYLIIIAFLVFVLGGLVFFGSCDSGWSVVGYEV |
| Ga0222717_102526832 | 3300021957 | Estuarine Water | VSDDLKDYIAIIAFLVIVLGGLVLLGSCDSGWSVVGYEV |
| Ga0222717_103274172 | 3300021957 | Estuarine Water | VSDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSIVGYEV |
| Ga0222716_103011473 | 3300021959 | Estuarine Water | MNEDLKDYLTIIAFLIIVLGGLVLFGSCDGGWSVAGYEV |
| Ga0212024_10058255 | 3300022065 | Aqueous | MSGLVNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0212021_10603932 | 3300022068 | Aqueous | VNEDWKDYATILAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0212021_11250152 | 3300022068 | Aqueous | LNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0196887_10421312 | 3300022178 | Aqueous | MNEDLKDYISIVVFLIIVLGGLILIGSCDSGWSVAGYEV |
| Ga0196899_10400743 | 3300022187 | Aqueous | MNDDFKDYISILIFLFIVLGGLVLLGSCDSGWSIAGYEV |
| Ga0196899_11558142 | 3300022187 | Aqueous | MNDDLKDYISILIFLFIVLGGLVFLGSCDAGWSIAGYEV |
| Ga0255751_104125191 | 3300023116 | Salt Marsh | QNGHLKLNEDWKDYVSIIAFLIIVLGGLVLLGSCV |
| (restricted) Ga0233444_103463612 | 3300024264 | Seawater | MNEDLKDYLTIIAFLVIVLGGLVLFGSCDGGWSVAGYEV |
| Ga0209992_101394823 | 3300024344 | Deep Subsurface | VNEDLKDYISIVVFLILVLGGLILIGSCDGGWSVAGYEV |
| Ga0208667_10083089 | 3300025070 | Marine | MNEDLKDYLTIIAFLVIILGGLVLLGSCDGGWSVAGYEV |
| Ga0207896_10065553 | 3300025071 | Marine | MSEDLKDYLTIIGFLVIILGGLVFFGSCDSGWSVSGYEV |
| Ga0208298_10801602 | 3300025084 | Marine | VSDDLKDYITIIAFLVIVLGGLVLLGSCDNGWSVVGYEV |
| Ga0208794_10031911 | 3300025093 | Marine | MNEDIKDVIKVIAFITVILGGLVLLGSCDSGWSVAGWEV |
| Ga0208794_100322910 | 3300025093 | Marine | MSEDIKDVIKVIAFITVILGGLVLLGSCDSGWSVAGWEV |
| Ga0208794_10199121 | 3300025093 | Marine | MFLKKMMSEDIKDVIKVIAFITVILGGLVLLGSCDSGWS |
| Ga0208434_10963262 | 3300025098 | Marine | GLVNEDWKDYVSIMAFLFIVLGGLILIGSCDSGWSIAGYEV |
| Ga0208669_10003333 | 3300025099 | Marine | MNGLVNDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSVVGYEV |
| Ga0208669_10045119 | 3300025099 | Marine | VSDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSVVGYEV |
| Ga0208669_10801742 | 3300025099 | Marine | MNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDSGWSVVGYEV |
| Ga0208159_10066525 | 3300025101 | Marine | VDGIVNEDLKDYISIIVFLIVVLGGLVLIGSCDGGWSIAGYEV |
| Ga0208158_10363522 | 3300025110 | Marine | MNGLVSDDLKDYITIIAFLVIVLGGLVLLGSCDNGWSVVGYEV |
| Ga0209535_10973022 | 3300025120 | Marine | MNEDLKDYLTIIAFLVIVLGGLVLLGSCDGGWSVVGYEV |
| Ga0209232_100223216 | 3300025132 | Marine | MNEDWKDYVSIIAFLFIVLGGLVLIGSCDSGWSIAGYEV |
| Ga0209336_100611985 | 3300025137 | Marine | LKDYLTIIAFLVIVLGGLVFFGSCDGGWSVAGYEV |
| Ga0209645_10011515 | 3300025151 | Marine | MNEDWKDYVTIIAFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0209645_10163264 | 3300025151 | Marine | MNEDFTDYIKILVFLVLVLGGLVFFGSCDAGWSIAGYEV |
| Ga0209645_11587493 | 3300025151 | Marine | MNEDWTDYLKILIFLALVLGGLVFFGSCDGGWSIAGHEI |
| Ga0209337_10003311 | 3300025168 | Marine | MNEDLKDYLSIIAFLIVVLGGLVLIGSCDGGWSVAGYEV |
| Ga0209337_10264689 | 3300025168 | Marine | MSEDLKDIIKVVVFLVVILGGLVLVGSCNSGWSVAGYEI |
| Ga0208148_10303013 | 3300025508 | Aqueous | MNEDLKDYLTIIAFLVIVLGGLVLFGSCDSGWSVSGYEV |
| Ga0208148_10484691 | 3300025508 | Aqueous | SDDLKDYITIIAFLVIVLGGLVLLGSCDNGWSVVGYEV |
| Ga0209094_10848282 | 3300025594 | Pelagic Marine | MNEDLKDYIAIIAFLVIVLGGLVLLGSCDGGWSVAGYEV |
| Ga0208149_10770461 | 3300025610 | Aqueous | MNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIA |
| Ga0208004_11102722 | 3300025630 | Aqueous | VNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0208899_10460443 | 3300025759 | Aqueous | MSGLVNEDWKDYATILAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0208899_11343962 | 3300025759 | Aqueous | VSDDLKDYITIIAFLVIVLGGLVLLGSCDGGWSVAGYEV |
| Ga0208767_11649751 | 3300025769 | Aqueous | KLNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0208767_11654351 | 3300025769 | Aqueous | MSGLVNEDWKDYLSIIAFLVIVLGGLVLLGSCDAGWSVAGYE |
| Ga0208767_12049483 | 3300025769 | Aqueous | MQEDWTDYLKIILFLLFVLGGLVFLGSCDSGWSISG |
| Ga0208425_10836443 | 3300025803 | Aqueous | KHRRFLQVLQAMNEDWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0208645_10392606 | 3300025853 | Aqueous | MNEDWKDYVTIIAFLIIVLGGLILLGSCDGGWSIAGYEV |
| Ga0208644_11445593 | 3300025889 | Aqueous | MNGLVNEDWKDYVSIIAFLVIVLGGLVLLGSCDAGWSVAGYEV |
| Ga0208644_11577171 | 3300025889 | Aqueous | MQEDWTDYLKIILFLLFVLGGLVFLGSCDSGWSIS |
| Ga0209503_102350133 | 3300027859 | Marine | VNEDLKDYISIIVFLIVVLGGLVLIGSCDGGWSIAGYEV |
| Ga0209404_103520613 | 3300027906 | Marine | MNEDWKDYLSIILFLFIVLGGLIILGSCDSGWSIAGYEV |
| Ga0183683_10159945 | 3300029309 | Marine | MNEDWKDYVSILAFLFIVLGGLVLLGSCDGGWSIAGYEV |
| Ga0183755_10189968 | 3300029448 | Marine | MNEDWKDYISIVVFLIIVLGGLILIGSCDSGWSVAGYEV |
| Ga0183757_100095821 | 3300029787 | Marine | MNEDYTDYIKIIIFLFLVLGTLVFLGSCDGGWSVAGYDIDKV |
| Ga0183826_10530322 | 3300029792 | Marine | MSGLVNEDWKDYLSIILFLIVILGGLIILGSCDSGWSVAGYEV |
| Ga0315315_103219433 | 3300032073 | Seawater | VSEDWKDYISIIAFLFIVLGGLILIGSCDSGWSVAGYEV |
| Ga0316208_10538191 | 3300032254 | Microbial Mat | CLVDGIMSEDLKDYITIIGFLVIVLGGLVFFGSCDSGWSVAGYEV |
| Ga0348336_001743_16602_16721 | 3300034375 | Aqueous | MNEDWKDYITIIAFLIIVLGGLVLLGSCDGGWSIAGYEV |
| ⦗Top⦘ |