


| Basic Information | |
|---|---|
| Family ID | F023870 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNATETPVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.13 % |
| % of genes near scaffold ends (potentially truncated) | 16.83 % |
| % of genes from short scaffolds (< 2000 bps) | 75.48 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.404 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.365 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.019 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF00115 | COX1 | 37.98 |
| PF04442 | CtaG_Cox11 | 37.98 |
| PF00510 | COX3 | 4.33 |
| PF02104 | SURF1 | 2.40 |
| PF01040 | UbiA | 1.92 |
| PF02628 | COX15-CtaA | 1.44 |
| PF06968 | BATS | 0.96 |
| PF00116 | COX2 | 0.96 |
| PF02790 | COX2_TM | 0.96 |
| PF00581 | Rhodanese | 0.48 |
| PF10003 | DUF2244 | 0.48 |
| PF11137 | DUF2909 | 0.48 |
| PF03626 | COX4_pro | 0.48 |
| PF13500 | AAA_26 | 0.48 |
| PF02040 | ArsB | 0.48 |
| PF00271 | Helicase_C | 0.48 |
| PF08340 | DUF1732 | 0.48 |
| PF01799 | Fer2_2 | 0.48 |
| PF01553 | Acyltransferase | 0.48 |
| PF00924 | MS_channel | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 37.98 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 4.33 |
| COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 2.40 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 1.92 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 1.44 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.96 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.48 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.48 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.77 % |
| Unclassified | root | N/A | 19.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10129237 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300001661|JGI12053J15887_10158504 | Not Available | 1183 | Open in IMG/M |
| 3300001661|JGI12053J15887_10418695 | Not Available | 643 | Open in IMG/M |
| 3300001661|JGI12053J15887_10560713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
| 3300002917|JGI25616J43925_10008173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4548 | Open in IMG/M |
| 3300003368|JGI26340J50214_10015742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2357 | Open in IMG/M |
| 3300004080|Ga0062385_10328860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 888 | Open in IMG/M |
| 3300004080|Ga0062385_10486530 | Not Available | 758 | Open in IMG/M |
| 3300004082|Ga0062384_100664884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 713 | Open in IMG/M |
| 3300004091|Ga0062387_100225948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1151 | Open in IMG/M |
| 3300004092|Ga0062389_100795623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1125 | Open in IMG/M |
| 3300004631|Ga0058899_12009524 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Piciformes → Picidae → Dryobates → Dryobates pubescens | 1092 | Open in IMG/M |
| 3300005533|Ga0070734_10000748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 59200 | Open in IMG/M |
| 3300005591|Ga0070761_10385667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 853 | Open in IMG/M |
| 3300006050|Ga0075028_100317923 | Not Available | 872 | Open in IMG/M |
| 3300006059|Ga0075017_100395506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1036 | Open in IMG/M |
| 3300006354|Ga0075021_10913828 | Not Available | 570 | Open in IMG/M |
| 3300006638|Ga0075522_10015081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4988 | Open in IMG/M |
| 3300006893|Ga0073928_10004409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 20879 | Open in IMG/M |
| 3300006893|Ga0073928_10555498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 816 | Open in IMG/M |
| 3300007265|Ga0099794_10137717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1235 | Open in IMG/M |
| 3300007788|Ga0099795_10002294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4462 | Open in IMG/M |
| 3300007788|Ga0099795_10253502 | Not Available | 760 | Open in IMG/M |
| 3300009038|Ga0099829_10129343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1997 | Open in IMG/M |
| 3300009038|Ga0099829_11658450 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009088|Ga0099830_10912893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 726 | Open in IMG/M |
| 3300009089|Ga0099828_10916601 | Not Available | 782 | Open in IMG/M |
| 3300009500|Ga0116229_10007372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 17440 | Open in IMG/M |
| 3300009500|Ga0116229_10029480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 6237 | Open in IMG/M |
| 3300009500|Ga0116229_10114161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2411 | Open in IMG/M |
| 3300009500|Ga0116229_10197706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1732 | Open in IMG/M |
| 3300009500|Ga0116229_10225552 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1603 | Open in IMG/M |
| 3300009500|Ga0116229_10241750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1539 | Open in IMG/M |
| 3300009500|Ga0116229_10336184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1269 | Open in IMG/M |
| 3300009500|Ga0116229_10420687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1113 | Open in IMG/M |
| 3300009500|Ga0116229_10426877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
| 3300009500|Ga0116229_10436392 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300009500|Ga0116229_10590315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 914 | Open in IMG/M |
| 3300009510|Ga0116230_10022252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6155 | Open in IMG/M |
| 3300009627|Ga0116109_1154249 | Not Available | 531 | Open in IMG/M |
| 3300009633|Ga0116129_1002262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9866 | Open in IMG/M |
| 3300009633|Ga0116129_1072292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1026 | Open in IMG/M |
| 3300009709|Ga0116227_10138115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1934 | Open in IMG/M |
| 3300009787|Ga0116226_10150831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2420 | Open in IMG/M |
| 3300009787|Ga0116226_10929860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 842 | Open in IMG/M |
| 3300010860|Ga0126351_1194783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300011120|Ga0150983_11450538 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300011120|Ga0150983_12214061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 610 | Open in IMG/M |
| 3300011269|Ga0137392_10375711 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300011270|Ga0137391_10456522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1086 | Open in IMG/M |
| 3300011270|Ga0137391_10861805 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300011271|Ga0137393_10492766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1051 | Open in IMG/M |
| 3300012096|Ga0137389_11322263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300012189|Ga0137388_11023326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300012202|Ga0137363_11666041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 530 | Open in IMG/M |
| 3300012203|Ga0137399_10437187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1093 | Open in IMG/M |
| 3300012205|Ga0137362_11454882 | Not Available | 572 | Open in IMG/M |
| 3300012209|Ga0137379_11613202 | Not Available | 547 | Open in IMG/M |
| 3300012357|Ga0137384_10031747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4342 | Open in IMG/M |
| 3300012359|Ga0137385_10265288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1484 | Open in IMG/M |
| 3300012359|Ga0137385_10646470 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012359|Ga0137385_10805837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300012363|Ga0137390_10636891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1032 | Open in IMG/M |
| 3300012582|Ga0137358_10003305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9409 | Open in IMG/M |
| 3300012582|Ga0137358_10790669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 631 | Open in IMG/M |
| 3300012683|Ga0137398_10108083 | Not Available | 1759 | Open in IMG/M |
| 3300012683|Ga0137398_10437348 | Not Available | 894 | Open in IMG/M |
| 3300012683|Ga0137398_11030358 | Not Available | 569 | Open in IMG/M |
| 3300012685|Ga0137397_11074229 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012685|Ga0137397_11100801 | Not Available | 579 | Open in IMG/M |
| 3300012917|Ga0137395_10429495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 948 | Open in IMG/M |
| 3300012917|Ga0137395_10553386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 830 | Open in IMG/M |
| 3300012922|Ga0137394_10946684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300012925|Ga0137419_11654019 | Not Available | 545 | Open in IMG/M |
| 3300012927|Ga0137416_10337223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300012927|Ga0137416_11230734 | Not Available | 675 | Open in IMG/M |
| 3300012929|Ga0137404_10016775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 5204 | Open in IMG/M |
| 3300012929|Ga0137404_10146946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1956 | Open in IMG/M |
| 3300013314|Ga0175859_1099329 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1380 | Open in IMG/M |
| 3300014201|Ga0181537_10002142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 17604 | Open in IMG/M |
| 3300014201|Ga0181537_10517824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300014492|Ga0182013_10010128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9796 | Open in IMG/M |
| 3300014495|Ga0182015_10746256 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300014498|Ga0182019_10231682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1208 | Open in IMG/M |
| 3300014501|Ga0182024_10363138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1887 | Open in IMG/M |
| 3300014501|Ga0182024_10862399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1096 | Open in IMG/M |
| 3300014658|Ga0181519_10532184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 724 | Open in IMG/M |
| 3300014838|Ga0182030_10000095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 130374 | Open in IMG/M |
| 3300014838|Ga0182030_10339391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1617 | Open in IMG/M |
| 3300015054|Ga0137420_1317448 | Not Available | 8925 | Open in IMG/M |
| 3300015167|Ga0167661_1092773 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300015193|Ga0167668_1013368 | Not Available | 1850 | Open in IMG/M |
| 3300015193|Ga0167668_1069785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300015242|Ga0137412_10006337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9491 | Open in IMG/M |
| 3300015242|Ga0137412_10019674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5493 | Open in IMG/M |
| 3300015264|Ga0137403_11582383 | Not Available | 508 | Open in IMG/M |
| 3300019786|Ga0182025_1175058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1728 | Open in IMG/M |
| 3300019787|Ga0182031_1383696 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300019887|Ga0193729_1149931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300019887|Ga0193729_1153270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 831 | Open in IMG/M |
| 3300019890|Ga0193728_1366092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 511 | Open in IMG/M |
| 3300020021|Ga0193726_1064112 | Not Available | 1720 | Open in IMG/M |
| 3300020140|Ga0179590_1002389 | Not Available | 3226 | Open in IMG/M |
| 3300020199|Ga0179592_10000032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 64336 | Open in IMG/M |
| 3300020199|Ga0179592_10124633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1182 | Open in IMG/M |
| 3300020199|Ga0179592_10390927 | Not Available | 608 | Open in IMG/M |
| 3300020579|Ga0210407_10031753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3927 | Open in IMG/M |
| 3300020579|Ga0210407_10179700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1639 | Open in IMG/M |
| 3300020579|Ga0210407_10538417 | Not Available | 912 | Open in IMG/M |
| 3300020580|Ga0210403_10093791 | Not Available | 2430 | Open in IMG/M |
| 3300020581|Ga0210399_10490025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1022 | Open in IMG/M |
| 3300020581|Ga0210399_11460081 | Not Available | 532 | Open in IMG/M |
| 3300020583|Ga0210401_10951214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300020583|Ga0210401_11458565 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300021086|Ga0179596_10429080 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300021086|Ga0179596_10500069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300021088|Ga0210404_10615403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 618 | Open in IMG/M |
| 3300021151|Ga0179584_1290002 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300021168|Ga0210406_10080728 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
| 3300021168|Ga0210406_10231941 | Not Available | 1521 | Open in IMG/M |
| 3300021178|Ga0210408_10000665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 40711 | Open in IMG/M |
| 3300021178|Ga0210408_10170256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1729 | Open in IMG/M |
| 3300021407|Ga0210383_10687429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 880 | Open in IMG/M |
| 3300021420|Ga0210394_10046600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3801 | Open in IMG/M |
| 3300021420|Ga0210394_10080070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2823 | Open in IMG/M |
| 3300021432|Ga0210384_11733486 | Not Available | 530 | Open in IMG/M |
| 3300021478|Ga0210402_10032788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4493 | Open in IMG/M |
| 3300021478|Ga0210402_10198727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1842 | Open in IMG/M |
| 3300021479|Ga0210410_10000082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 160836 | Open in IMG/M |
| 3300021479|Ga0210410_11387991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 595 | Open in IMG/M |
| 3300022557|Ga0212123_10015641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9404 | Open in IMG/M |
| 3300022557|Ga0212123_10138229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1903 | Open in IMG/M |
| 3300022726|Ga0242654_10368955 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300023046|Ga0233356_1000768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2481 | Open in IMG/M |
| 3300024220|Ga0224568_1008906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 964 | Open in IMG/M |
| 3300025463|Ga0208193_1001613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9741 | Open in IMG/M |
| 3300025679|Ga0207933_1032807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2015 | Open in IMG/M |
| 3300025862|Ga0209483_1099242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1276 | Open in IMG/M |
| 3300026304|Ga0209240_1102545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1021 | Open in IMG/M |
| 3300026319|Ga0209647_1177373 | Not Available | 821 | Open in IMG/M |
| 3300026482|Ga0257172_1009679 | All Organisms → cellular organisms → Eukaryota | 1566 | Open in IMG/M |
| 3300026555|Ga0179593_1085248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2632 | Open in IMG/M |
| 3300026557|Ga0179587_10123103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1593 | Open in IMG/M |
| 3300026557|Ga0179587_10883592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300027381|Ga0208983_1035715 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 971 | Open in IMG/M |
| 3300027590|Ga0209116_1075723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300027633|Ga0208988_1038345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1231 | Open in IMG/M |
| 3300027651|Ga0209217_1086700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 905 | Open in IMG/M |
| 3300027660|Ga0209736_1106414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300027667|Ga0209009_1025446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1449 | Open in IMG/M |
| 3300027681|Ga0208991_1196975 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027701|Ga0209447_10045981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1205 | Open in IMG/M |
| 3300027727|Ga0209328_10068131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1090 | Open in IMG/M |
| 3300027795|Ga0209139_10050897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1454 | Open in IMG/M |
| 3300027807|Ga0209208_10000168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 73556 | Open in IMG/M |
| 3300027807|Ga0209208_10087716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2212 | Open in IMG/M |
| 3300027807|Ga0209208_10164026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1304 | Open in IMG/M |
| 3300027812|Ga0209656_10014947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4830 | Open in IMG/M |
| 3300027826|Ga0209060_10004905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 10041 | Open in IMG/M |
| 3300027829|Ga0209773_10097217 | Not Available | 1214 | Open in IMG/M |
| 3300027860|Ga0209611_10016198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9569 | Open in IMG/M |
| 3300027860|Ga0209611_10023648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 6793 | Open in IMG/M |
| 3300027860|Ga0209611_10055162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3103 | Open in IMG/M |
| 3300027860|Ga0209611_10088368 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300027860|Ga0209611_10097308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1994 | Open in IMG/M |
| 3300027860|Ga0209611_10185031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1286 | Open in IMG/M |
| 3300027860|Ga0209611_10602000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 606 | Open in IMG/M |
| 3300027862|Ga0209701_10139601 | Not Available | 1487 | Open in IMG/M |
| 3300027867|Ga0209167_10622369 | Not Available | 591 | Open in IMG/M |
| 3300027903|Ga0209488_10131534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1887 | Open in IMG/M |
| 3300028047|Ga0209526_10302252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1082 | Open in IMG/M |
| 3300028536|Ga0137415_10029489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 5405 | Open in IMG/M |
| 3300028536|Ga0137415_10225920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1685 | Open in IMG/M |
| 3300028800|Ga0265338_10370992 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1025 | Open in IMG/M |
| 3300028808|Ga0302228_10297111 | Not Available | 724 | Open in IMG/M |
| 3300029954|Ga0311331_10220416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2130 | Open in IMG/M |
| 3300030007|Ga0311338_10982936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300030580|Ga0311355_11194520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300030626|Ga0210291_11892279 | Not Available | 519 | Open in IMG/M |
| 3300030923|Ga0138296_1605560 | Not Available | 541 | Open in IMG/M |
| 3300031023|Ga0073998_11577279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 895 | Open in IMG/M |
| 3300031047|Ga0073995_12262623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 985 | Open in IMG/M |
| 3300031057|Ga0170834_103632010 | Not Available | 663 | Open in IMG/M |
| 3300031057|Ga0170834_104532873 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031057|Ga0170834_105324503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1366 | Open in IMG/M |
| 3300031128|Ga0170823_12610825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 521 | Open in IMG/M |
| 3300031231|Ga0170824_126011033 | Not Available | 504 | Open in IMG/M |
| 3300031234|Ga0302325_11479201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 877 | Open in IMG/M |
| 3300031234|Ga0302325_13089851 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031236|Ga0302324_102327935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 660 | Open in IMG/M |
| 3300031241|Ga0265325_10171306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1016 | Open in IMG/M |
| 3300031446|Ga0170820_10571201 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031446|Ga0170820_12020735 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031708|Ga0310686_107520716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3255 | Open in IMG/M |
| 3300031708|Ga0310686_112960190 | Not Available | 522 | Open in IMG/M |
| 3300031715|Ga0307476_10606764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 812 | Open in IMG/M |
| 3300031718|Ga0307474_10335904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1168 | Open in IMG/M |
| 3300031718|Ga0307474_11215754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 596 | Open in IMG/M |
| 3300031726|Ga0302321_100965834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 969 | Open in IMG/M |
| 3300031730|Ga0307516_10000060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 118638 | Open in IMG/M |
| 3300031730|Ga0307516_10953997 | Not Available | 527 | Open in IMG/M |
| 3300031753|Ga0307477_10445655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300031962|Ga0307479_10404538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1350 | Open in IMG/M |
| 3300032174|Ga0307470_10003236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6223 | Open in IMG/M |
| 3300032174|Ga0307470_10003549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5980 | Open in IMG/M |
| 3300032180|Ga0307471_100599016 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1261 | Open in IMG/M |
| 3300032180|Ga0307471_103102667 | Not Available | 589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.94% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 12.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.92% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.44% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.44% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.44% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.48% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.48% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.48% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.48% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.48% |
| Moss Associated | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated | 0.48% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013314 | Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101292372 | 3300001593 | Forest Soil | MNDSVRRRIRNGALGLGVLALAFYFGFIVLLVHHGHH* |
| JGI12053J15887_101585043 | 3300001661 | Forest Soil | MNATETPVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH* |
| JGI12053J15887_104186952 | 3300001661 | Forest Soil | MNVTETEVKRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRSHH* |
| JGI12053J15887_105607132 | 3300001661 | Forest Soil | MNATETQGKRRIRNGALGLMCLALVFYFGIIALLIYRSHH* |
| JGI25616J43925_100081737 | 3300002917 | Grasslands Soil | MNATETEVKRPAVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH* |
| JGI26340J50214_100157422 | 3300003368 | Bog Forest Soil | MNAAETRVKRRIRNGALGLMSLALVFYFGIIALLIHRGHH* |
| Ga0062385_103288602 | 3300004080 | Bog Forest Soil | MSAAMSTLRRRIRNSSLGLTALALAFYFGFIALSVLRRH* |
| Ga0062385_104865301 | 3300004080 | Bog Forest Soil | MNPTEPQRKRRIRNGALGLMSLALVFYFGFIALLMHRGHH* |
| Ga0062384_1006648842 | 3300004082 | Bog Forest Soil | MRVAESPVKRPLDRRRIRNGALGLLSVALAFYFGIIAIFIYRSHH* |
| Ga0062387_1002259482 | 3300004091 | Bog Forest Soil | MNATQWQVKRRIRNGALVLMSLALAFYFGFIAILIYRSHH* |
| Ga0062389_1007956232 | 3300004092 | Bog Forest Soil | MNTAEVRVKRRIRNGALGLMSLALAFYFGIIALLIHRGHH* |
| Ga0058899_120095241 | 3300004631 | Forest Soil | MNVTETQGKRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0070734_1000074831 | 3300005533 | Surface Soil | MSVAQSRRRIRQRALLLTAVALGFYVGFIALTIYRSHH* |
| Ga0070761_103856672 | 3300005591 | Soil | MNATEMRVRRRIRNGALGLMTLALAFYFGIIALLIHRGHH* |
| Ga0075028_1003179232 | 3300006050 | Watersheds | MNVTETEVRRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRSHH* |
| Ga0075017_1003955062 | 3300006059 | Watersheds | MSASVKRRIRNGVLGLASLALAFYFGFIALLVYRSHH* |
| Ga0075021_109138281 | 3300006354 | Watersheds | MNVTETEVRRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRGHH* |
| Ga0075522_100150815 | 3300006638 | Arctic Peat Soil | MSVTEPSVKRRIRNGALGLMSLALLFYFGFIAYYLYHRHH* |
| Ga0073928_1000440911 | 3300006893 | Iron-Sulfur Acid Spring | MNVTGTEVKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH* |
| Ga0073928_105554982 | 3300006893 | Iron-Sulfur Acid Spring | MNATETPGKRRIRNGALGLMSLALVLYFGFMALLIYRSHH* |
| Ga0099794_101377172 | 3300007265 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALVFYFGFIALLIYRSHH* |
| Ga0099795_100022947 | 3300007788 | Vadose Zone Soil | MNVTGTEVKRPSVRRRIRNAAFGLMSVALAFYFGIIALLIYRSHH* |
| Ga0099795_102535022 | 3300007788 | Vadose Zone Soil | MNVTETQGKRPTVRSRVRNGALGLMSLALAAYFGFIALLIYRSFH* |
| Ga0099829_101293432 | 3300009038 | Vadose Zone Soil | MNATETPVRRRIRKGALGLMSVALAFYFGIIALLIYRSHH* |
| Ga0099829_116584501 | 3300009038 | Vadose Zone Soil | MNMSDTQVRRRIRNGALGLMSLALAVYFGFIALLIYRSHH* |
| Ga0099830_109128932 | 3300009088 | Vadose Zone Soil | MNVTGTEVKRPSVRRRIRNAALGLMSVALAFYFGIIALLIYRSHH* |
| Ga0099828_109166011 | 3300009089 | Vadose Zone Soil | MNVTETGVKRPSVRRRIRNGALGLMSLALAFYFGIITLLIYRGHH* |
| Ga0116229_100073722 | 3300009500 | Host-Associated | MSVAEASIRRRIRKGALGLMVLALSFYLGFIALLVYRSRH* |
| Ga0116229_100294809 | 3300009500 | Host-Associated | MSATSSAKRRIKYSALGLMTLALAFYFGFIAMLVFRAHH* |
| Ga0116229_101141611 | 3300009500 | Host-Associated | AESQSRRRIRNGALGLMALALSFYVGFIALLVYRSRH* |
| Ga0116229_101977062 | 3300009500 | Host-Associated | MSATDTPVRRRIRNGALGLMALAMTFYVGFIALLVYRSRH* |
| Ga0116229_102255522 | 3300009500 | Host-Associated | MSAIGSTKRRIRKSALGLMTLALIFYFGFIALLFFRGHR* |
| Ga0116229_102417503 | 3300009500 | Host-Associated | MSATETPIRRRIRNGALGLMALALSFYVGFIALLVYRSRH* |
| Ga0116229_103361842 | 3300009500 | Host-Associated | MSATSSVRRRIKYSAFGLMTLALAFYFGFIALLFFRSHH* |
| Ga0116229_104206872 | 3300009500 | Host-Associated | MSVAGSKRRIRNSALGLMTLALVFYFGFIALLFYRGSHH* |
| Ga0116229_104268772 | 3300009500 | Host-Associated | MSTMSSVKRRIRYSAFGLMALALAFYFGFIALLVFRSRH* |
| Ga0116229_104363922 | 3300009500 | Host-Associated | MSVLGSTKRRIRNSALGLMTLALVFYFGFIALLFFRSHH* |
| Ga0116229_105903152 | 3300009500 | Host-Associated | MSATGSVKRRIKYSAFGLMALALAFYFGFIALLIFRSRH* |
| Ga0116230_100222525 | 3300009510 | Host-Associated | MSVIGSTKRRIRNSALGLMTLALVFYFGFIALLFFRSHH* |
| Ga0116109_11542491 | 3300009627 | Peatland | MSATETPIRRRIRNGALGLMALALSFYIGFIALLVYRSRH* |
| Ga0116129_100226211 | 3300009633 | Peatland | MSMSSGRRRIRNSALGLMSLALAFYFGFIALLVFRSHH* |
| Ga0116129_10722922 | 3300009633 | Peatland | MSTMSSGRRRIRNSALGLVSLALAFYFGFIALLVFRSHH* |
| Ga0116227_101381153 | 3300009709 | Host-Associated | VATADRKRIVKGALGLMSLALAFYFGFIALLVLRSRH* |
| Ga0116226_101508312 | 3300009787 | Host-Associated | MSAMSSVKRRIRYSAFGLMTLALTFYLGFIALLVYRSRH* |
| Ga0116226_109298602 | 3300009787 | Host-Associated | MSAIGSTKRRIRNSALGLMTLALVFYFGFIALLFFRSHH* |
| Ga0126351_11947832 | 3300010860 | Boreal Forest Soil | MNDSVRRRIRNGALGLGVLALAFYFGFIVLLVHHSHH* |
| Ga0150983_114505382 | 3300011120 | Forest Soil | MNVTETQDRRPSVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH* |
| Ga0150983_122140612 | 3300011120 | Forest Soil | MNTTEMRVRRRIRNGALGLMSLALVFYFGIIALLILRGHH* |
| Ga0137392_103757112 | 3300011269 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH* |
| Ga0137391_104565222 | 3300011270 | Vadose Zone Soil | MNVTETEAKRPSVRRRIRNGALGLMSLALAFYFGIIAMLIYRSHH* |
| Ga0137391_108618052 | 3300011270 | Vadose Zone Soil | HGPRGQMNVTETQGERPSVRRRVRNGALGLMSLALVFYFGIIALLIYRSHH* |
| Ga0137393_104927662 | 3300011271 | Vadose Zone Soil | MNATETPGKRRIRNAALGLMSLALALYFGFMALLIYRSHH* |
| Ga0137389_113222632 | 3300012096 | Vadose Zone Soil | MNATGTEVKRPSIRRRIRNGALGLMTVALAFYFGIIALLIYRSHH* |
| Ga0137388_110233262 | 3300012189 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALVFYFGIIALLIYRSHH* |
| Ga0137363_116660412 | 3300012202 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAVYFGFIALLIYRSHR* |
| Ga0137399_104371872 | 3300012203 | Vadose Zone Soil | MNVAETEAGRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH* |
| Ga0137362_114548822 | 3300012205 | Vadose Zone Soil | MSATETEVRRPSVRRRIRNGALGLMSVALAFYFGIIALLIFRSHH* |
| Ga0137379_116132022 | 3300012209 | Vadose Zone Soil | MNMTGTEVKRPSVRRRIRNGALGLMSVALAFYFGIIAILIYRSHH* |
| Ga0137384_100317477 | 3300012357 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH* |
| Ga0137385_102652883 | 3300012359 | Vadose Zone Soil | MNVTETQGGRPSVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH* |
| Ga0137385_106464701 | 3300012359 | Vadose Zone Soil | PRRQMNVTGTEVKRPSVRRRIRNAAFGLMSVALAFYFGIIALLIYRSHH* |
| Ga0137385_108058371 | 3300012359 | Vadose Zone Soil | MNMSDTQVRRRIRNGALGLMSLALAFYFGFIALLVYRSHH* |
| Ga0137390_106368911 | 3300012363 | Vadose Zone Soil | WVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH* |
| Ga0137358_100033057 | 3300012582 | Vadose Zone Soil | MSAAETAVKRPSVRRRIRNGALGLMSVALAFYFGIIALLIFRSHH* |
| Ga0137358_107906692 | 3300012582 | Vadose Zone Soil | MNAAETEAKRPSVRRRIRNGALGLMSVALAVYFGIIALLIYRSHH* |
| Ga0137398_101080832 | 3300012683 | Vadose Zone Soil | MNATEAPVRRRIRNGALGLMSLALALYFGFIALLIYRSHH* |
| Ga0137398_104373481 | 3300012683 | Vadose Zone Soil | MNGTESQGERPSVGRRVRNGALGLMSLALAFYFGFIA |
| Ga0137398_110303582 | 3300012683 | Vadose Zone Soil | MNAAETEAKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH* |
| Ga0137397_110742292 | 3300012685 | Vadose Zone Soil | DGARRQMNVTETEVKRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRGHH* |
| Ga0137397_111008012 | 3300012685 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAVYFGFIALLIYRSHH* |
| Ga0137395_104294952 | 3300012917 | Vadose Zone Soil | MNMSDTQVRRRIRNGALGLMSLALVFYFGFIALLIYRSHH* |
| Ga0137395_105533862 | 3300012917 | Vadose Zone Soil | MNATEAPVRRRIRKGALGLMSLALALYFGFIALLIYRGHH* |
| Ga0137394_109466842 | 3300012922 | Vadose Zone Soil | GERPSVRRRVRNGALGLMSLALAVYFGFIALLIYRSHR* |
| Ga0137419_116540192 | 3300012925 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGAWGLMSLALAVYFGFIALLIYRSHH* |
| Ga0137416_103372233 | 3300012927 | Vadose Zone Soil | MNVSDTQVRRRIRNGALGLMSLALAVYFGFIALLIYRSHH* |
| Ga0137416_112307341 | 3300012927 | Vadose Zone Soil | MNVTETQGERPSVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0137404_100167752 | 3300012929 | Vadose Zone Soil | MNVTGTEVKHPSVRRRIRNGALGLMSVALAFYFGIIALLIYRGHH* |
| Ga0137404_101469463 | 3300012929 | Vadose Zone Soil | MNVTETEVKRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRGHH* |
| Ga0175859_10993291 | 3300013314 | Moss Associated | MNGAHRSETEGGTTSRRVRNLALGLMSLALTFYFGFIAITIYRSHH* |
| Ga0181537_1000214215 | 3300014201 | Bog | MSAAETPIRRRIRNGALGLMALALSFYFGFIALLVYRSRH* |
| Ga0181537_105178242 | 3300014201 | Bog | MSMSAAKRRIRNSALGLMSLALAFYLGFIALLVFRSHH* |
| Ga0182013_100101287 | 3300014492 | Bog | MSAAGTQKPPSVRRRIRNGALGLMSVALAFYFGIIVLLIYRSHH* |
| Ga0182015_107462562 | 3300014495 | Palsa | GPVHSMSAAGTEKSSSVRRRIRRGALSLMSVALAFYFGIIFLLIYRSHH* |
| Ga0182019_102316823 | 3300014498 | Fen | MSAAETHVGRPQLRRRIRNGALGLMAVALTFYFGFIALLIYRSHH* |
| Ga0182024_103631382 | 3300014501 | Permafrost | MNVTETQVRRRIRNGALGLMSLALVFYLGFIAILIYRSHH* |
| Ga0182024_108623993 | 3300014501 | Permafrost | MNVTETQVKRRIRNGALGLMSLALAFYLGFIALLIYRSHH* |
| Ga0181519_105321842 | 3300014658 | Bog | MSAVSSTRKRIRNGALGLMTVALVFYFGFIALLVYRGHH* |
| Ga0182030_1000009597 | 3300014838 | Bog | MSAMSPVKRRIKYSALGLMTLALAFYFGFIALLVFRSHH* |
| Ga0182030_103393912 | 3300014838 | Bog | MSAADTQKPPSVRRRIRNGALGLMTVALAFYFGIIVLLIYRSHH* |
| Ga0137420_131744812 | 3300015054 | Vadose Zone Soil | MNVTETQGMRPSFDGESATGIGLMSLALAFYFGFIALLIYRGHH* |
| Ga0167661_10927732 | 3300015167 | Glacier Forefield Soil | ETDQRIQVKRRIRNGALALASLALAFYVGFIVLLVFRSHH* |
| Ga0167668_10133682 | 3300015193 | Glacier Forefield Soil | MNVAETQGERPSVRRRVRNGALGLMSLALAFYFGIIALLIYRGHH* |
| Ga0167668_10697852 | 3300015193 | Glacier Forefield Soil | MSEGVRRRIRNGALGLASLALAFYLGFIVLLVLRSRH* |
| Ga0137412_100063372 | 3300015242 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAVYFGFIALLIYRSFH* |
| Ga0137412_100196747 | 3300015242 | Vadose Zone Soil | MNGTESQGERPSVGRRVRNGALGLMSLALAFYFGFIALLIYRSHH* |
| Ga0137403_115823832 | 3300015264 | Vadose Zone Soil | MNVSGTQGERPSVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH* |
| Ga0182025_11750584 | 3300019786 | Permafrost | MNVTETQVRRRIRNGALGLMSLALVFYLGFIAILIYRSHH |
| Ga0182031_13836962 | 3300019787 | Bog | MSAAGTQKPPSVRRRIRNGALGLMSVALAFYFGIIVLLIYRSHH |
| Ga0193729_11499312 | 3300019887 | Soil | MNVTGTQGERPSVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0193729_11532702 | 3300019887 | Soil | MNATETPARRRIRNGALGLMSLALALYFGFIALLIYRSHH |
| Ga0193728_13660922 | 3300019890 | Soil | MNATEGPVRRRIRNGALGLMSLALALYFGFIALLIYRSHH |
| Ga0193726_10641122 | 3300020021 | Soil | MNVTETQGERSSVRRRVRNGALGLMSLALAVYFGFIALLIYRSHH |
| Ga0179590_10023894 | 3300020140 | Vadose Zone Soil | MNVTGTEVKRPSVRRRIRNAALGLMSVALAFYFGIIALLIYRSHH |
| Ga0179592_1000003244 | 3300020199 | Vadose Zone Soil | MNVTGTQGERPSVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH |
| Ga0179592_101246332 | 3300020199 | Vadose Zone Soil | MNVTGTEVKRPSVRRRIRNAAFGLMSVALAFYFGIIALLIYRSHH |
| Ga0179592_103909271 | 3300020199 | Vadose Zone Soil | MNVTGTEVKHPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0210407_100317534 | 3300020579 | Soil | MNVTETEVKRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRSHH |
| Ga0210407_101797003 | 3300020579 | Soil | MNATETQGKRPSVRRRVRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0210407_105384172 | 3300020579 | Soil | MNATEMRIRRRIRNGALGLMTLALAFYFGIIALLIHRGHH |
| Ga0210403_100937913 | 3300020580 | Soil | MNATETEVRGQSVRRRIRNGALGLMSLALAFYFGFIALLVYRSHP |
| Ga0210399_104900252 | 3300020581 | Soil | MNTTEMRVRRRIRNGALGLMSLALVFYFGIIALLI |
| Ga0210399_114600811 | 3300020581 | Soil | MNVTETQDRRPSVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0210401_109512141 | 3300020583 | Soil | MSASVKRRIRNGVLGLASLALAFYFGFIALLVYRSHH |
| Ga0210401_114585652 | 3300020583 | Soil | TEVKRPSVRRRIRNAALGLMSVALAFYFGIIALLIYRGHH |
| Ga0179596_104290802 | 3300021086 | Vadose Zone Soil | MNVTETQGGRPSVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH |
| Ga0179596_105000691 | 3300021086 | Vadose Zone Soil | MNMSDTQVRRRIRNGALGLMSLALAVYFGFIALLIYRSHH |
| Ga0210404_106154032 | 3300021088 | Soil | MNATGTEVKRPSVRRRIRNAALGLMSVALAFYFGIIALLIYRSHH |
| Ga0179584_12900022 | 3300021151 | Vadose Zone Soil | MNVTGTQGDRPSVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0210406_100807282 | 3300021168 | Soil | MNATGTEVKRPAVRRRIRNGALGLMSVALAFYFGIIALLIYRGHH |
| Ga0210406_102319412 | 3300021168 | Soil | MNGTETQGERPTVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0210408_1000066531 | 3300021178 | Soil | MNTTEMRVRRRIRNGALGLMSLALVFYFGVIALLIHRAHH |
| Ga0210408_101702562 | 3300021178 | Soil | MNATGTEVKRPAVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0210383_106874293 | 3300021407 | Soil | GPRGQMNVTETQDRRPSVRRRIRNGALGLMSLALAFYFGFIALLIYRSLH |
| Ga0210394_100466004 | 3300021420 | Soil | MNATEMRVRRRIRNGALGLMTLALAFYFGIIALLIHRGHH |
| Ga0210394_100800702 | 3300021420 | Soil | MNMIGTEVKSPSIRRRIRNAALGLMTVALAFYFGIIALLIYRSHH |
| Ga0210384_117334862 | 3300021432 | Soil | MNVTETQGGRPTVRRRVRNGALGLMSLALAFYFGFI |
| Ga0210402_100327882 | 3300021478 | Soil | MNVTGTQGRRPSVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0210402_101987273 | 3300021478 | Soil | MNVTETQDGRPTVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0210410_1000008260 | 3300021479 | Soil | MNTTGMRVRRRIRNGALGLMSLALVFYFGVIALLIHRGHH |
| Ga0210410_113879912 | 3300021479 | Soil | MNVTETQDRHPSVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0210409_102737983 | 3300021559 | Soil | MNVSATRVRNGALGLAFLALVFYVGFILWMVHRSHH |
| Ga0212123_100156414 | 3300022557 | Iron-Sulfur Acid Spring | MNVTGTEVKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0212123_101382292 | 3300022557 | Iron-Sulfur Acid Spring | MNATETPGKRRIRNGALGLMSLALVLYFGFMALLIYRSHH |
| Ga0242654_103689551 | 3300022726 | Soil | RDQMNATETQGKRPSVRRRVRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0233356_10007685 | 3300023046 | Soil | MNNATETQGKRRIRNAALGLMSLALALYFGFMALLIYRSHH |
| Ga0224568_10089062 | 3300024220 | Plant Litter | MAETPLKRPPDRRKIRNSALGLLSVALAFYFGIIAILIYRGHH |
| Ga0208193_10016132 | 3300025463 | Peatland | MSMSSGRRRIRNSALGLMSLALAFYFGFIALLVFRSHH |
| Ga0207933_10328071 | 3300025679 | Arctic Peat Soil | MSVTEPSVKRRIRNGALGLMSLALLFYFGFIAYFLYHRHH |
| Ga0209483_10992422 | 3300025862 | Arctic Peat Soil | MSVTEPSVKRRIRNGALGLMSLALLFYFGFIAYYLYHRHH |
| Ga0209240_11025452 | 3300026304 | Grasslands Soil | MNATEAPVRRRIRNGALGLMSLALALYFGFIALLIYRSHH |
| Ga0209647_11773732 | 3300026319 | Grasslands Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAFYFGIIALLIYRSH |
| Ga0257172_10096791 | 3300026482 | Soil | MNVTGTEAKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0179593_10852482 | 3300026555 | Vadose Zone Soil | MNAAETEAKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0179587_101231031 | 3300026557 | Vadose Zone Soil | ETEAKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0179587_108835922 | 3300026557 | Vadose Zone Soil | VNMMGTQVKGPSIRRRIRNAALGLMTVALALYFGIIALLIHRGHH |
| Ga0208983_10357151 | 3300027381 | Forest Soil | MNATETPVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0209116_10757232 | 3300027590 | Forest Soil | MNATEMRVRRRIRNGALGLMSLALAFYFGIIALLIHRGHH |
| Ga0208988_10383451 | 3300027633 | Forest Soil | ALSQLQHGPRRRMNATETPVKRRIRNGALGLMSLALALYFGFMALLIYRSHH |
| Ga0209217_10867002 | 3300027651 | Forest Soil | MNATETPVRRRIRNGALRLMSLALALYFGFIALLIYRSHH |
| Ga0209736_11064142 | 3300027660 | Forest Soil | MNVTETQGKRPPVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0209009_10254462 | 3300027667 | Forest Soil | MNVTETQGKRPPVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH |
| Ga0208991_11969752 | 3300027681 | Forest Soil | MNATETQGKRRIRNGALGLMCLALVFYFGIIALLIYRSHH |
| Ga0209447_100459812 | 3300027701 | Bog Forest Soil | MNTAEVRVKRRIRNGALGLMSLALAFYFGIIALLIHRGHH |
| Ga0209328_100681311 | 3300027727 | Forest Soil | GALSQLQHGAQRRMNATETSVKRRIRNGALGLMSLALALYFGFMALLIYRSHH |
| Ga0209139_100508972 | 3300027795 | Bog Forest Soil | MSAAMSTLRRRIRNSSLGLTALALAFYFGFIALSVLRRH |
| Ga0209208_100001683 | 3300027807 | Host-Associated | MSEAGDRPSQVRSRVRMRALLLSSLALAFYFGFIALTVYRSHH |
| Ga0209208_100877162 | 3300027807 | Host-Associated | MSATSSVRRRIKYSAFGLMTLALAFYFGFIALLFFRSHH |
| Ga0209208_101640262 | 3300027807 | Host-Associated | MSVIGSTKRRIRNSALGLMTLALVFYFGFIALLFFRSHH |
| Ga0209656_100149472 | 3300027812 | Bog Forest Soil | MNAAETRVKRRIRNGALGLMSLALVFYFGIIALLIHRGHH |
| Ga0209060_100049055 | 3300027826 | Surface Soil | MSVAQSRRRIRQRALLLTAVALGFYVGFIALTIYRSHH |
| Ga0209773_100972172 | 3300027829 | Bog Forest Soil | MNATQWQVKRRIRNGALVLMSLALAFYFGFIAILIYRSHH |
| Ga0209611_100161989 | 3300027860 | Host-Associated | MSATSSAKRRIKYSALGLMTLALAFYFGFIAMLVFRAHH |
| Ga0209611_100236487 | 3300027860 | Host-Associated | MSATETPIRRRIRNGALGLMALALSFYVGFIALLVYRSRH |
| Ga0209611_100551623 | 3300027860 | Host-Associated | MSATDTPVRRRIRNGALGLMALAMTFYVGFIALLVYRSRH |
| Ga0209611_100883682 | 3300027860 | Host-Associated | MSVAEASIRRRIRKGALGLMLLALSFYFGFIALLVYRSRH |
| Ga0209611_100973083 | 3300027860 | Host-Associated | MSVAGSKRRIRNSALGLMTLALVFYFGFIALLFYRGSHH |
| Ga0209611_101850313 | 3300027860 | Host-Associated | AESQSRRRIRNGALGLMALALSFYVGFIALLVYRSRH |
| Ga0209611_106020002 | 3300027860 | Host-Associated | MSATGSVKRRIKYSAFGLMALALAFYFGFIALLIFRSRH |
| Ga0209701_101396012 | 3300027862 | Vadose Zone Soil | MNVTGTEVKRPSVRRRIRNGALGLMSLALAFYFGI |
| Ga0209167_106223692 | 3300027867 | Surface Soil | MNATGTEVKRPSVRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0209488_101315342 | 3300027903 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0209526_103022521 | 3300028047 | Forest Soil | RGQMNLTETQGKRPPVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0137415_100294891 | 3300028536 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALVFYFGFIALLIYRSHH |
| Ga0137415_102259202 | 3300028536 | Vadose Zone Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAVYFGFIALLIYRSHH |
| Ga0265338_103709922 | 3300028800 | Rhizosphere | MTAAHPDKPADARRRIRNAALGLMCVALAFYFGIIALLIHRSHH |
| Ga0302228_102971112 | 3300028808 | Palsa | MSAIENPNRRRIRNTALGLMTVALALYFGFMALLVFRSRH |
| Ga0311331_102204162 | 3300029954 | Bog | MSAMSSVKRRIKYSAFGLMALALAFYFGFIALLVFRSRH |
| Ga0311338_109829361 | 3300030007 | Palsa | EQPSRARVHHLALALTSLALAFYFGFIALTFYRSHH |
| Ga0311355_111945201 | 3300030580 | Palsa | QHRTGSHLSVAADRRRIVRGALGLSALALAFYFGFIALLVLRSHH |
| Ga0210291_118922792 | 3300030626 | Soil | MNVTEMQVRRRIRNGALGLMCLALTFYFGIIALLIHRGHH |
| Ga0138296_16055602 | 3300030923 | Soil | MNVTETQGERPSVRRRVRNGALGLMSLALAVYFGFIALLRKKKI |
| Ga0073998_115772792 | 3300031023 | Soil | MNVTGTEVKRPSIRRRIRNGALGLMSVALAFYFGIIALLIYRSHH |
| Ga0073995_122626232 | 3300031047 | Soil | MNVTETQGKRPPVRRRVRNGALGLMSLALTFYFGFIALLIYRSHH |
| Ga0170834_1036320101 | 3300031057 | Forest Soil | MNMTETEVKRPSVRRRIRNGALGLMSVALAFYFGIIAILIYRSHH |
| Ga0170834_1045328731 | 3300031057 | Forest Soil | TETHSERPSVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0170834_1053245032 | 3300031057 | Forest Soil | MNVTRTEVTRPSVRRRIRNAALGLMSVALAFYFGIIALLIYRSHH |
| Ga0170823_126108252 | 3300031128 | Forest Soil | MNMTETEVKRPSVRRRIRNGALGLMSVALAFYFGIIAILICRSHH |
| Ga0170824_1260110332 | 3300031231 | Forest Soil | MNVTETQGERPSVRRRVRNGALGLMSVALVFYFGIIALLIYRSHH |
| Ga0302325_114792012 | 3300031234 | Palsa | MSAAGTEKSPSVRRRIRRGALSLMSVALAFYFGIIFLLIYRSHH |
| Ga0302325_130898511 | 3300031234 | Palsa | EGGSVKRRIRNGALGLAALALAFYLGFIVMLVLRSHH |
| Ga0302324_1023279352 | 3300031236 | Palsa | MSMGTAKRRIRNSALGLMSLALAFYLGFIALLVFRSHH |
| Ga0265325_101713062 | 3300031241 | Rhizosphere | MRAAETEKPASAKRRIRNAALGLMSVALAFYFGIIALLIYRSHH |
| Ga0170820_105712011 | 3300031446 | Forest Soil | VSGALSQLQHGSARRMNATETPVRRRIRNGALGLMSLALALYFGFMALLIYRSHH |
| Ga0170820_120207352 | 3300031446 | Forest Soil | MSATETQGERPSVRRRVRNGALGLMSLALVFYFGFIALLIYRSHH |
| Ga0310686_1075207165 | 3300031708 | Soil | MAETPLKRPPDRRKIRNSALGLLSVALAFYFGIIAILIYRGHR |
| Ga0310686_1129601902 | 3300031708 | Soil | MAETQREGPAYRRRIRNSALGLLSVVLAFYFGIIAILIYRGHR |
| Ga0307476_106067642 | 3300031715 | Hardwood Forest Soil | MNATGTEIKHPSVRRRIRNGALGLMSVALAFYFGIIAILIYRSHH |
| Ga0307474_103359042 | 3300031718 | Hardwood Forest Soil | MSAGVKRRIRNGALGLASLALAFYFGFIALLVYRSHH |
| Ga0307474_112157542 | 3300031718 | Hardwood Forest Soil | MNATETKDRRPSVRRRIRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0302321_1009658343 | 3300031726 | Fen | MSVTETQVGRPQLRRRIRNGALGLTAVALTFYFGFIVLLVYRSHH |
| Ga0307516_1000006020 | 3300031730 | Ectomycorrhiza | MSVTEARGERPPVRRRVRNGALGLMSLALAFYFGFIALLIYRSHH |
| Ga0307516_109539971 | 3300031730 | Ectomycorrhiza | MSVTETQGKRPTVRRRVRNGALGLMSLALAFYFGFIAL |
| Ga0307477_104456552 | 3300031753 | Hardwood Forest Soil | MNATGTEVKRPSVRRRIRNGALGLMSVALAFYFGIIAILIYRSHH |
| Ga0307479_104045382 | 3300031962 | Hardwood Forest Soil | MSVTETQGGRPSVRRRVRNAALGLMSLALAFYFGFIALLIYRSHH |
| Ga0307470_100032362 | 3300032174 | Hardwood Forest Soil | MNVTGTEIKHPSVRRRIRNAALGLMSVALAFYFGIIALLIYRSHH |
| Ga0307470_100035498 | 3300032174 | Hardwood Forest Soil | MNATETPVRRRIRNGALGLMSLALALYFGFIALLIYRSHH |
| Ga0307471_1005990162 | 3300032180 | Hardwood Forest Soil | MNVTETEAKRPSVRRRIRNGALGLMSLALAFYFGIIAILIYRGHR |
| Ga0307471_1031026672 | 3300032180 | Hardwood Forest Soil | MNVAETQGERASVRRRVRNGALGLMSLALAFYFGIIALLIYRSHH |
| ⦗Top⦘ |