


| Basic Information | |
|---|---|
| Family ID | F023938 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRNRFEIGLYELALVACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.59 % |
| % of genes near scaffold ends (potentially truncated) | 18.75 % |
| % of genes from short scaffolds (< 2000 bps) | 73.08 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.365 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.05% β-sheet: 0.00% Coil/Unstructured: 53.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 47.12 |
| PF01895 | PhoU | 13.94 |
| PF00005 | ABC_tran | 3.85 |
| PF02563 | Poly_export | 3.85 |
| PF00291 | PALP | 2.88 |
| PF00072 | Response_reg | 1.44 |
| PF00294 | PfkB | 1.44 |
| PF00528 | BPD_transp_1 | 1.44 |
| PF02518 | HATPase_c | 1.44 |
| PF01556 | DnaJ_C | 0.96 |
| PF00106 | adh_short | 0.48 |
| PF13561 | adh_short_C2 | 0.48 |
| PF03449 | GreA_GreB_N | 0.48 |
| PF01546 | Peptidase_M20 | 0.48 |
| PF00909 | Ammonium_transp | 0.48 |
| PF01494 | FAD_binding_3 | 0.48 |
| PF04972 | BON | 0.48 |
| PF03886 | ABC_trans_aux | 0.48 |
| PF01717 | Meth_synt_2 | 0.48 |
| PF02668 | TauD | 0.48 |
| PF13650 | Asp_protease_2 | 0.48 |
| PF12849 | PBP_like_2 | 0.48 |
| PF01266 | DAO | 0.48 |
| PF01370 | Epimerase | 0.48 |
| PF01039 | Carboxyl_trans | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 3.85 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.96 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.48 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.48 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.48 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.48 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.48 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.48 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.48 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.48 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.37 % |
| Unclassified | root | N/A | 21.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100174170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2035 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100221712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101168858 | Not Available | 658 | Open in IMG/M |
| 3300004067|Ga0055485_10200437 | Not Available | 567 | Open in IMG/M |
| 3300004080|Ga0062385_10176099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1131 | Open in IMG/M |
| 3300004081|Ga0063454_100180129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1169 | Open in IMG/M |
| 3300004091|Ga0062387_101377868 | Not Available | 560 | Open in IMG/M |
| 3300004114|Ga0062593_102437284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 591 | Open in IMG/M |
| 3300004157|Ga0062590_101827176 | Not Available | 624 | Open in IMG/M |
| 3300004463|Ga0063356_106224222 | Not Available | 511 | Open in IMG/M |
| 3300005171|Ga0066677_10167356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1213 | Open in IMG/M |
| 3300005171|Ga0066677_10492601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300005175|Ga0066673_10034184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2467 | Open in IMG/M |
| 3300005178|Ga0066688_10899996 | Not Available | 546 | Open in IMG/M |
| 3300005179|Ga0066684_10069334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2081 | Open in IMG/M |
| 3300005179|Ga0066684_10871925 | Not Available | 590 | Open in IMG/M |
| 3300005180|Ga0066685_10981563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300005181|Ga0066678_10464391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300005184|Ga0066671_10614085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 706 | Open in IMG/M |
| 3300005184|Ga0066671_10901218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300005332|Ga0066388_100265891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2356 | Open in IMG/M |
| 3300005332|Ga0066388_105771307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 626 | Open in IMG/M |
| 3300005335|Ga0070666_10205378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1386 | Open in IMG/M |
| 3300005336|Ga0070680_100998618 | Not Available | 723 | Open in IMG/M |
| 3300005336|Ga0070680_101412577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 603 | Open in IMG/M |
| 3300005338|Ga0068868_102065051 | Not Available | 542 | Open in IMG/M |
| 3300005343|Ga0070687_100780711 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005367|Ga0070667_101521043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 629 | Open in IMG/M |
| 3300005434|Ga0070709_10085785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2065 | Open in IMG/M |
| 3300005435|Ga0070714_100042570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3837 | Open in IMG/M |
| 3300005436|Ga0070713_100917130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300005451|Ga0066681_10219283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1144 | Open in IMG/M |
| 3300005451|Ga0066681_10766465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 584 | Open in IMG/M |
| 3300005467|Ga0070706_100101382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2675 | Open in IMG/M |
| 3300005529|Ga0070741_11094948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300005534|Ga0070735_10007619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 8609 | Open in IMG/M |
| 3300005535|Ga0070684_101192998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300005538|Ga0070731_10001372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 25394 | Open in IMG/M |
| 3300005538|Ga0070731_10386484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300005538|Ga0070731_10392189 | Not Available | 923 | Open in IMG/M |
| 3300005541|Ga0070733_10069340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2220 | Open in IMG/M |
| 3300005541|Ga0070733_10394978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 920 | Open in IMG/M |
| 3300005541|Ga0070733_10912447 | Not Available | 590 | Open in IMG/M |
| 3300005544|Ga0070686_100669732 | Not Available | 825 | Open in IMG/M |
| 3300005553|Ga0066695_10843185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300005556|Ga0066707_10795489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300005560|Ga0066670_10231264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1117 | Open in IMG/M |
| 3300005560|Ga0066670_11046796 | Not Available | 500 | Open in IMG/M |
| 3300005574|Ga0066694_10200933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300005575|Ga0066702_10908182 | Not Available | 525 | Open in IMG/M |
| 3300005576|Ga0066708_10100470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1717 | Open in IMG/M |
| 3300005598|Ga0066706_10762981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300005598|Ga0066706_10990831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 648 | Open in IMG/M |
| 3300005614|Ga0068856_102543455 | Not Available | 518 | Open in IMG/M |
| 3300005764|Ga0066903_100941229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1570 | Open in IMG/M |
| 3300005764|Ga0066903_102375468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
| 3300005764|Ga0066903_108044101 | Not Available | 541 | Open in IMG/M |
| 3300005843|Ga0068860_101189320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300005896|Ga0075282_1028737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 743 | Open in IMG/M |
| 3300005902|Ga0075273_10085011 | Not Available | 614 | Open in IMG/M |
| 3300005921|Ga0070766_10000137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 28542 | Open in IMG/M |
| 3300005921|Ga0070766_10572003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300006028|Ga0070717_10187306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1807 | Open in IMG/M |
| 3300006028|Ga0070717_11509669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 609 | Open in IMG/M |
| 3300006031|Ga0066651_10698696 | Not Available | 544 | Open in IMG/M |
| 3300006032|Ga0066696_10170359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1371 | Open in IMG/M |
| 3300006034|Ga0066656_10073776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2022 | Open in IMG/M |
| 3300006046|Ga0066652_100203858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1703 | Open in IMG/M |
| 3300006046|Ga0066652_101909466 | Not Available | 532 | Open in IMG/M |
| 3300006173|Ga0070716_100185895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1369 | Open in IMG/M |
| 3300006175|Ga0070712_101299827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300006176|Ga0070765_100833757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
| 3300006794|Ga0066658_10071292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1557 | Open in IMG/M |
| 3300006797|Ga0066659_10535383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300006871|Ga0075434_101350187 | Not Available | 723 | Open in IMG/M |
| 3300006893|Ga0073928_10000196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 146407 | Open in IMG/M |
| 3300006893|Ga0073928_10000491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 93051 | Open in IMG/M |
| 3300007788|Ga0099795_10002257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4480 | Open in IMG/M |
| 3300007788|Ga0099795_10096595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300007821|Ga0104323_130097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3160 | Open in IMG/M |
| 3300007982|Ga0102924_1004389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 14228 | Open in IMG/M |
| 3300007982|Ga0102924_1090020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1585 | Open in IMG/M |
| 3300009137|Ga0066709_100000597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 20290 | Open in IMG/M |
| 3300009143|Ga0099792_10900061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300009177|Ga0105248_11135086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 883 | Open in IMG/M |
| 3300009792|Ga0126374_11831067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300010046|Ga0126384_10689044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
| 3300010301|Ga0134070_10366910 | Not Available | 561 | Open in IMG/M |
| 3300010320|Ga0134109_10006799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3133 | Open in IMG/M |
| 3300010322|Ga0134084_10133669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
| 3300010337|Ga0134062_10028046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2201 | Open in IMG/M |
| 3300010360|Ga0126372_12069302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 617 | Open in IMG/M |
| 3300010371|Ga0134125_10187023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella | 2307 | Open in IMG/M |
| 3300010373|Ga0134128_12467001 | Not Available | 573 | Open in IMG/M |
| 3300010376|Ga0126381_100013210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 9410 | Open in IMG/M |
| 3300010396|Ga0134126_10075130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4190 | Open in IMG/M |
| 3300010396|Ga0134126_11904079 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300011269|Ga0137392_10059982 | All Organisms → cellular organisms → Bacteria | 2894 | Open in IMG/M |
| 3300011271|Ga0137393_10647514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 906 | Open in IMG/M |
| 3300012010|Ga0120118_1001620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 7974 | Open in IMG/M |
| 3300012181|Ga0153922_1072302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 771 | Open in IMG/M |
| 3300012200|Ga0137382_10191587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1402 | Open in IMG/M |
| 3300012203|Ga0137399_11112972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300012204|Ga0137374_10945559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300012208|Ga0137376_10321192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1344 | Open in IMG/M |
| 3300012211|Ga0137377_10974470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 779 | Open in IMG/M |
| 3300012212|Ga0150985_116667281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300012285|Ga0137370_10247246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1056 | Open in IMG/M |
| 3300012360|Ga0137375_10702490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300012362|Ga0137361_10333849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1390 | Open in IMG/M |
| 3300012362|Ga0137361_11903323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300012469|Ga0150984_112624740 | Not Available | 513 | Open in IMG/M |
| 3300012582|Ga0137358_10395949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300012683|Ga0137398_10554939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300012918|Ga0137396_11047421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012925|Ga0137419_10258658 | Not Available | 1315 | Open in IMG/M |
| 3300012927|Ga0137416_10969357 | Not Available | 758 | Open in IMG/M |
| 3300012930|Ga0137407_10343762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1372 | Open in IMG/M |
| 3300012944|Ga0137410_10709579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 839 | Open in IMG/M |
| 3300012955|Ga0164298_10654565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 730 | Open in IMG/M |
| 3300012989|Ga0164305_11471554 | Not Available | 603 | Open in IMG/M |
| 3300013503|Ga0120127_10171372 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300014487|Ga0182000_10009908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2290 | Open in IMG/M |
| 3300014501|Ga0182024_10160501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3140 | Open in IMG/M |
| 3300014501|Ga0182024_10469698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1608 | Open in IMG/M |
| 3300015245|Ga0137409_10940054 | Not Available | 701 | Open in IMG/M |
| 3300015356|Ga0134073_10404085 | Not Available | 516 | Open in IMG/M |
| 3300015371|Ga0132258_10984889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2130 | Open in IMG/M |
| 3300016294|Ga0182041_12071177 | Not Available | 530 | Open in IMG/M |
| 3300018058|Ga0187766_11127411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 564 | Open in IMG/M |
| 3300018086|Ga0187769_11137596 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300018431|Ga0066655_10357506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300018431|Ga0066655_10782582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300018468|Ga0066662_10476041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1128 | Open in IMG/M |
| 3300018468|Ga0066662_10787351 | Not Available | 921 | Open in IMG/M |
| 3300018468|Ga0066662_11257218 | Not Available | 754 | Open in IMG/M |
| 3300018482|Ga0066669_10004158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 6450 | Open in IMG/M |
| 3300018482|Ga0066669_11622225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300018482|Ga0066669_11666890 | Not Available | 584 | Open in IMG/M |
| 3300019885|Ga0193747_1056399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 974 | Open in IMG/M |
| 3300019888|Ga0193751_1016035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3804 | Open in IMG/M |
| 3300020010|Ga0193749_1060760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300020022|Ga0193733_1207430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300020199|Ga0179592_10324741 | Not Available | 681 | Open in IMG/M |
| 3300020581|Ga0210399_11409881 | Not Available | 544 | Open in IMG/M |
| 3300020583|Ga0210401_10009799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9402 | Open in IMG/M |
| 3300021170|Ga0210400_10002643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 16395 | Open in IMG/M |
| 3300021171|Ga0210405_10492645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 961 | Open in IMG/M |
| 3300021362|Ga0213882_10009329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3521 | Open in IMG/M |
| 3300021420|Ga0210394_11399342 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300021420|Ga0210394_11674960 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021474|Ga0210390_10642126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300021559|Ga0210409_10347539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 1333 | Open in IMG/M |
| 3300021560|Ga0126371_10047039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4116 | Open in IMG/M |
| 3300022557|Ga0212123_10000122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 261799 | Open in IMG/M |
| 3300022557|Ga0212123_10000847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 92339 | Open in IMG/M |
| 3300022557|Ga0212123_10031079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5477 | Open in IMG/M |
| 3300022721|Ga0242666_1069576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
| 3300025898|Ga0207692_11059791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300025910|Ga0207684_10110300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2355 | Open in IMG/M |
| 3300025912|Ga0207707_11071501 | Not Available | 658 | Open in IMG/M |
| 3300025915|Ga0207693_10459246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 995 | Open in IMG/M |
| 3300025922|Ga0207646_10035606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4495 | Open in IMG/M |
| 3300025941|Ga0207711_10974839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 787 | Open in IMG/M |
| 3300026075|Ga0207708_11400710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300026088|Ga0207641_12080384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300026308|Ga0209265_1008009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3291 | Open in IMG/M |
| 3300026310|Ga0209239_1105541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300026312|Ga0209153_1167800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 800 | Open in IMG/M |
| 3300026322|Ga0209687_1022185 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
| 3300026490|Ga0257153_1110959 | Not Available | 541 | Open in IMG/M |
| 3300026530|Ga0209807_1325782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300026530|Ga0209807_1353461 | Not Available | 501 | Open in IMG/M |
| 3300026538|Ga0209056_10676050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300026547|Ga0209156_10206209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300026550|Ga0209474_10015091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 6100 | Open in IMG/M |
| 3300026550|Ga0209474_10067765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2489 | Open in IMG/M |
| 3300026550|Ga0209474_10746744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300026552|Ga0209577_10544092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 744 | Open in IMG/M |
| 3300027388|Ga0208995_1042929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300027645|Ga0209117_1079333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300027706|Ga0209581_1002707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 16377 | Open in IMG/M |
| 3300027738|Ga0208989_10219504 | Not Available | 625 | Open in IMG/M |
| 3300027867|Ga0209167_10612869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300027869|Ga0209579_10000825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 27742 | Open in IMG/M |
| 3300027905|Ga0209415_10005899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 21891 | Open in IMG/M |
| 3300027986|Ga0209168_10021401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3654 | Open in IMG/M |
| 3300028536|Ga0137415_10312665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1375 | Open in IMG/M |
| 3300031234|Ga0302325_10250355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2952 | Open in IMG/M |
| 3300031670|Ga0307374_10012753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 11735 | Open in IMG/M |
| 3300031670|Ga0307374_10242942 | Not Available | 1217 | Open in IMG/M |
| 3300031670|Ga0307374_10264615 | Not Available | 1131 | Open in IMG/M |
| 3300031708|Ga0310686_105873265 | Not Available | 1123 | Open in IMG/M |
| 3300031708|Ga0310686_118903391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2895 | Open in IMG/M |
| 3300031754|Ga0307475_10072694 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300031754|Ga0307475_10082361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2484 | Open in IMG/M |
| 3300031754|Ga0307475_10844249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300031965|Ga0326597_10044369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5593 | Open in IMG/M |
| 3300031965|Ga0326597_10145754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2831 | Open in IMG/M |
| 3300032001|Ga0306922_12161115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 538 | Open in IMG/M |
| 3300032205|Ga0307472_100796118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300032782|Ga0335082_10954898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → unclassified Defluviicoccus → Defluviicoccus sp. | 721 | Open in IMG/M |
| 3300032783|Ga0335079_10889489 | Not Available | 916 | Open in IMG/M |
| 3300032829|Ga0335070_10467939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1198 | Open in IMG/M |
| 3300032892|Ga0335081_10123642 | Not Available | 3774 | Open in IMG/M |
| 3300032892|Ga0335081_12146429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300032896|Ga0335075_10285300 | Not Available | 1862 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.48% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.48% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1001741702 | 3300002245 | Forest Soil | MRNRFEIGLYELALVGCAATLAALVFAEGWIWPLKAVAVLIPVTLLIG* |
| JGIcombinedJ26739_1002217124 | 3300002245 | Forest Soil | MRKHFRIGPHELALAACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG* |
| JGIcombinedJ26739_1011688582 | 3300002245 | Forest Soil | VRNRFEIGLYELALVGCAATLAALVYAEGWIWPLKAVAVIIPVTLLIG* |
| Ga0055485_102004371 | 3300004067 | Natural And Restored Wetlands | MRYRFDISLRVTTLALCTAALAALVYSEGWIWPLKAAAVMIPVSLLIS* |
| Ga0062385_101760993 | 3300004080 | Bog Forest Soil | YRFEISLREATLIVCTGTLAALVYAEGWIWPLKAVAVMIPVSLLIG* |
| Ga0063454_1001801292 | 3300004081 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0062387_1013778681 | 3300004091 | Bog Forest Soil | MRYRFEISLREATLIVCTGTLAALVYAEGWIWPLKAVAVMIPVSLLIS* |
| Ga0062593_1024372841 | 3300004114 | Soil | MRNRFEIGLYELLLVGCATALAMLVYVEGWIWPLKAAAVMIPVSLLIG* |
| Ga0062590_1018271762 | 3300004157 | Soil | MRYRFELGPRHLTLVLCAATLAALVYAEGWTWPLKAAAVIIPLSLLIG* |
| Ga0063356_1062242221 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRHRFQIGPREATLLLCVAALAALVYEEGWIWPLKAAALLIPVSLLIG* |
| Ga0066677_101673562 | 3300005171 | Soil | MLFSGAMRNRFEIGVYELLLLGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0066677_104926012 | 3300005171 | Soil | MHRRFRIGPHQLALAGCLATLAVLVYAEGWIWPLKAAALMIPVTLLIG* |
| Ga0066673_100341844 | 3300005175 | Soil | YELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066688_108999962 | 3300005178 | Soil | FHAISPAMRNRFEIGRYQLALVACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066684_100693342 | 3300005179 | Soil | MRNRFEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066684_108719252 | 3300005179 | Soil | MRNRFEIGLYQLALVACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066685_109815632 | 3300005180 | Soil | MRNRFEIGAYELLLVGCAAALAVLVYAEGWIWPLKAAAIMIPVTVLIG* |
| Ga0066678_104643911 | 3300005181 | Soil | MHRRFRIGPHELVLVACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG* |
| Ga0066671_106140851 | 3300005184 | Soil | MHRRFRIGPYEFALAACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG* |
| Ga0066671_109012182 | 3300005184 | Soil | MRNRFEIGPREAALVLCAAVLAALVYAEGWIWPLEAAAVMIPISLLIS* |
| Ga0066388_1002658912 | 3300005332 | Tropical Forest Soil | MRNRFEIGPYDLLLVGCTAALAALVYVEGWIWPLKAAAVIIPVTLLIG* |
| Ga0066388_1057713072 | 3300005332 | Tropical Forest Soil | RFEIGLYEVLLVGCAAAFAVLVYAEGWIWPLKAAAVMIPVTLLIG* |
| Ga0070666_102053781 | 3300005335 | Switchgrass Rhizosphere | VLCWGMRYRFELGPREATLILCTAALVALVYVEGWIWPLKAAAVMIPLSLAIG* |
| Ga0070680_1009986182 | 3300005336 | Corn Rhizosphere | MRYRFELGPREVTLILCIATMAALVYAEGWIWPLKAAAVMIPLSLLIG* |
| Ga0070680_1014125772 | 3300005336 | Corn Rhizosphere | MRYRFELGLREAALILCAAALVALVYAGGWTWPLKAAAVMIPLSLLIG* |
| Ga0068868_1020650512 | 3300005338 | Miscanthus Rhizosphere | GPREATLILCTAAQVALVYVEGWIWPLKAAAVMIPLSLAIG* |
| Ga0070687_1007807112 | 3300005343 | Switchgrass Rhizosphere | MRYRFELGPREVTLILCIATTAALVYAEGWIWPLKAAAFMIPLSLLIG* |
| Ga0070667_1015210433 | 3300005367 | Switchgrass Rhizosphere | MRYRFELGPREATLILCTAALVALVYVEGWIWPLKAAAVMIPLSL |
| Ga0070709_100857852 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLYELLLVGCATALATLVYVEGWIWPLKAAAVMIPVSLLIG* |
| Ga0070714_1000425703 | 3300005435 | Agricultural Soil | MRRRFEIGPREAALVLCAVLLAALVYAEGWIWPLKAAAVMIPVSLLIS* |
| Ga0070713_1009171302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLYELALVGCVATLATLVFAEGWIWPLKAVAVIIPVTLLIG* |
| Ga0066681_102192831 | 3300005451 | Soil | PRPGFHAISRAMRNRFEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066681_107664652 | 3300005451 | Soil | FYAMRNRFEIGLYELALVACAGTLATLVYAEGWIWPLKAAAIMIPLTLLIG* |
| Ga0070706_1001013822 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLHELALVACAATLATLVYAEGWIWPLKAAAVMIPLTLLIG* |
| Ga0070741_110949482 | 3300005529 | Surface Soil | MRKRLEIGPREAALLVCAIALVALVYAEGWTWPLKVAAVVLPISLLVG* |
| Ga0070735_100076194 | 3300005534 | Surface Soil | MQLPTLPIGRRQAALVACTAVLLALVYAEGWIWPLKAAAVVIPISLLAG* |
| Ga0070684_1011929982 | 3300005535 | Corn Rhizosphere | MRYRFELGPREATLILCTATLAALVYAEGWIWPLKAAAVMIPLSLVIG* |
| Ga0070731_100013726 | 3300005538 | Surface Soil | MRYRFQINPREAALLACSVALATLVYVEGWIWPLKAAAVMIPVSLLIS* |
| Ga0070731_103864842 | 3300005538 | Surface Soil | MRNRFEIQLREAMLILCVAALAVLVYAEGWVWPLKAAA |
| Ga0070731_103921892 | 3300005538 | Surface Soil | MRRRFEIRTREMTLIVCTLALALLVYAEGWIWPLKAAAVLIPVSLMISEDGVV* |
| Ga0070733_100693403 | 3300005541 | Surface Soil | MRHRFEITLTEATLLVCTGTLAALVYAEGWIWPLKVAAAMIPVSLLIG* |
| Ga0070733_103949782 | 3300005541 | Surface Soil | MQYRFEISLREATLILCTAALATLVYTEGWIWPLKAAAVLIPVSLLIS* |
| Ga0070733_109124471 | 3300005541 | Surface Soil | MRKRFELTVYKATLILCTALLGALVYSEGWIWPLKAAAVMIPVSLLIS* |
| Ga0070686_1006697322 | 3300005544 | Switchgrass Rhizosphere | VLCWGMRYRFELGPREATLILCTATLAALVYAEGWIWPLKAAAVMIPLSLVIG* |
| Ga0066695_108431852 | 3300005553 | Soil | MRKGFEFGPHEVILAARVAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066707_107954892 | 3300005556 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVS |
| Ga0066670_102312641 | 3300005560 | Soil | RFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0066670_110467961 | 3300005560 | Soil | MMSQPQPRFHAIFHAMRNRFEIGLYELALFACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066694_102009332 | 3300005574 | Soil | MRNRFEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPLTLLIG* |
| Ga0066702_109081821 | 3300005575 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALAVLVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0066708_101004702 | 3300005576 | Soil | MRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0066706_107629812 | 3300005598 | Soil | MRNRFEIGRYELALVACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066706_109908311 | 3300005598 | Soil | DFMLFSGAMRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0068856_1025434552 | 3300005614 | Corn Rhizosphere | VLPSAMRHQFQVTLHVATLVVCTATLAALVYAEGWIWPLKAAAVLIPVSLLIG* |
| Ga0066903_1009412292 | 3300005764 | Tropical Forest Soil | MRNRFEIGLYEVLLVGCAAAFAVLVYAEGWIWPLKAAAVMIPVTLLIG* |
| Ga0066903_1023754682 | 3300005764 | Tropical Forest Soil | MRNRFRIGPYELALVVCTAALTALVYKEGWIWPLKAAAVMIPVSLLIG* |
| Ga0066903_1080441012 | 3300005764 | Tropical Forest Soil | VRGRCYPAVMDKRFEIGPREAALLLCAVAVAALVYAEGWIWPLKGAAVMIPVALLIG* |
| Ga0068860_1011893202 | 3300005843 | Switchgrass Rhizosphere | MRYRFELGPREATLILCTAALVALVYAEGWIWPLKAAAVMIPLSLVIG* |
| Ga0075282_10287372 | 3300005896 | Rice Paddy Soil | MRSRFELTIYKATLVLCAVLLAALVYGEGWIWPLKAAAVMIPVSLLIS* |
| Ga0075273_100850112 | 3300005902 | Rice Paddy Soil | MRRRFEIRPRDTMLMLCCAALAVLVYSEGWIWSLKVAAVMIPVSLLMS* |
| Ga0070766_100001375 | 3300005921 | Soil | MGKRFEIGPREAALVLCAVVLAVLVYTQGWIWPLKAAAVMIPVSLLFS* |
| Ga0070766_105720031 | 3300005921 | Soil | MRKHFRIGPHELVLAACLATLAVLVYAEGWIWPLKAAALMIPV |
| Ga0070717_101873062 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPERANLADMRNRFEIGPREAALVLCAVLLVALVYEEGWIWPLKAAAVMIPVSLLIS* |
| Ga0070717_115096692 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLYELLLVGCATALATLVYVEGWIWPLKAAAVIMPVSLLIG* |
| Ga0066651_106986962 | 3300006031 | Soil | GFHAISRAMRNRFEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066696_101703591 | 3300006032 | Soil | MRNRFEIGAYELLLVGCAAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0066656_100737762 | 3300006034 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALVALVYTEGWIWPLKAAAVIIPVSLLIG* |
| Ga0066652_1002038583 | 3300006046 | Soil | MRNRFEIGLYELALVACAVTLATLVYAEGWIWPLKAATIMIPVGLLIG* |
| Ga0066652_1019094662 | 3300006046 | Soil | MRNRFEIGLYELELVACAGTLATLVYAEGWIWPLKAAAIMIPLTLLIG* |
| Ga0070716_1001858952 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLYELLLVGCAAMLATLVYVEGWIWPLKAAAVMIPVSLLIG* |
| Ga0070712_1012998272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGAYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0070765_1008337572 | 3300006176 | Soil | MRKHFRIGPHELVLAACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG* |
| Ga0066658_100712923 | 3300006794 | Soil | MLFSGAMRNRFEIGVYELLLVGCAPALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0066659_105353831 | 3300006797 | Soil | MRNRFEIGSYEVALVACAATLAALVYAEGWIWPLKAVA |
| Ga0075434_1013501871 | 3300006871 | Populus Rhizosphere | MRNRFEIGLYELLLVGCATALAMLVYVEGWIWPLKAAAVMIPVSLLIG |
| Ga0073928_1000019696 | 3300006893 | Iron-Sulfur Acid Spring | VRYRFQISLREATLIVCAGALAVLVYAEGWIWPLKAAAVMIPVSLLIT* |
| Ga0073928_1000049172 | 3300006893 | Iron-Sulfur Acid Spring | MRNRFEIGPYELMLVGCAGALAALVYAEGWIWPLKAAAVMIPVTLLIG* |
| Ga0099795_100022572 | 3300007788 | Vadose Zone Soil | MRNRFEIGLHELALVGCAATLAALVYAEGWIWPLKAVAVLIPVTLLLV* |
| Ga0099795_100965952 | 3300007788 | Vadose Zone Soil | MMSRPQPRFHAIFDAMRNRFEIGPYEVALVACAATLAALVYAEGWIWPLKTVAIMIPVTLLIG* |
| Ga0104323_1300972 | 3300007821 | Soil | MRYRFEISLHEATLILCAALLAALVYGEGWIWSLKAAAVMIPVSLLIS* |
| Ga0102924_10043897 | 3300007982 | Iron-Sulfur Acid Spring | MQLPTLPIGRRQAALVACTAVLLVLVYAEGWIWPLKAAAVVIPISLLAG* |
| Ga0102924_10900202 | 3300007982 | Iron-Sulfur Acid Spring | MRHRLQIGPRDAALVLCTLALVALVYSEGWIWPLKAAALIIPLSLLVG* |
| Ga0066709_10000059712 | 3300009137 | Grasslands Soil | MRNRFEIGLYELALVACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0099792_109000612 | 3300009143 | Vadose Zone Soil | MRNRFEIGPYEVALVACAATLAALVYAEGWIWPLKAVAIMIPVTLLIG* |
| Ga0105248_111350862 | 3300009177 | Switchgrass Rhizosphere | MRYRFELGPREATLILCTAALVALVYVEGWIWPLKAAAVMIPLSLAIG* |
| Ga0126374_118310672 | 3300009792 | Tropical Forest Soil | MRNRFEIGPYELLLVGCTAALAALVYIEGWIWPLKAAAVIIPVTLLIG* |
| Ga0126384_106890442 | 3300010046 | Tropical Forest Soil | MRNRFEIGPYELLLVGCTAALAALVYVEGWIWPLKAAAVIIPVTLLIG* |
| Ga0134070_103669102 | 3300010301 | Grasslands Soil | MRNRFEIGVYELLLVGCAAALATLVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0134109_100067991 | 3300010320 | Grasslands Soil | MRKRFEFGPHVVVLAACLAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0134084_101336692 | 3300010322 | Grasslands Soil | MLFSGAMRNRFEIGAYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0134062_100280462 | 3300010337 | Grasslands Soil | MLFSGAMRNRFEIGVYEPLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0126372_114087351 | 3300010360 | Tropical Forest Soil | PDPMRRRMDISPYDAALIVCAVSLLALVYAEGWIWPLKAAAVMIPVTLLIG* |
| Ga0126372_120693021 | 3300010360 | Tropical Forest Soil | IVRGRCYPSVMDKRFEIGPREAALLLCAVAVAALVYAEGWIWPLKGAAMMIPVALLIG* |
| Ga0134125_101870232 | 3300010371 | Terrestrial Soil | VRQRIEIHAFEAALVLCAVALVALVYAEGWIWPLKAAAVVLPLTLLVS* |
| Ga0134128_124670011 | 3300010373 | Terrestrial Soil | MKRRIAIRAFEAALVLCAVALVALVYTEGWIWPLKAAAVVLPITLLVS* |
| Ga0126381_1000132109 | 3300010376 | Tropical Forest Soil | MRNCFEIGPYELLLVGCTAALAALVYIEGWIWPLKAAAVMIPVTLLIG* |
| Ga0134126_100751303 | 3300010396 | Terrestrial Soil | MRSRIEIHAFEAALVLCAVALVALVYTEGWIWPLKAAAVVLPITLLVG* |
| Ga0134126_119040792 | 3300010396 | Terrestrial Soil | MRNRFKIGLYELALVACAATLATLVYAEGWIWPLKAAALMIPLTLLVS* |
| Ga0137392_100599824 | 3300011269 | Vadose Zone Soil | MRKHFQIGPLELALAACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG* |
| Ga0137393_106475142 | 3300011271 | Vadose Zone Soil | MRKHFQIGPLELALAACLATLAVLVYTEGWIWPLKAAALMIPVTLLIG* |
| Ga0120118_100162010 | 3300012010 | Permafrost | MQHRFEISWHVVTVAVCAVTLAVLVNAEGWIWPLQAAALLIPVSLLIG* |
| Ga0153922_10723021 | 3300012181 | Attine Ant Fungus Gardens | MGKRFEIDPREAALVLCAVVLAVLVYTQGWIWPLKAAAVMIPVSLLFS* |
| Ga0137382_101915872 | 3300012200 | Vadose Zone Soil | MRKRFEFGPHEVILAACLAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137399_111129722 | 3300012203 | Vadose Zone Soil | MRKRFEFGPHEVVLAACLAALAVLVYAEGWIWPLKAA |
| Ga0137374_109455592 | 3300012204 | Vadose Zone Soil | MRKRFEFGPHEVALAACVAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137376_103211923 | 3300012208 | Vadose Zone Soil | MRKRFEFGPHEVVLAACVAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137377_109744702 | 3300012211 | Vadose Zone Soil | MRNRFEIGVYEPLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG* |
| Ga0150985_1166672812 | 3300012212 | Avena Fatua Rhizosphere | MRNRFEIGLYELALVACAGTLATLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137370_102472463 | 3300012285 | Vadose Zone Soil | FHTMRNRFEIGPYEVALVACAATLAALVYAEGWIWPLKAVAIMIPVTLLIR* |
| Ga0137375_107024902 | 3300012360 | Vadose Zone Soil | MRQRFEISPHVVSLLVCTATLAALVYAEGWIWPLQAAAVLIPVSLLIG* |
| Ga0137361_103338491 | 3300012362 | Vadose Zone Soil | MRKRFEFGPHEVILAACRAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137361_119033231 | 3300012362 | Vadose Zone Soil | MRKRFEFGPHEVILAACLAALAVLVYAEGWIWPLKA |
| Ga0150984_1126247401 | 3300012469 | Avena Fatua Rhizosphere | PAAPACYAAGMRYRFELGPRHLMLVLCAATLAALVYAEGWTWPLKAAAVIIPLSLLIG* |
| Ga0137358_103959492 | 3300012582 | Vadose Zone Soil | MRKRFEFGPHEVVLAACLAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137398_105549392 | 3300012683 | Vadose Zone Soil | MMSRPQPRFHAIFDAMRNRFEIGPYEVALVACAATLAALVYAEGWIWPLKAVAVLIPVTLLLV* |
| Ga0137396_110474212 | 3300012918 | Vadose Zone Soil | MRKRFEFGPHEVVLAACLAALAVLVYAEGWIWPLKAAAIMI |
| Ga0137419_102586582 | 3300012925 | Vadose Zone Soil | MRKHFQIGPHELVLAACLATLAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137416_109693572 | 3300012927 | Vadose Zone Soil | MHRRFRIGPHELVLAACVATLVVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0137407_103437621 | 3300012930 | Vadose Zone Soil | MFRKQLPIGSREIALIVCTVALVALVYSEGWTWPLKAAAVMIPISLLIG* |
| Ga0137410_107095792 | 3300012944 | Vadose Zone Soil | MRQRFEITPHVATLLVCTATLAALVYAEGWIWPLKAVAVLIPVTLLLV* |
| Ga0164298_106545652 | 3300012955 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALVALVYTEGWIWPLKAAAVIIPVSVLIG* |
| Ga0164305_114715542 | 3300012989 | Soil | MRNRFKIGLYELALVACAATLATLVYAEGWIWPLKAAAVMIPLSLVIG* |
| Ga0120127_101713722 | 3300013503 | Permafrost | MRYRFDISLHVTTLVACAAVLAVLVYAEGWTWPLQAAAVLIPVSLLIG* |
| Ga0182000_100099082 | 3300014487 | Soil | MRNRFEIGLYELLLVGCATALAKLVYVEGWIWPLKAAAVIIPVSLLIG* |
| Ga0182024_101605013 | 3300014501 | Permafrost | MRRRLELRLHEATVVVCAVTLVALIYAEGWIWPLQAAAVVLPITLLVG* |
| Ga0182024_104696982 | 3300014501 | Permafrost | MRHRFEIGLHEAALVFCAVALLALVYAEGWIWPLKAAAVVLPISLLIG* |
| Ga0137409_109400542 | 3300015245 | Vadose Zone Soil | ISSAMRNRFEIGLHELALVGCAATLAALVYAEGWIWPLKAVAVLIPVTLLLV* |
| Ga0134073_104040851 | 3300015356 | Grasslands Soil | AAMRNRFEIGAYELLLVGCAAALAVLVYAEGWIWPLKAAAIMIPVTLLIG* |
| Ga0132258_109848893 | 3300015371 | Arabidopsis Rhizosphere | MRNRFQIGLYELALVVCAVTLATLVYAEGWIWSLKAAAIMIPVGLLIG* |
| Ga0182041_120711771 | 3300016294 | Soil | IARHMQRPVIPIGPRQAMLVACTVVLVALVYAEGWIWPLKAAAVVIPITLLAG |
| Ga0187766_111274112 | 3300018058 | Tropical Peatland | RFEINPHQAALLVCIALLGVLVHGEGWIWPLKAAAVMIPVTLLIG |
| Ga0187769_111375962 | 3300018086 | Tropical Peatland | MPHRFEISPYSATLVLCTVLLVTLVYDEGWIWPLKAAAVMIPVSLLLG |
| Ga0066655_103575061 | 3300018431 | Grasslands Soil | MRNRFEIGVYELLLLGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0066655_107825822 | 3300018431 | Grasslands Soil | MRNRFEIGLYELALVACAATLAALVYAEGWIWPLKAAAIMIPVTLLIG |
| Ga0066662_104760413 | 3300018468 | Grasslands Soil | DFMLFSGAMRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0066662_107873512 | 3300018468 | Grasslands Soil | MRRRFEIGPREAALVLCALVLAALVYAEGWIWPLKAAAVMIPVSLLIS |
| Ga0066662_112572182 | 3300018468 | Grasslands Soil | MRRHFRIGPYEFALAACLATLAVLVYAEGWIWPLKAAALMIPVTLVIG |
| Ga0066669_100041584 | 3300018482 | Grasslands Soil | MRNRFEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG |
| Ga0066669_116222252 | 3300018482 | Grasslands Soil | MRNRFEIGLYQLALVACAATLAALVYAEGWIWPLKAAASMIPVTLLIG |
| Ga0066669_116668902 | 3300018482 | Grasslands Soil | MRNRFEIGPYEVALVACAATLAALVYAEGWIWPLKAVAIMIPVTLLIG |
| Ga0193747_10563992 | 3300019885 | Soil | MRNRFEIGAHELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0193751_10160354 | 3300019888 | Soil | MLFSRAMRNRFKIGLYELSLAGCAVALAALVYAEGWIWPLKAAAVMIPMTLLIG |
| Ga0193749_10607602 | 3300020010 | Soil | MRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0193733_12074302 | 3300020022 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0179592_103247412 | 3300020199 | Vadose Zone Soil | MRNRFEIGLHELALVGCAATLAALVYAEGWIWPLKAVAVLIPVTLLLV |
| Ga0210399_114098811 | 3300020581 | Soil | MHRNFRIGPHELALAACLATLAVLVYAEGWIWPLKAAAVMIPVTLLIG |
| Ga0210401_100097997 | 3300020583 | Soil | MRKHFRIGPHELVLAACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG |
| Ga0210400_100026432 | 3300021170 | Soil | MRNRFEIGLYELALVGCAATLAVLVFAEGWIWPLKAVAVLIPVTLLIG |
| Ga0210405_104926451 | 3300021171 | Soil | MRKHFRIGPHELALAACLATLAVLVYAEGWIWPLKAAALMIPVTLLIG |
| Ga0213882_100093293 | 3300021362 | Exposed Rock | MRNRLEIGLYEVMLVGCAAALAALVYAEGWIWPLKAAAVMIPMGLLIG |
| Ga0210394_113993422 | 3300021420 | Soil | MVPAAVRLRPVMVEYVMRFRFEIHAREAALVLCALALAALVYTEGWIWPLKAAAVMIPVSLLIT |
| Ga0210394_116749602 | 3300021420 | Soil | VRYRFEFQMREAALLVCILALAALVYAEGWIWPLKAAAVMIPVSLLIS |
| Ga0210390_106421262 | 3300021474 | Soil | MRFRFEMHAREAALILCALALAALVYTEGWIWPLKAAAVMIPVSLLIT |
| Ga0210409_103475392 | 3300021559 | Soil | MRYRFQISLREATLIVCAGALTVLVYAEGWIWPLKAAAVMIPVSLLIT |
| Ga0126371_100470392 | 3300021560 | Tropical Forest Soil | MRNRFEIGPYELLLVGCTAALAALVYVEGWIWPLKAAAVIIPVTLLIG |
| Ga0212123_1000012297 | 3300022557 | Iron-Sulfur Acid Spring | VRYRFQISLREATLIVCAGALAVLVYAEGWIWPLKAAAVMIPVSLLIT |
| Ga0212123_1000084771 | 3300022557 | Iron-Sulfur Acid Spring | MRNRFEIGPYELMLVGCAGALAALVYAEGWIWPLKAAAVMIPVTLLIG |
| Ga0212123_100310794 | 3300022557 | Iron-Sulfur Acid Spring | MQLPTLPIGRRQAALVACTAVLLVLVYAEGWIWPLKAAAVVIPISLLAG |
| Ga0242666_10695762 | 3300022721 | Soil | MVEYVMRFRFEIHAREAALVLCALALAALVYTEGWIWPLKAAAVMIPVSLLIT |
| Ga0207692_110597911 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLYELLLVGCATALATLVYVEGWIWPLKAAAVIMP |
| Ga0207684_101103002 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLHELALVACAATLATLVYAEGWIWPLKAAAVMIPLTLLIG |
| Ga0207707_110715012 | 3300025912 | Corn Rhizosphere | MRYRFELGLREAALILCAAALVALVYAGGWTWPLKAAAVMIPLSLLIG |
| Ga0207693_104592462 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGAYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0207646_100356063 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRFEIGLHELALVACVATLATLVYAEGWIWPLKAAAVMIPLTLLIG |
| Ga0207711_109748392 | 3300025941 | Switchgrass Rhizosphere | VLCWGMRYRFELGPREATLILCTAALVALVYVEGWIWPLKAAAVMIPLSLAIG |
| Ga0207708_114007102 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYRFELGPREATLILCTAALVPLVYVEGWIWPLKAAAVMIPLSLAIG |
| Ga0207641_120803841 | 3300026088 | Switchgrass Rhizosphere | MRNRFEIGLYELLLVGCATALATLVYVEGWIWRLKAAAVMIPVS |
| Ga0209265_10080091 | 3300026308 | Soil | MLFSGAMRNRFEIGVYELLLVGCAAALAALVYTEGWIWPLKAAAVIIPVSLLIG |
| Ga0209239_11055411 | 3300026310 | Grasslands Soil | MRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVS |
| Ga0209153_11678002 | 3300026312 | Soil | GFHAISRAMRNRFEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG |
| Ga0209687_10221851 | 3300026322 | Soil | MRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVI |
| Ga0257153_11109592 | 3300026490 | Soil | VRNRFEIGLYELALIGCAATLAALVYAEGWIWPLKAVAVLIPVTLLIG |
| Ga0209807_13257822 | 3300026530 | Soil | MLFSGAMRNRFEIGVYELLLLGCAAALAALVYAEGWIWPLKAAAVIIPVSLLI |
| Ga0209807_13534612 | 3300026530 | Soil | FEIGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG |
| Ga0209056_106760501 | 3300026538 | Soil | MRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAV |
| Ga0209156_102062092 | 3300026547 | Soil | MRNRFETGPYELVVVACAATLLALVYAEGWIWPLKAAAIMIPVTLLIG |
| Ga0209474_100150917 | 3300026550 | Soil | MRNRFEIGVNELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0209474_100677653 | 3300026550 | Soil | MRNRFEIGAYELLLVGCAAALAVLVYAEGWIWPLKAAAIMIPVTLLIG |
| Ga0209474_107467442 | 3300026550 | Soil | MRNRFEIGAYELLLVGCAAALAALVYTEGWIWPLKAAAVIIPVSLL |
| Ga0209577_105440922 | 3300026552 | Soil | RNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPVSLLIG |
| Ga0208995_10429292 | 3300027388 | Forest Soil | MRNRFEIGLHELALVGCAATLAALVYAEGWIWPLKAVAVLIPVT |
| Ga0209117_10793331 | 3300027645 | Forest Soil | MRNRFEIGPYELALVGCAVTLAALVYAEGWIWPLKAVAVLIPVTLLLSGA |
| Ga0209581_100270711 | 3300027706 | Surface Soil | MRKRLEIGPREAALLVCAIALVALVYAEGWTWPLKVAAVVLPISLLVG |
| Ga0208989_102195042 | 3300027738 | Forest Soil | MRNRFEIGVYELLLVGCAAALAALVYAEGWIWPLKAAAVIIPV |
| Ga0209167_106128692 | 3300027867 | Surface Soil | MRHRFEITLTEATLLVCTGTLAALVYAEGWIWPLKVAAAMIPVSLLIG |
| Ga0209579_1000082522 | 3300027869 | Surface Soil | MRYRFQINPREAALLACSVALATLVYVEGWIWPLKAAAVMIPVSLLIS |
| Ga0209415_100058993 | 3300027905 | Peatlands Soil | MRYRFEITLVEATLLVCTGTLAALVYAEGWIWPLKAAAVMIPVSLLIG |
| Ga0209168_100214012 | 3300027986 | Surface Soil | MQLPTLPIGRRQAALVACTAVLLALVYAEGWIWPLKAAAVVIPISLLAG |
| Ga0137415_103126652 | 3300028536 | Vadose Zone Soil | MHRRFRIGPHELVLAACVATLVVLVYAEGWIWPLKAAALMIPVTLLIG |
| Ga0302325_102503553 | 3300031234 | Palsa | MLKSGMRHRFELHLRETTLVVCTLTLAGLVYAEGWIWPLKAAAVMIPVSLLIG |
| Ga0307374_100127539 | 3300031670 | Soil | MRQRFEIHLREATLIACTVALAALVYAEGWIWPLKAVAVIIPVSLLIS |
| Ga0307374_102429422 | 3300031670 | Soil | MRHRFEINPREATLIACTGALAALVYLEGWIWPLKAVALMIPVSLLIS |
| Ga0307374_102646152 | 3300031670 | Soil | MRHRFEIRPHDAALVLCAAALVVLVYAEGWIWPLKAAAVVLPISLLVG |
| Ga0310686_1058732652 | 3300031708 | Soil | MRRRLELRLHEAIVVVCAVTLVALIYAEGWIWPLQAAAVVLPITLLVG |
| Ga0310686_1189033912 | 3300031708 | Soil | MRRRVEIHAFEAALVLCAVALVALVYTEGWIWPLKAAALMLPITLLVS |
| Ga0307475_100726943 | 3300031754 | Hardwood Forest Soil | MLFSRAMRNRFKIGLYELSLAGCAAALAALVYAEGWIWPLKAAAVMIPVTLLIG |
| Ga0307475_100823612 | 3300031754 | Hardwood Forest Soil | MQRPIVPIGPREAMLVACTVALVVLVYAEGWIWPLKAAAVVIPISLLAG |
| Ga0307475_108442492 | 3300031754 | Hardwood Forest Soil | MLPERANLADMRNRFEIGPREAALVLCAVLLVALVYEEGWIWPLKAAAVMIPVSLLIS |
| Ga0326597_100443696 | 3300031965 | Soil | MRHRFEITLRETALILCTAVLAVLVYSEGWIWPLKAAALMIPISLLIG |
| Ga0326597_101457542 | 3300031965 | Soil | MRQRFEISLHAAALIVCTATLAALVYAEGWIWPLQAAAVLIPIALLIG |
| Ga0306922_121611152 | 3300032001 | Soil | MQRPVIPIGPRQAMLVACTVVLVALVCAEGWIWPLKAAAVVIPITLLAG |
| Ga0307472_1007961182 | 3300032205 | Hardwood Forest Soil | MRNRFEIGFHELALVACAATLAVLVYAEGWIWPLKAAVIMIPVTLLIG |
| Ga0335082_109548981 | 3300032782 | Soil | MFRKLLPIAPREAALIVCAGALAALVYAEGWIWPLKAAAVMIPITLLIG |
| Ga0335079_108894892 | 3300032783 | Soil | MRHRIEIHAFEAALVLCAVALVALVYSEGWIWPLKAAAVVLPITLLVS |
| Ga0335070_104679392 | 3300032829 | Soil | MRMRKRFEIGPRHAALILCACALVALVYAEGWIWPLKAAAVMIPLTLLVS |
| Ga0335081_101236422 | 3300032892 | Soil | MHHRFRIGRHEVALAVCTVLLAALVYGEGWIWPLKAAALMIPLSLLIS |
| Ga0335081_121464292 | 3300032892 | Soil | MRGRFRIEPRHAALVACALTLVALVYSEGWIWPLKAAAIMIPVSLLAG |
| Ga0335075_102853002 | 3300032896 | Soil | MRRRFEIRPHEMMLVMCCLALAVLVYSEGWIWPLKAAAVIIPVSLLIS |
| ⦗Top⦘ |