


| Basic Information | |
|---|---|
| Family ID | F023813 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKTNAIAQDSGWDVSFWFAISSPLLGVLLGILAAAIFCR |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.88 % |
| % of genes near scaffold ends (potentially truncated) | 57.21 % |
| % of genes from short scaffolds (< 2000 bps) | 86.06 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.904 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.019 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.673 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF02776 | TPP_enzyme_N | 10.58 |
| PF12697 | Abhydrolase_6 | 5.77 |
| PF00069 | Pkinase | 2.40 |
| PF00873 | ACR_tran | 1.44 |
| PF07681 | DoxX | 1.44 |
| PF01575 | MaoC_dehydratas | 1.44 |
| PF14833 | NAD_binding_11 | 0.96 |
| PF06314 | ADC | 0.96 |
| PF02423 | OCD_Mu_crystall | 0.96 |
| PF00107 | ADH_zinc_N | 0.96 |
| PF02771 | Acyl-CoA_dh_N | 0.96 |
| PF04966 | OprB | 0.96 |
| PF13515 | FUSC_2 | 0.96 |
| PF08240 | ADH_N | 0.96 |
| PF07311 | Dodecin | 0.96 |
| PF00190 | Cupin_1 | 0.48 |
| PF17164 | DUF5122 | 0.48 |
| PF00923 | TAL_FSA | 0.48 |
| PF13432 | TPR_16 | 0.48 |
| PF02261 | Asp_decarbox | 0.48 |
| PF02737 | 3HCDH_N | 0.48 |
| PF04632 | FUSC | 0.48 |
| PF02547 | Queuosine_synth | 0.48 |
| PF12146 | Hydrolase_4 | 0.48 |
| PF03446 | NAD_binding_2 | 0.48 |
| PF02932 | Neur_chan_memb | 0.48 |
| PF13452 | MaoC_dehydrat_N | 0.48 |
| PF02915 | Rubrerythrin | 0.48 |
| PF13884 | Peptidase_S74 | 0.48 |
| PF13371 | TPR_9 | 0.48 |
| PF00881 | Nitroreductase | 0.48 |
| PF03306 | AAL_decarboxy | 0.48 |
| PF01266 | DAO | 0.48 |
| PF00171 | Aldedh | 0.48 |
| PF04185 | Phosphoesterase | 0.48 |
| PF02515 | CoA_transf_3 | 0.48 |
| PF07885 | Ion_trans_2 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 9.62 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.44 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.44 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.96 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.96 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.96 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG4689 | Acetoacetate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.48 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.48 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.48 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0853 | Aspartate 1-decarboxylase | Coenzyme transport and metabolism [H] | 0.48 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.48 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.48 |
| COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 0.48 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.48 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.48 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.48 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.90 % |
| Unclassified | root | N/A | 10.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02GTA5W | Not Available | 531 | Open in IMG/M |
| 2088090014|GPIPI_16755340 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 2170459003|FZN2CUW02ICTCL | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 2170459006|GBPF9FW01C41AD | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 533 | Open in IMG/M |
| 2189573002|GZIGXIF01C42XB | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000890|JGI11643J12802_10251749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
| 3300002909|JGI25388J43891_1036443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 780 | Open in IMG/M |
| 3300004156|Ga0062589_102653083 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300004479|Ga0062595_102138869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300004643|Ga0062591_100955750 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005166|Ga0066674_10513986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 538 | Open in IMG/M |
| 3300005175|Ga0066673_10630751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 622 | Open in IMG/M |
| 3300005177|Ga0066690_10827541 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005180|Ga0066685_10030778 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
| 3300005181|Ga0066678_10047851 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300005187|Ga0066675_10052103 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
| 3300005289|Ga0065704_10126450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1689 | Open in IMG/M |
| 3300005293|Ga0065715_10891246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
| 3300005332|Ga0066388_100383171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2052 | Open in IMG/M |
| 3300005332|Ga0066388_102710125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 904 | Open in IMG/M |
| 3300005332|Ga0066388_107013472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 567 | Open in IMG/M |
| 3300005345|Ga0070692_10331213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 940 | Open in IMG/M |
| 3300005347|Ga0070668_102074848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300005434|Ga0070709_11599844 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005436|Ga0070713_100928682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 838 | Open in IMG/M |
| 3300005437|Ga0070710_11209722 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 559 | Open in IMG/M |
| 3300005438|Ga0070701_10880168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300005446|Ga0066686_10607414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 743 | Open in IMG/M |
| 3300005450|Ga0066682_10673305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 639 | Open in IMG/M |
| 3300005526|Ga0073909_10221603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 828 | Open in IMG/M |
| 3300005546|Ga0070696_100280643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1270 | Open in IMG/M |
| 3300005552|Ga0066701_10061676 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2096 | Open in IMG/M |
| 3300005554|Ga0066661_10212162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1199 | Open in IMG/M |
| 3300005569|Ga0066705_10501589 | Not Available | 760 | Open in IMG/M |
| 3300005569|Ga0066705_10866969 | Not Available | 536 | Open in IMG/M |
| 3300005574|Ga0066694_10267152 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 812 | Open in IMG/M |
| 3300005575|Ga0066702_10203699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1198 | Open in IMG/M |
| 3300005576|Ga0066708_10145682 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300005587|Ga0066654_10541488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300005713|Ga0066905_100358352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1168 | Open in IMG/M |
| 3300005764|Ga0066903_100363987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2349 | Open in IMG/M |
| 3300005764|Ga0066903_102658964 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 970 | Open in IMG/M |
| 3300005764|Ga0066903_103307549 | Not Available | 871 | Open in IMG/M |
| 3300005764|Ga0066903_108986598 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005983|Ga0081540_1118804 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300006032|Ga0066696_10457272 | Not Available | 836 | Open in IMG/M |
| 3300006046|Ga0066652_100208815 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300006046|Ga0066652_101009589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 789 | Open in IMG/M |
| 3300006796|Ga0066665_10508559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300006806|Ga0079220_11476115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 582 | Open in IMG/M |
| 3300006881|Ga0068865_101537214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 597 | Open in IMG/M |
| 3300006903|Ga0075426_11245983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 564 | Open in IMG/M |
| 3300006904|Ga0075424_101746447 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009012|Ga0066710_102277248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 788 | Open in IMG/M |
| 3300009012|Ga0066710_102737311 | Not Available | 701 | Open in IMG/M |
| 3300009012|Ga0066710_102747930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 699 | Open in IMG/M |
| 3300009012|Ga0066710_104102161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. F001 | 545 | Open in IMG/M |
| 3300009038|Ga0099829_11665396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 525 | Open in IMG/M |
| 3300009090|Ga0099827_12016165 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300009098|Ga0105245_11456996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 735 | Open in IMG/M |
| 3300009101|Ga0105247_11823139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300009137|Ga0066709_101229294 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300009137|Ga0066709_101303568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1064 | Open in IMG/M |
| 3300009147|Ga0114129_10582193 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1452 | Open in IMG/M |
| 3300009147|Ga0114129_11547322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 813 | Open in IMG/M |
| 3300009156|Ga0111538_11914281 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300009553|Ga0105249_12637370 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010043|Ga0126380_10134042 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1555 | Open in IMG/M |
| 3300010046|Ga0126384_10143091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1831 | Open in IMG/M |
| 3300010047|Ga0126382_10873911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 775 | Open in IMG/M |
| 3300010047|Ga0126382_11486814 | Not Available | 622 | Open in IMG/M |
| 3300010048|Ga0126373_11302464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 792 | Open in IMG/M |
| 3300010322|Ga0134084_10059091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1147 | Open in IMG/M |
| 3300010323|Ga0134086_10038130 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300010335|Ga0134063_10417222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
| 3300010358|Ga0126370_10166885 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300010366|Ga0126379_10157828 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300010371|Ga0134125_11908643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 646 | Open in IMG/M |
| 3300010401|Ga0134121_11697980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 654 | Open in IMG/M |
| 3300010401|Ga0134121_12608762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 549 | Open in IMG/M |
| 3300011270|Ga0137391_10254894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1520 | Open in IMG/M |
| 3300012198|Ga0137364_10241607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1332 | Open in IMG/M |
| 3300012198|Ga0137364_10888914 | Not Available | 674 | Open in IMG/M |
| 3300012198|Ga0137364_11354234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
| 3300012199|Ga0137383_10988961 | Not Available | 613 | Open in IMG/M |
| 3300012200|Ga0137382_10664067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. F001 | 746 | Open in IMG/M |
| 3300012200|Ga0137382_10996487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 602 | Open in IMG/M |
| 3300012201|Ga0137365_11344589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 505 | Open in IMG/M |
| 3300012202|Ga0137363_10535133 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012202|Ga0137363_10758158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 822 | Open in IMG/M |
| 3300012202|Ga0137363_11224228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 638 | Open in IMG/M |
| 3300012203|Ga0137399_11771323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300012205|Ga0137362_11009686 | Not Available | 708 | Open in IMG/M |
| 3300012205|Ga0137362_11614176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 535 | Open in IMG/M |
| 3300012206|Ga0137380_11749243 | Not Available | 505 | Open in IMG/M |
| 3300012207|Ga0137381_10662464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 908 | Open in IMG/M |
| 3300012207|Ga0137381_11402982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300012208|Ga0137376_10674797 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 892 | Open in IMG/M |
| 3300012209|Ga0137379_11276261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 641 | Open in IMG/M |
| 3300012209|Ga0137379_11287664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 637 | Open in IMG/M |
| 3300012211|Ga0137377_10126196 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300012349|Ga0137387_10729220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 717 | Open in IMG/M |
| 3300012350|Ga0137372_10563945 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012351|Ga0137386_10351064 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300012351|Ga0137386_10945646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 615 | Open in IMG/M |
| 3300012351|Ga0137386_11008781 | Not Available | 592 | Open in IMG/M |
| 3300012354|Ga0137366_10548497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 832 | Open in IMG/M |
| 3300012354|Ga0137366_11113377 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012357|Ga0137384_11375749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300012358|Ga0137368_10490137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 793 | Open in IMG/M |
| 3300012361|Ga0137360_10316365 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300012361|Ga0137360_10509847 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300012361|Ga0137360_11545387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 568 | Open in IMG/M |
| 3300012361|Ga0137360_11803420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300012362|Ga0137361_10588461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1020 | Open in IMG/M |
| 3300012362|Ga0137361_10885931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 810 | Open in IMG/M |
| 3300012582|Ga0137358_10296823 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300012582|Ga0137358_10560059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 768 | Open in IMG/M |
| 3300012683|Ga0137398_10989178 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300012685|Ga0137397_10650380 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012918|Ga0137396_10386488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1037 | Open in IMG/M |
| 3300012923|Ga0137359_11425497 | Not Available | 581 | Open in IMG/M |
| 3300012923|Ga0137359_11448448 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012924|Ga0137413_11083818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
| 3300012929|Ga0137404_10988367 | Not Available | 770 | Open in IMG/M |
| 3300012930|Ga0137407_11949370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
| 3300012957|Ga0164303_11047363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 585 | Open in IMG/M |
| 3300012960|Ga0164301_10354892 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300012971|Ga0126369_10031006 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4399 | Open in IMG/M |
| 3300012971|Ga0126369_10859365 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012972|Ga0134077_10301972 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300012984|Ga0164309_10812778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 754 | Open in IMG/M |
| 3300012986|Ga0164304_10285408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1124 | Open in IMG/M |
| 3300012986|Ga0164304_11568573 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
| 3300012987|Ga0164307_10968455 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012989|Ga0164305_10453483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 997 | Open in IMG/M |
| 3300014150|Ga0134081_10119217 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300014325|Ga0163163_13090088 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 519 | Open in IMG/M |
| 3300015241|Ga0137418_10054083 | All Organisms → cellular organisms → Bacteria | 3683 | Open in IMG/M |
| 3300015241|Ga0137418_10106953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2512 | Open in IMG/M |
| 3300015245|Ga0137409_10122298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2397 | Open in IMG/M |
| 3300015373|Ga0132257_101656230 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 819 | Open in IMG/M |
| 3300015373|Ga0132257_104424389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 511 | Open in IMG/M |
| 3300017654|Ga0134069_1307200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300017656|Ga0134112_10288918 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 657 | Open in IMG/M |
| 3300018081|Ga0184625_10551340 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018431|Ga0066655_10113602 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1541 | Open in IMG/M |
| 3300018431|Ga0066655_11074084 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300018431|Ga0066655_11395186 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018433|Ga0066667_10035289 | All Organisms → cellular organisms → Bacteria | 2865 | Open in IMG/M |
| 3300018433|Ga0066667_10694981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 853 | Open in IMG/M |
| 3300019789|Ga0137408_1004901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 3539 | Open in IMG/M |
| 3300019789|Ga0137408_1011095 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300019789|Ga0137408_1140398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3277 | Open in IMG/M |
| 3300019877|Ga0193722_1002365 | All Organisms → cellular organisms → Bacteria | 4533 | Open in IMG/M |
| 3300019879|Ga0193723_1002426 | All Organisms → cellular organisms → Bacteria | 6829 | Open in IMG/M |
| 3300019882|Ga0193713_1066204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1026 | Open in IMG/M |
| 3300019886|Ga0193727_1147332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
| 3300019888|Ga0193751_1051881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1762 | Open in IMG/M |
| 3300019999|Ga0193718_1112816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| 3300020005|Ga0193697_1015328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1877 | Open in IMG/M |
| 3300020006|Ga0193735_1013888 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300021344|Ga0193719_10224494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 798 | Open in IMG/M |
| 3300021413|Ga0193750_1006517 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 3034 | Open in IMG/M |
| 3300021418|Ga0193695_1134436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300021560|Ga0126371_10097167 | Not Available | 2926 | Open in IMG/M |
| 3300022534|Ga0224452_1037826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1410 | Open in IMG/M |
| 3300022534|Ga0224452_1075417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1019 | Open in IMG/M |
| 3300022756|Ga0222622_10039186 | Not Available | 2596 | Open in IMG/M |
| 3300025915|Ga0207693_10737217 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 762 | Open in IMG/M |
| 3300025916|Ga0207663_10242598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris TIE-1 | 1322 | Open in IMG/M |
| 3300025926|Ga0207659_11677891 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300026088|Ga0207641_11509473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 674 | Open in IMG/M |
| 3300026310|Ga0209239_1092546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1292 | Open in IMG/M |
| 3300026317|Ga0209154_1038252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2179 | Open in IMG/M |
| 3300026323|Ga0209472_1139068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. F001 | 928 | Open in IMG/M |
| 3300026498|Ga0257156_1096417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 615 | Open in IMG/M |
| 3300026524|Ga0209690_1073945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1449 | Open in IMG/M |
| 3300026528|Ga0209378_1039841 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300026529|Ga0209806_1305317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 534 | Open in IMG/M |
| 3300026538|Ga0209056_10017623 | All Organisms → cellular organisms → Bacteria | 7030 | Open in IMG/M |
| 3300026540|Ga0209376_1191688 | Not Available | 938 | Open in IMG/M |
| 3300026547|Ga0209156_10013599 | All Organisms → cellular organisms → Bacteria | 5156 | Open in IMG/M |
| 3300026548|Ga0209161_10424030 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027643|Ga0209076_1178306 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028592|Ga0247822_10649265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 849 | Open in IMG/M |
| 3300028718|Ga0307307_10214489 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300028819|Ga0307296_10156240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1233 | Open in IMG/M |
| 3300030844|Ga0075377_11665775 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1323 | Open in IMG/M |
| 3300030916|Ga0075386_12073783 | Not Available | 733 | Open in IMG/M |
| 3300031231|Ga0170824_104044750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 587 | Open in IMG/M |
| 3300031446|Ga0170820_12758492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300031446|Ga0170820_16571886 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300031573|Ga0310915_10822085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300031720|Ga0307469_10726714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 903 | Open in IMG/M |
| 3300031754|Ga0307475_11588666 | Not Available | 500 | Open in IMG/M |
| 3300031890|Ga0306925_10097832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3121 | Open in IMG/M |
| 3300031912|Ga0306921_10453607 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300031942|Ga0310916_10128278 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300031942|Ga0310916_11708086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300031945|Ga0310913_10043179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2917 | Open in IMG/M |
| 3300031945|Ga0310913_10366604 | Not Available | 1020 | Open in IMG/M |
| 3300031946|Ga0310910_10215207 | Not Available | 1494 | Open in IMG/M |
| 3300032076|Ga0306924_10647528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300032180|Ga0307471_101971616 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 732 | Open in IMG/M |
| 3300032180|Ga0307471_103617557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300033412|Ga0310810_10209751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2190 | Open in IMG/M |
| 3300033551|Ga0247830_10301860 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_00202460 | 2065487018 | Soil | MLTKNSMKTNRSAQYSGWNFSFWFAVSSPLLGVLLGVLAAAIFCR |
| GPIPI_01187170 | 2088090014 | Soil | LEKNSMKTNPSAQGSGWNVSFWFALSSPLLGVLLGNLAAAIFCR |
| E4A_02512010 | 2170459003 | Grass Soil | MKTNSTAKESGWRVSFWFAVSSPLLGVLLGFLAAA |
| L01_00152450 | 2170459006 | Grass Soil | KTNAIAEDSGCDVSFWFAVSSPLLGVLLGLVAAAIFCR |
| FE1_06753600 | 2189573002 | Grass Soil | MKTNPTAQESGWRVSFWFALSSPLIGVLLAFLAAAI |
| JGI11643J12802_102517491 | 3300000890 | Soil | MLEKNKMKTNRSAQGSGWNLSFWFAVSSPLLGVLVGILAAAIFCR* |
| JGI25388J43891_10364432 | 3300002909 | Grasslands Soil | MKTNAIAQDPGWDFSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0062589_1026530831 | 3300004156 | Soil | VKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFYR* |
| Ga0062595_1021388692 | 3300004479 | Soil | MKTNAIAKESGWRFSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0062591_1009557501 | 3300004643 | Soil | SVKTNSIAQESGWNVSFWFAVSSPLLGVLLGLLAAAIFCR* |
| Ga0066674_105139862 | 3300005166 | Soil | MLEKNSMKTNAIAQDPGWDFSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0066673_106307512 | 3300005175 | Soil | MLEKNSMKTNAIAQDPGWDFSFWFALSSPLLGVLLGILAAAIFCR* |
| Ga0066690_108275412 | 3300005177 | Soil | MLEKNSMKTNPSAQGSGWNVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0066685_100307783 | 3300005180 | Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0066678_100478513 | 3300005181 | Soil | MKTNPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0066675_100521033 | 3300005187 | Soil | MKTNAIAQDPGRDFSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0065704_101264501 | 3300005289 | Switchgrass Rhizosphere | MKKNPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0065715_108912461 | 3300005293 | Miscanthus Rhizosphere | MKKNSFTQEPGWNVSFWFAVTSPLLGVLLAILALAILSW* |
| Ga0066388_1003831713 | 3300005332 | Tropical Forest Soil | MKTNPTAQDSSWDFCFWFAVSSPLLGVLLGFIAAGIFLSTT* |
| Ga0066388_1027101252 | 3300005332 | Tropical Forest Soil | METNPVAQDSGWDLCFWFAVSSPLLGVLLGFVAAAIFLSMT* |
| Ga0066388_1070134721 | 3300005332 | Tropical Forest Soil | MKTNSIAQGSGWNVSFWFAVTSPLLGVLLGFVAAAIFLSTT* |
| Ga0070692_103312133 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ENSVKMNSTTSDWNVSFWFAVSSPLLGVLLGFGAVAIFYR* |
| Ga0070668_1020748481 | 3300005347 | Switchgrass Rhizosphere | ENSVKMNSTTSDWNVSFWFAVSSPLLGVLLGVLAPVIFCR* |
| Ga0070709_115998442 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTNSIAQDSGWNVSFWFAVSSPLLGVLFGILGAAILSMIEEAM |
| Ga0070713_1009286823 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NSVKMNSTTSDWNVSFWFAVSSPLLGVLLGIFAAAIFCR* |
| Ga0070710_112097221 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RKKSEIFWNFGLRTLEKYSVKTNAIDQNSGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0070701_108801681 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FERLENSVKMNSTTSDWNVSFWFAVSSPLLGVLLGFGAVAIFYR* |
| Ga0066686_106074141 | 3300005446 | Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVLLGLLAAAIFCR* |
| Ga0066682_106733053 | 3300005450 | Soil | RTLEKNSMKTNAIAQDPGWDFSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0073909_102216032 | 3300005526 | Surface Soil | TVKVPDWNISFWFAVSSPLLGALLGFGAVAILYR* |
| Ga0070696_1002806431 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVFERLENSVKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFYR* |
| Ga0066701_100616762 | 3300005552 | Soil | MKTNPIAQESGWNVSFWFALSSPLLGVLVGFLAAAIFYR* |
| Ga0066661_102121621 | 3300005554 | Soil | ENSVKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFYR* |
| Ga0066705_105015891 | 3300005569 | Soil | TRTARHSGWDMPFWFAASSPLLGVLVALLALAIFCR* |
| Ga0066705_108669691 | 3300005569 | Soil | VKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFY |
| Ga0066694_102671522 | 3300005574 | Soil | MNTNPNAQGSGWNVSFWFALSSPLLGGLLGILAAAIFCR* |
| Ga0066702_102036992 | 3300005575 | Soil | VKANPTTKDWDISFWFAVSSPLLGVLLGLLALMILYR* |
| Ga0066708_101456821 | 3300005576 | Soil | NPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0066654_105414882 | 3300005587 | Soil | MKTNAIAQDPGWDFSFWFALSSPLLGVLLGILAAAIFCR* |
| Ga0066905_1003583521 | 3300005713 | Tropical Forest Soil | METNPVGQDSGWDLCFWFAVSSPLLGVLLGFVAAAIFLS |
| Ga0066903_1003639871 | 3300005764 | Tropical Forest Soil | TNSITPEAGWNISFWFAVSSPLIGIALGFALAALALL* |
| Ga0066903_1026589641 | 3300005764 | Tropical Forest Soil | NPIAQDSGWDFSFWFAVSSPLLGVLLGIVAVAIFCR* |
| Ga0066903_1033075491 | 3300005764 | Tropical Forest Soil | MKTNPSAEDLGWNFSFWFAVSSPLLGVLLAMLALAIFCR* |
| Ga0066903_1089865981 | 3300005764 | Tropical Forest Soil | IAQKAGWNVSFWFAGSSPLLGVLVGILAAAIFCR* |
| Ga0081540_11188043 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNTNPTAQDSGWDFSFWFAVSSPLLGVLLGFVAAALFLSMT* |
| Ga0066696_104572723 | 3300006032 | Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVLVGMLAAAIFCR* |
| Ga0066652_1002088153 | 3300006046 | Soil | MLEKNNVKTNPSAQDSGWNVSFWFAISSPLLGVLVGILAAAIFCR* |
| Ga0066652_1010095893 | 3300006046 | Soil | LEKNSVKTNRALQDSGWDLSFWFAVSSPLLGVLLAIVALAIFCR* |
| Ga0066665_105085592 | 3300006796 | Soil | MKRNPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0079220_114761152 | 3300006806 | Agricultural Soil | MKTNPIAQEPGWRVSFWFAVSSPVLGVLLGFLAAAIFCR* |
| Ga0068865_1015372141 | 3300006881 | Miscanthus Rhizosphere | MKTNAIVQDSGWRVSFWFAISSPLLGVLLGLLAAAI |
| Ga0075426_112459831 | 3300006903 | Populus Rhizosphere | DRTLQDSSWDVSFWFVVTSPLLGILFGFLGVVIFFR* |
| Ga0075424_1017464471 | 3300006904 | Populus Rhizosphere | VKTNAIAQESGWRVSLWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0066710_1022772482 | 3300009012 | Grasslands Soil | MLEKNSMKTNPSAQGSGWNVSFWFAVSSPLLGVLVGILAAAIFCR |
| Ga0066710_1027373113 | 3300009012 | Grasslands Soil | VNTNLTAQDSGWNVSFWFAVLSPLLGILLAIIALAIFRP |
| Ga0066710_1027479302 | 3300009012 | Grasslands Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVPLGILAAAIFCR |
| Ga0066710_1041021611 | 3300009012 | Grasslands Soil | MLEEDSVKTNSIAQESGWRVSFWFAVSSPLLGVLVG |
| Ga0099829_116653961 | 3300009038 | Vadose Zone Soil | KNSMKTNSIAQESGWNVSFWFAISSPLLGVLLGLLAAAIFCR* |
| Ga0099827_120161651 | 3300009090 | Vadose Zone Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVLVGLLAAAIFCR* |
| Ga0105245_114569961 | 3300009098 | Miscanthus Rhizosphere | NSVKTNSTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0105247_118231391 | 3300009101 | Switchgrass Rhizosphere | MNSTNSDWNVSFWFAVWSPLLGVLLGILAAAIFCR* |
| Ga0066709_1012292941 | 3300009137 | Grasslands Soil | MLEEDSVKTNSIAQESGWRVSFWFAVSSPLLGVLVGILAAAI |
| Ga0066709_1013035682 | 3300009137 | Grasslands Soil | MKTNAIAQDPGWDFSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0114129_105821931 | 3300009147 | Populus Rhizosphere | ENRVKANSTTQNSGWDVSFWFAVSSPLLGVLLGIVAPMILCR* |
| Ga0114129_115473221 | 3300009147 | Populus Rhizosphere | NAIAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0111538_119142811 | 3300009156 | Populus Rhizosphere | MKTNAIAEESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0105249_126373701 | 3300009553 | Switchgrass Rhizosphere | MNSTTSDWNVSFWFAVSSPLLGVLLGLLILAIFVSMTE |
| Ga0126380_101340422 | 3300010043 | Tropical Forest Soil | MKTISFTQESDWNVSFWFAVTSPLLGALLGILALAIFQP* |
| Ga0126384_101430911 | 3300010046 | Tropical Forest Soil | EKKSMKTNPRAQGSGWNVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0126382_108739112 | 3300010047 | Tropical Forest Soil | MKTNPIAQDSGWDFCFWFAVSSPLLGVLLGFVAAAIFLSMT* |
| Ga0126382_114868142 | 3300010047 | Tropical Forest Soil | IAQDSGWNFSFWFAVSSPLLGVLLAMVALAIFCR* |
| Ga0126373_113024641 | 3300010048 | Tropical Forest Soil | MKTNSIAQESGWRVSFWFAVSSPLIGVLLAFLAAAIF |
| Ga0134084_100590911 | 3300010322 | Grasslands Soil | KSVKMNSTTSDWNVSFWFAVSSPLLGVLLGILAVVIFFR* |
| Ga0134086_100381303 | 3300010323 | Grasslands Soil | MLEKNSMKTNAIAQDPGWDFSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0134063_104172221 | 3300010335 | Grasslands Soil | MKTNAIAQDAGWDFSFWFAISSPLLGVLLGILAAAIF |
| Ga0126370_101668853 | 3300010358 | Tropical Forest Soil | MKTNPIAEDSGWDFSFLFAVSSPLIGVLLAMVALAIFCR* |
| Ga0126379_101578283 | 3300010366 | Tropical Forest Soil | MKTNPIAEDSGWFFSFLFAVSSPLIGVLLAMVALAIFCR* |
| Ga0134125_119086432 | 3300010371 | Terrestrial Soil | MNTNPGAQGSGWNVPFWFALSSPLLGVLLGILAAAILC |
| Ga0134121_116979801 | 3300010401 | Terrestrial Soil | TVKVPDWNISFWFAVSSPLLGVLLGFLVLAIFFR* |
| Ga0134121_126087623 | 3300010401 | Terrestrial Soil | ENSVKMNSTTSDWNVSFWFAVSSPLLGVLLGLLVLAILFR* |
| Ga0137391_102548941 | 3300011270 | Vadose Zone Soil | ENSVKTNSIAQESGWNVSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0137364_102416072 | 3300012198 | Vadose Zone Soil | MLEKNSMKTNAIAQDPSWDFSFWFALSSPLLGVLLGILAAAIFCR* |
| Ga0137364_108889141 | 3300012198 | Vadose Zone Soil | SSVKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFCR* |
| Ga0137364_113542342 | 3300012198 | Vadose Zone Soil | MKTNAIAQDPGWDFSFWFAVSSPLLGVLVGILAAAIFC |
| Ga0137383_109889611 | 3300012199 | Vadose Zone Soil | VKTNSTVEAPDWNISFWFAVSSPLLGVLLGFGAVAI |
| Ga0137382_106640671 | 3300012200 | Vadose Zone Soil | MLEEDSVKTNSIAQESGWRVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137382_109964873 | 3300012200 | Vadose Zone Soil | AIAQDPGWDFSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137365_113445892 | 3300012201 | Vadose Zone Soil | MKADPSAQDSGWNLSVWFALSSPLLGVLVGILAAAIFCR* |
| Ga0137363_105351332 | 3300012202 | Vadose Zone Soil | MKTNPIAQDPGWDFSFWFAISIPLLGVLVGILAAAIFCR* |
| Ga0137363_107581583 | 3300012202 | Vadose Zone Soil | MKTNSILQGHGWNVSFWFAITSPLLGVLLAIIALAIFRP* |
| Ga0137363_112242281 | 3300012202 | Vadose Zone Soil | MKTNPSAQGSGWNVSFWFALSSPLLGVLLGILAAAIF |
| Ga0137399_117713232 | 3300012203 | Vadose Zone Soil | MKTNPSAQGSGWNASFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137362_110096861 | 3300012205 | Vadose Zone Soil | NNMKTKPTAKEPAWDFCFWFAVSSPLLGVLLGFLTAAIFCR* |
| Ga0137362_116141761 | 3300012205 | Vadose Zone Soil | NSVKTNPTTSDWNISFWFAVLSPLFGILLAIIALAIFRP* |
| Ga0137380_117492431 | 3300012206 | Vadose Zone Soil | VKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFYR |
| Ga0137381_106624641 | 3300012207 | Vadose Zone Soil | VNTNLTAQDSGWNVSFWFAVLSPLLGILLAIIALAIFRP* |
| Ga0137381_114029822 | 3300012207 | Vadose Zone Soil | MKTNAISQDSGWHVSFWFAISSPLLGVLVGLLAAAIFCR |
| Ga0137376_106747973 | 3300012208 | Vadose Zone Soil | DSVKTNSIAQESGWRVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137379_112762613 | 3300012209 | Vadose Zone Soil | MKTDPSAQGSGWNLSVWFALSSPLLGVLVGILAAAIFCR* |
| Ga0137379_112876642 | 3300012209 | Vadose Zone Soil | MKTNPTAEETGWRLSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0137377_101261961 | 3300012211 | Vadose Zone Soil | SVKTNSTVKVPDWNISFWFAVSSPLLGVLLGFGAVAIFCR* |
| Ga0137387_107292201 | 3300012349 | Vadose Zone Soil | TNSTARDSGWDVSFWFAVSSPLLGVLLGVLAVAIFFR* |
| Ga0137372_105639452 | 3300012350 | Vadose Zone Soil | MKTNAIAQDSGWDFSFWFAISSPLLGVLVGILAAAIFCR* |
| Ga0137386_103510642 | 3300012351 | Vadose Zone Soil | VKTNSIAQESGWNVSFWFAVSSPLIGVLLAFLAAAIFVDD* |
| Ga0137386_109456461 | 3300012351 | Vadose Zone Soil | VDLRTLEKNSMKTNPSAQSSGWNVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137386_110087813 | 3300012351 | Vadose Zone Soil | VDLRTLEKNSMKTNPSAQSSGWNVSFWFAVSSPLLGVLVGMLAAAIFCR* |
| Ga0137366_105484973 | 3300012354 | Vadose Zone Soil | MLEKNSVKTNSIAQESGWNVSFWFAVSSPLLGVLVGMLAAAIFCR* |
| Ga0137366_111133771 | 3300012354 | Vadose Zone Soil | MKTNPTAEESGWDFYFWFAVSSPLLGVLVGILAAA |
| Ga0137384_113757492 | 3300012357 | Vadose Zone Soil | VKTSAIAQDSGWDFSFWFAISSPLLGVLLGLLAAAIFVDDQKKP* |
| Ga0137368_104901372 | 3300012358 | Vadose Zone Soil | MKTNAIAQDSGWDVSFWFAISSPLLGVLVGILAAAIFCR* |
| Ga0137360_103163651 | 3300012361 | Vadose Zone Soil | NSVKTNSIAQESGWNVSFWFAVSSPLLGVLLGILAAAIFCR* |
| Ga0137360_105098471 | 3300012361 | Vadose Zone Soil | ISQGPSWNISFWFAVTSPLLGVLLAIIALAIFRP* |
| Ga0137360_115453871 | 3300012361 | Vadose Zone Soil | MKTTAKKSDWDVSFWFAISSPLLGVLLGILALAIFFR* |
| Ga0137360_118034201 | 3300012361 | Vadose Zone Soil | KNSMKTNAIAKESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0137361_105884613 | 3300012362 | Vadose Zone Soil | MKTNPSAQGAGWNVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137361_108859311 | 3300012362 | Vadose Zone Soil | NSIAQESGWRVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137358_102968231 | 3300012582 | Vadose Zone Soil | NSVKTNSIAQESGWNVSFWFALSRPLFGVLLGILAAAIFCR* |
| Ga0137358_105600591 | 3300012582 | Vadose Zone Soil | NSVKTNSIAQESGWNVSFWFAVSSPLLGVLLGFGAVAIFYR* |
| Ga0137398_109891782 | 3300012683 | Vadose Zone Soil | VKTNLIAQDSGWDVSFWFAITSPLLGVLLAIIALAIFRP |
| Ga0137397_106503801 | 3300012685 | Vadose Zone Soil | MKTNVIAQDSGWLVSFWFATSSPLLFLLLGLLATATFGG |
| Ga0137396_103864881 | 3300012918 | Vadose Zone Soil | NSVKIKSTIQDTGWNVSFWFAITSPLLGVLLAIIALAIFRP* |
| Ga0137359_114254971 | 3300012923 | Vadose Zone Soil | NSVKTNKTAKDSGWDVSFWFAVSSPLLGVLLAIVALAIFCR* |
| Ga0137359_114484481 | 3300012923 | Vadose Zone Soil | NPTAEESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0137413_110838181 | 3300012924 | Vadose Zone Soil | MKTNAIVQDSGWRVSFWFAVSSPLIGVLLAFLAAAIF |
| Ga0137404_109883672 | 3300012929 | Vadose Zone Soil | VKINSTSNASDWNVSFWFAVSSPLLGILLGILAAAIFYR* |
| Ga0137407_119493703 | 3300012930 | Vadose Zone Soil | SVKTNSIAQESGWNVSFWFAVSSPLLGVLLGILAAAIFCR* |
| Ga0164303_110473631 | 3300012957 | Soil | NSMKTNAIAHQSGWRVSFWFAASSPLIGVLLAFLAAAIFCR* |
| Ga0164301_103548922 | 3300012960 | Soil | ESNMKTNPTALGSGWRVSFWFAVSSPLIGVLLAFRAAAIFCR* |
| Ga0126369_100310061 | 3300012971 | Tropical Forest Soil | VKTNSITQDEGWNLSFWFAVSSPVLGVLLAILALAI |
| Ga0126369_108593653 | 3300012971 | Tropical Forest Soil | MKTNPIAEDSGWDFSFLFAVSSPLIGVLPAMVALAIFCR* |
| Ga0134077_103019722 | 3300012972 | Grasslands Soil | MKTNPSAQGPGWNVSFWFAVSSPLLGVLVGMLAAAIFCR* |
| Ga0164309_108127783 | 3300012984 | Soil | ANLRTLEKESMKTNAIAQGAGWNVSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0164304_102854081 | 3300012986 | Soil | TLEKESMKTNAIAQGAGWNVSFWFAISSPLLGVLLGILAAAIFCR* |
| Ga0164304_115685731 | 3300012986 | Soil | NSMKTNPIAEDSGWDFSFWFAVSSPLLGVLLGLLAAAIFCR* |
| Ga0164307_109684551 | 3300012987 | Soil | MKTNPTAKESAWRVSFWFAVSSPLLGVLVGILAAAIFC |
| Ga0164305_104534832 | 3300012989 | Soil | MLEKNRVKTNAIPKASGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0134081_101192171 | 3300014150 | Grasslands Soil | MKTNPSAQGPGWNVSFWFAVSSPLLGVLVGILAAA |
| Ga0163163_130900883 | 3300014325 | Switchgrass Rhizosphere | MKTNAIAQNSGWDVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0137418_100540834 | 3300015241 | Vadose Zone Soil | MKTNAIVQDSGWRVSFWFAVSSPLIGVLLAFLAAAIFCR* |
| Ga0137418_101069531 | 3300015241 | Vadose Zone Soil | DLRTLEKDGMEANPSAQGPGCNFSFWFVLSSPLLGVLLGILAAAIFCR* |
| Ga0137409_101222985 | 3300015245 | Vadose Zone Soil | MQTNFTAKAPAWNVSFWFAVSSPLLGVLVGILAAAIFCR* |
| Ga0132257_1016562301 | 3300015373 | Arabidopsis Rhizosphere | MKIKPTTQDSVWDISFWFAVSSPLTGVLLAILALAIL |
| Ga0132257_1044243892 | 3300015373 | Arabidopsis Rhizosphere | MKTNAIAKESGWRLSFWFAVSSPLIGVLLAFLAAAIFC* |
| Ga0134069_13072002 | 3300017654 | Grasslands Soil | MKTNAIAQDPGWDFSFWFALSSPLLGVLLGILAAAIFCR |
| Ga0134112_102889181 | 3300017656 | Grasslands Soil | MKTNSIAQESGWNVSFWFAISSPLLGVLVGILAAAIFCR |
| Ga0184625_105513401 | 3300018081 | Groundwater Sediment | DVDLRTLEKNSMKTNPSAQDSGWDVSFWFALSSPLLGVLLGILAAAIFCR |
| Ga0066655_101136021 | 3300018431 | Grasslands Soil | TLEKHSMKTDPSAQGSGWDVSFWFAVSSPLLGVLLAIIALAIFCR |
| Ga0066655_110740841 | 3300018431 | Grasslands Soil | MKTNPTAEESGWDFYFWFAVSSPLLGVLVGMLAAAIFCR |
| Ga0066655_113951863 | 3300018431 | Grasslands Soil | LEKNSMKTNAIAQDPGWDFSFWFALSSPLLGVLLGILAAAIFCR |
| Ga0066667_100352892 | 3300018433 | Grasslands Soil | MKTNAIAQDPGWDFSFWFAVSSPLIGVLLAFLAAAIFCR |
| Ga0066667_106949812 | 3300018433 | Grasslands Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVLLGILAAAIFCR |
| Ga0137408_10049011 | 3300019789 | Vadose Zone Soil | MKTDSIAQGSGWNVSFWFAVTSPFLGVLLAILALVIFRP |
| Ga0137408_10110952 | 3300019789 | Vadose Zone Soil | TLEKNSMKTNAISQDSGWHVSFWFAISSPLLGVLVGLLAAAIFCR |
| Ga0137408_11403981 | 3300019789 | Vadose Zone Soil | VKTNSIAQESGWNVSFWFAISSPLLGVLVGILAAARGGD |
| Ga0193722_10023655 | 3300019877 | Soil | VKMNSTPSDWNVSFWFAVSSPLLGVLLGFGAVAIFYR |
| Ga0193723_10024269 | 3300019879 | Soil | MKTNSILQSHGWNVSFWFAITSPLLGVLLAIIALAIFRP |
| Ga0193713_10662041 | 3300019882 | Soil | VKTNSIAQESGWNVSFWFAISSPLLGVLLGLLAAAIF |
| Ga0193727_11473321 | 3300019886 | Soil | MKTNAIAQDSGWDVSFWFAISSPLLGVLLGILAAAIFCR |
| Ga0193751_10518812 | 3300019888 | Soil | MKTNAIAQDSGWDVSFWFALSSPLLGVLVGLLAAAI |
| Ga0193718_11128161 | 3300019999 | Soil | VKTNSIAQESGWNVSFWFAISSPLLGVLLGLLAAAIFCR |
| Ga0193697_10153281 | 3300020005 | Soil | MKTNPTAQEPGWRVSFWFAVSSPLIGVLLAFLAAAIFCR |
| Ga0193735_10138882 | 3300020006 | Soil | MKTNAIAQDSGWHVSFWFAISSPLLGVLLGLLAAAIFCR |
| Ga0193719_102244943 | 3300021344 | Soil | LEKNKMKTNPSAQGPGWNVSFWFALSSPLLGVLLGILAAAIVCR |
| Ga0193750_10065171 | 3300021413 | Soil | MKTNAIAQDPGWDFSFWFAISSPLLGVLLGILAVAIFCR |
| Ga0193695_11344361 | 3300021418 | Soil | DLRTLEKNSMKTNATAQDSGWHVSFWFAISSPLLGVLIGILAAAIFCR |
| Ga0126371_100971673 | 3300021560 | Tropical Forest Soil | MKTNPSAEDLGWNFSFWFAVSSPLLGVLLAMLALAIFCR |
| Ga0224452_10378263 | 3300022534 | Groundwater Sediment | VKTNSIAQESGWNVSFWFAISSPLLGVLLGLLAAAI |
| Ga0224452_10754174 | 3300022534 | Groundwater Sediment | AIAQDSGWDVSFWFAISSPLLGVLLGILAAAIFCR |
| Ga0222622_100391862 | 3300022756 | Groundwater Sediment | MKTNSSAQGPGWNVSFWFAVSSPLLGVLVGILAAAIF |
| Ga0207693_107372171 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKTNSIAQESGWRVSFWFAVSSPLIGVLLAFLAAAIF |
| Ga0207663_102425981 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NSVKMNSTTSDWNVSFWFAVSSPLLGVLLGLLVLAILFR |
| Ga0207659_116778911 | 3300025926 | Miscanthus Rhizosphere | NAIAQDSGWRVSFWFAITSPLLGVLLGLLAAAIFCR |
| Ga0207641_115094731 | 3300026088 | Switchgrass Rhizosphere | MKTNAIVQDSGWRVSFWFAVSSPLIGVLLAFLAAA |
| Ga0209239_10925463 | 3300026310 | Grasslands Soil | MLEKNSMKTNAIAQDPGWDFSFWFALSSPLLGVLLGILAAAIFCR |
| Ga0209154_10382521 | 3300026317 | Soil | SVKTNPTAQESGWRVSFWFALSSPLIGVLLAFLAVAIFCR |
| Ga0209472_11390681 | 3300026323 | Soil | VKTNSIAQESGWNVSFWFAISSPLLGVLVGILAAAIFCR |
| Ga0257156_10964172 | 3300026498 | Soil | MKTNPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR |
| Ga0209690_10739451 | 3300026524 | Soil | MKTNPIAQESGWNVSFWFALSSPLLGVLVGFLAAAIFYR |
| Ga0209378_10398414 | 3300026528 | Soil | PNAQGPGWNVSFWFAVSSPLLGVLVGTLAAAIFCR |
| Ga0209806_13053172 | 3300026529 | Soil | NSVKTNSIAQESGWNVSFWFALSSPLFGVLLGILAAAIFCR |
| Ga0209056_100176238 | 3300026538 | Soil | MKTNPSAQGSDWNVSFWFAVSSPLLGVLLGILAAAIFCR |
| Ga0209376_11916881 | 3300026540 | Soil | NPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR |
| Ga0209156_100135995 | 3300026547 | Soil | MKTNAIAQDPGRDFSFWFAISSPLLGVLLGILAAAIFCR |
| Ga0209161_104240302 | 3300026548 | Soil | MKTNPTAEESGWDFYFWFAVSSPLLGVLVGLLAAAIFLSMNRRRHELN |
| Ga0209076_11783063 | 3300027643 | Vadose Zone Soil | MKTNASAQGAGWNVSFWFALSSPLLGVLLGLLAAAIFCR |
| Ga0247822_106492651 | 3300028592 | Soil | MKKNPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR |
| Ga0307307_102144892 | 3300028718 | Soil | MKTDPTAQESGWRVSFWFAVSSPLIGVLLAFLAAAIFC |
| Ga0307296_101562401 | 3300028819 | Soil | TLEKNSMKTNPSAQGSGWNVSFWFALSSPLPGVLLGILAAAIFCR |
| Ga0075377_116657753 | 3300030844 | Soil | MKTNAIAEGSGWDFSFCFAISSPLLGVLLGLLAAAIFCR |
| Ga0075386_120737832 | 3300030916 | Soil | MKTNAIAEDSGCDVSFWFAVSSPLLGVLLGLLAAA |
| Ga0170824_1040447501 | 3300031231 | Forest Soil | MKTNPTAKESGWRVSFWFAVSSPLIGVLLAFLAAAIFCR |
| Ga0170820_127584921 | 3300031446 | Forest Soil | MKTNPTAQESGWRVSFWFAVSSPLIGVLLAFRAAAIFCR |
| Ga0170820_165718863 | 3300031446 | Forest Soil | MKTNPTAQESGWRVSFWFAMSSPLIGVLLAFLAAAIFCR |
| Ga0310915_108220852 | 3300031573 | Soil | MKTNPTAQESSWRVSFWFAVSRPLIGVLLAFLAVAIFLP |
| Ga0307469_107267143 | 3300031720 | Hardwood Forest Soil | VKMNSTTSDWNVSFWFAVSSPLLGVLLGFGAVAIFYR |
| Ga0307475_115886661 | 3300031754 | Hardwood Forest Soil | VKTDSIDQDSDWNVSFWFAVLSPLLGILLAMTALAIFRP |
| Ga0306925_100978322 | 3300031890 | Soil | MKINPIAQNSGWDLCFWFAVSSPLLGVLLGFVAAAIFLSMT |
| Ga0306921_104536072 | 3300031912 | Soil | METNPIAKDSSWNFSFWFAVSSPLLGVLVAILALAIFYR |
| Ga0310916_101282782 | 3300031942 | Soil | MKTNPTAQESSWRVSFWFAVSRPLIGVLLAFLAVAIFLPMIE |
| Ga0310916_117080862 | 3300031942 | Soil | MKTNAIAEESGWRVSFWFAVSSPLIGVLLAFLAAAILCR |
| Ga0310913_100431792 | 3300031945 | Soil | MKINPIAQNSGWDLCFWFAVSSPLLGVLLGFVAAAIF |
| Ga0310913_103666042 | 3300031945 | Soil | NMKTNPTAQESSWRVSFWFAVSRPLIGVLLAFLAVAIFLPMIE |
| Ga0310910_102152072 | 3300031946 | Soil | MKTNPTAQESSWRVSFWFAVSRPLIGVLLAFLAVAIFLPM |
| Ga0306924_106475282 | 3300032076 | Soil | DNIMKTNPIAQDSGWDFSFWFAVSSPLLGVLLAMLALAIFCR |
| Ga0307471_1019716161 | 3300032180 | Hardwood Forest Soil | SMKIKPTTQDSGWDISFWFAVSSPLIGVLLAILALAILRP |
| Ga0307471_1036175573 | 3300032180 | Hardwood Forest Soil | MKTNAIARDSGWNVSFWFAISSPLLGVLLGLLAAAIFC |
| Ga0310810_102097512 | 3300033412 | Soil | MKTNAIAEDSGWDISFWFAVSSPLLGVLLGLLAAAIFCR |
| Ga0247830_103018602 | 3300033551 | Soil | LDNNVETNSIAQDSGWGFSFWFAISSPFVGVLLGLLAAAIVCR |
| ⦗Top⦘ |