


| Basic Information | |
|---|---|
| Family ID | F023678 |
| Family Type | Metagenome |
| Number of Sequences | 209 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VTLLKTLVNLVVATLVGALGDKLFGAWGMLLGFIAGGLAAWWVARRVFD |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 209 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.96 % |
| % of genes near scaffold ends (potentially truncated) | 21.05 % |
| % of genes from short scaffolds (< 2000 bps) | 76.56 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.694 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.761 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.44% β-sheet: 0.00% Coil/Unstructured: 41.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 209 Family Scaffolds |
|---|---|---|
| PF02322 | Cyt_bd_oxida_II | 33.01 |
| PF02594 | DUF167 | 18.66 |
| PF02325 | YGGT | 18.18 |
| PF05899 | Cupin_3 | 5.74 |
| PF01654 | Cyt_bd_oxida_I | 5.74 |
| PF16870 | OxoGdeHyase_C | 2.87 |
| PF02574 | S-methyl_trans | 1.91 |
| PF00850 | Hist_deacetyl | 1.44 |
| PF13428 | TPR_14 | 1.44 |
| PF01344 | Kelch_1 | 1.44 |
| PF06736 | TMEM175 | 0.96 |
| PF13964 | Kelch_6 | 0.96 |
| PF13418 | Kelch_4 | 0.48 |
| PF08281 | Sigma70_r4_2 | 0.48 |
| PF13578 | Methyltransf_24 | 0.48 |
| PF05977 | MFS_3 | 0.48 |
| PF00903 | Glyoxalase | 0.48 |
| PF16576 | HlyD_D23 | 0.48 |
| PF02311 | AraC_binding | 0.48 |
| PF02630 | SCO1-SenC | 0.48 |
| PF01012 | ETF | 0.48 |
| PF12161 | HsdM_N | 0.48 |
| PF00999 | Na_H_Exchanger | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
|---|---|---|---|
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 33.01 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 18.66 |
| COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 18.18 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 5.74 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.87 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 1.91 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 1.91 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.48 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.48 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.48 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.48 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.48 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.48 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.48 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.69 % |
| Unclassified | root | N/A | 4.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1011721 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300002561|JGI25384J37096_10177696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300002562|JGI25382J37095_10056115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
| 3300002909|JGI25388J43891_1073904 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300002911|JGI25390J43892_10028990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1336 | Open in IMG/M |
| 3300003994|Ga0055435_10167146 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 620 | Open in IMG/M |
| 3300004157|Ga0062590_100904922 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005166|Ga0066674_10049562 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300005166|Ga0066674_10118340 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300005166|Ga0066674_10241708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
| 3300005167|Ga0066672_10087299 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300005167|Ga0066672_10259031 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300005172|Ga0066683_10208445 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005174|Ga0066680_10001050 | All Organisms → cellular organisms → Bacteria | 10691 | Open in IMG/M |
| 3300005174|Ga0066680_10029036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3110 | Open in IMG/M |
| 3300005174|Ga0066680_10322140 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005175|Ga0066673_10029162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2634 | Open in IMG/M |
| 3300005175|Ga0066673_10686330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300005186|Ga0066676_10196352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
| 3300005187|Ga0066675_10372442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300005406|Ga0070703_10009948 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
| 3300005445|Ga0070708_100007093 | All Organisms → cellular organisms → Bacteria | 8942 | Open in IMG/M |
| 3300005445|Ga0070708_100356295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1379 | Open in IMG/M |
| 3300005446|Ga0066686_10382133 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005447|Ga0066689_10545102 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005468|Ga0070707_100159445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2198 | Open in IMG/M |
| 3300005537|Ga0070730_10005011 | All Organisms → cellular organisms → Bacteria | 11493 | Open in IMG/M |
| 3300005540|Ga0066697_10403849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 793 | Open in IMG/M |
| 3300005545|Ga0070695_101510719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300005552|Ga0066701_10020837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3255 | Open in IMG/M |
| 3300005553|Ga0066695_10696150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300005553|Ga0066695_10780636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300005555|Ga0066692_10990378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005557|Ga0066704_10085890 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300005557|Ga0066704_10469645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 831 | Open in IMG/M |
| 3300005558|Ga0066698_10820359 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005873|Ga0075287_1049551 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006034|Ga0066656_10174694 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300006034|Ga0066656_10187199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1312 | Open in IMG/M |
| 3300006046|Ga0066652_101016843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300006047|Ga0075024_100822948 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006173|Ga0070716_100898357 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006755|Ga0079222_10454336 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006755|Ga0079222_11798025 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006791|Ga0066653_10198628 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300006800|Ga0066660_10099855 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300006804|Ga0079221_10120161 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300006806|Ga0079220_10163284 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300006806|Ga0079220_10685087 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006846|Ga0075430_100724230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300006852|Ga0075433_10081215 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
| 3300006854|Ga0075425_100382139 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300006871|Ga0075434_100839347 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300007258|Ga0099793_10570293 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300007265|Ga0099794_10388097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300009012|Ga0066710_100412911 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300009012|Ga0066710_101869653 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009012|Ga0066710_103444873 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009012|Ga0066710_103822060 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
| 3300009038|Ga0099829_10039848 | All Organisms → cellular organisms → Bacteria | 3414 | Open in IMG/M |
| 3300009038|Ga0099829_10567539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 943 | Open in IMG/M |
| 3300009090|Ga0099827_10480395 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300009090|Ga0099827_11311762 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009137|Ga0066709_104277525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 520 | Open in IMG/M |
| 3300009143|Ga0099792_10182182 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300009147|Ga0114129_12205206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 663 | Open in IMG/M |
| 3300009162|Ga0075423_11024633 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300009609|Ga0105347_1229974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 756 | Open in IMG/M |
| 3300010304|Ga0134088_10247495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 857 | Open in IMG/M |
| 3300010325|Ga0134064_10218464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 691 | Open in IMG/M |
| 3300010325|Ga0134064_10464266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300010329|Ga0134111_10199741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 808 | Open in IMG/M |
| 3300010335|Ga0134063_10273371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300010335|Ga0134063_10333927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 734 | Open in IMG/M |
| 3300010336|Ga0134071_10062019 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300010359|Ga0126376_11707619 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010362|Ga0126377_10001565 | All Organisms → cellular organisms → Bacteria | 15097 | Open in IMG/M |
| 3300010391|Ga0136847_11443279 | All Organisms → cellular organisms → Bacteria | 3609 | Open in IMG/M |
| 3300010398|Ga0126383_11238552 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300011420|Ga0137314_1170171 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300011421|Ga0137462_1022589 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300011441|Ga0137452_1096694 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300012198|Ga0137364_10564021 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012198|Ga0137364_10653056 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 793 | Open in IMG/M |
| 3300012199|Ga0137383_10011894 | All Organisms → cellular organisms → Bacteria | 5855 | Open in IMG/M |
| 3300012199|Ga0137383_10016325 | All Organisms → cellular organisms → Bacteria | 5072 | Open in IMG/M |
| 3300012199|Ga0137383_10114152 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300012200|Ga0137382_10031668 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
| 3300012200|Ga0137382_10116313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1782 | Open in IMG/M |
| 3300012200|Ga0137382_10937798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300012201|Ga0137365_10089203 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300012201|Ga0137365_10238556 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300012206|Ga0137380_10027633 | All Organisms → cellular organisms → Bacteria | 5227 | Open in IMG/M |
| 3300012206|Ga0137380_10077109 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300012206|Ga0137380_10128459 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300012206|Ga0137380_10192652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1851 | Open in IMG/M |
| 3300012206|Ga0137380_10668317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 904 | Open in IMG/M |
| 3300012207|Ga0137381_10168481 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300012208|Ga0137376_10021332 | All Organisms → cellular organisms → Bacteria | 4980 | Open in IMG/M |
| 3300012208|Ga0137376_11153232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300012208|Ga0137376_11720143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
| 3300012208|Ga0137376_11790547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300012209|Ga0137379_10803262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 845 | Open in IMG/M |
| 3300012210|Ga0137378_10179995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1965 | Open in IMG/M |
| 3300012225|Ga0137434_1051403 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012232|Ga0137435_1107757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300012232|Ga0137435_1220257 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 580 | Open in IMG/M |
| 3300012349|Ga0137387_10024200 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
| 3300012349|Ga0137387_10034788 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
| 3300012349|Ga0137387_10750207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
| 3300012350|Ga0137372_10775082 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012354|Ga0137366_10314965 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300012354|Ga0137366_10329317 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012357|Ga0137384_10238411 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300012357|Ga0137384_10710365 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 816 | Open in IMG/M |
| 3300012359|Ga0137385_10046344 | All Organisms → cellular organisms → Bacteria | 3890 | Open in IMG/M |
| 3300012359|Ga0137385_10124402 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300012360|Ga0137375_10539383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 984 | Open in IMG/M |
| 3300012360|Ga0137375_11169401 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012361|Ga0137360_10187386 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300012362|Ga0137361_11960957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 502 | Open in IMG/M |
| 3300012917|Ga0137395_10327415 | Not Available | 1089 | Open in IMG/M |
| 3300012925|Ga0137419_10844301 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012931|Ga0153915_11381413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 823 | Open in IMG/M |
| 3300014154|Ga0134075_10031553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2154 | Open in IMG/M |
| 3300014157|Ga0134078_10224595 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300014867|Ga0180076_1023347 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300015241|Ga0137418_10910784 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300015359|Ga0134085_10556100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300015371|Ga0132258_11165023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1949 | Open in IMG/M |
| 3300015371|Ga0132258_12735118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300017656|Ga0134112_10434992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300017657|Ga0134074_1018718 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300017659|Ga0134083_10309651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 672 | Open in IMG/M |
| 3300017927|Ga0187824_10171532 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300017959|Ga0187779_10002581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 11066 | Open in IMG/M |
| 3300017959|Ga0187779_10715619 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300017966|Ga0187776_10234578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1167 | Open in IMG/M |
| 3300017973|Ga0187780_10003860 | All Organisms → cellular organisms → Bacteria | 11258 | Open in IMG/M |
| 3300017997|Ga0184610_1175474 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300018027|Ga0184605_10000123 | All Organisms → cellular organisms → Bacteria | 21393 | Open in IMG/M |
| 3300018064|Ga0187773_10092215 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300018071|Ga0184618_10322299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 659 | Open in IMG/M |
| 3300018084|Ga0184629_10080338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1559 | Open in IMG/M |
| 3300018422|Ga0190265_10021117 | All Organisms → cellular organisms → Bacteria | 5200 | Open in IMG/M |
| 3300018431|Ga0066655_10044202 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300018431|Ga0066655_10116022 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300018431|Ga0066655_10814010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
| 3300018431|Ga0066655_11148646 | Not Available | 547 | Open in IMG/M |
| 3300018433|Ga0066667_10095038 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300018468|Ga0066662_10031662 | All Organisms → cellular organisms → Bacteria | 3146 | Open in IMG/M |
| 3300018468|Ga0066662_10569963 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300018468|Ga0066662_11712831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 657 | Open in IMG/M |
| 3300018469|Ga0190270_10937443 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300018482|Ga0066669_10087434 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300018482|Ga0066669_10284034 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300018482|Ga0066669_10725738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300019868|Ga0193720_1039168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 676 | Open in IMG/M |
| 3300021046|Ga0215015_10244844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1194 | Open in IMG/M |
| 3300021088|Ga0210404_10219120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1026 | Open in IMG/M |
| 3300024177|Ga0247686_1051369 | Not Available | 513 | Open in IMG/M |
| 3300024178|Ga0247694_1006059 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300024246|Ga0247680_1066706 | Not Available | 526 | Open in IMG/M |
| 3300024290|Ga0247667_1027703 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300025324|Ga0209640_10319014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1295 | Open in IMG/M |
| 3300025324|Ga0209640_11382215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300025910|Ga0207684_10034819 | All Organisms → cellular organisms → Bacteria | 4277 | Open in IMG/M |
| 3300025922|Ga0207646_11883301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300025996|Ga0208777_1021312 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026295|Ga0209234_1036398 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300026295|Ga0209234_1279879 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300026297|Ga0209237_1032375 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
| 3300026300|Ga0209027_1109211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 980 | Open in IMG/M |
| 3300026318|Ga0209471_1270926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300026328|Ga0209802_1188087 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300026334|Ga0209377_1019926 | All Organisms → cellular organisms → Bacteria | 3441 | Open in IMG/M |
| 3300026524|Ga0209690_1095948 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300026536|Ga0209058_1242615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300026538|Ga0209056_10155978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1739 | Open in IMG/M |
| 3300026548|Ga0209161_10229936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 992 | Open in IMG/M |
| 3300026551|Ga0209648_10022359 | All Organisms → cellular organisms → Bacteria | 5522 | Open in IMG/M |
| 3300026700|Ga0208474_101181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 718 | Open in IMG/M |
| 3300027671|Ga0209588_1224628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300027725|Ga0209178_1196131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 713 | Open in IMG/M |
| 3300027846|Ga0209180_10125693 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300027857|Ga0209166_10014583 | All Organisms → cellular organisms → Bacteria | 5009 | Open in IMG/M |
| 3300027882|Ga0209590_10264423 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300028536|Ga0137415_11255954 | Not Available | 557 | Open in IMG/M |
| 3300028796|Ga0307287_10373554 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300028819|Ga0307296_10085201 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300028878|Ga0307278_10357829 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031576|Ga0247727_10143978 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 2325 | Open in IMG/M |
| 3300031576|Ga0247727_10375806 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300031576|Ga0247727_10401120 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300031720|Ga0307469_10013897 | All Organisms → cellular organisms → Bacteria | 4099 | Open in IMG/M |
| 3300031720|Ga0307469_10075161 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300031720|Ga0307469_10301536 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300031753|Ga0307477_10000615 | All Organisms → cellular organisms → Bacteria | 37006 | Open in IMG/M |
| 3300031820|Ga0307473_10040990 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300031820|Ga0307473_10665063 | Not Available | 727 | Open in IMG/M |
| 3300031962|Ga0307479_10760472 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031962|Ga0307479_10967906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 821 | Open in IMG/M |
| 3300032157|Ga0315912_10622998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300032180|Ga0307471_102683305 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032829|Ga0335070_10362871 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300034114|Ga0364938_039271 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.44% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.48% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026700 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN350 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10117213 | 3300002557 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARQVFD* |
| JGI25384J37096_101776962 | 3300002561 | Grasslands Soil | VRLLKALINLVVATLVGALGDKLLGAWGMVLGFIAGGLAAWWVARRVFDG* |
| JGI25382J37095_100561152 | 3300002562 | Grasslands Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFN* |
| JGI25388J43891_10739042 | 3300002909 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARRVFD* |
| JGI25390J43892_100289903 | 3300002911 | Grasslands Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0055435_101671462 | 3300003994 | Natural And Restored Wetlands | LVNLVVATLVSVAGEKVLGPWGMILGFIAGGVAGWWVVQRFFDA* |
| Ga0062590_1009049222 | 3300004157 | Soil | VKLLKALVNLIVATLVGVAGDKLFGPWGMILGFIAGGLAGWWVAQRFLDL* |
| Ga0066674_100495623 | 3300005166 | Soil | MTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0066674_101183403 | 3300005166 | Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVGRRIFDE* |
| Ga0066674_102417082 | 3300005166 | Soil | VRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRMFDS* |
| Ga0066672_100872993 | 3300005167 | Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRVFD* |
| Ga0066672_102590312 | 3300005167 | Soil | MKLLKTLVNLVVATVVSTLGSKLFGAWGMILGFVAGGLAAWWVARRVFD* |
| Ga0066683_102084452 | 3300005172 | Soil | VNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0066680_100010504 | 3300005174 | Soil | VRLLKTLVNLIVATLVGALGNNWFGAWGLVVGFIAGGLAAWWVARRVFD* |
| Ga0066680_100290363 | 3300005174 | Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVGRRIIDE* |
| Ga0066680_103221403 | 3300005174 | Soil | MRLLKALINLIVGTLVGALGNQVFGAWGLVLGFIAGGLAAWWVARRLFE* |
| Ga0066673_100291622 | 3300005175 | Soil | VKLLKALINLIVATLVGAAGDKVLGAWGMVLGFIAGGVAAWWIARRVFDA* |
| Ga0066673_106863302 | 3300005175 | Soil | MTLLKTLVNLVVGTLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0066676_101963522 | 3300005186 | Soil | GRGRVKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVGRRIFDE* |
| Ga0066675_103724422 | 3300005187 | Soil | VTLLKALVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0070703_100099482 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLKALINLIVGTLVGALGNQLFGAWGLVLGFIAGGVAAWWVARRLFE* |
| Ga0070708_1000070936 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLLKALVNFVVATLMGALGNALFGGWGLLIGFVAGGVSAWWVARRIFDE* |
| Ga0070708_1003562954 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLKTLVNLVVATLVSALGDKLFGAWGMVLGFIAGGLAAWWVAQRVST* |
| Ga0066686_103821333 | 3300005446 | Soil | VKLLKVLVNFVVATLVGALGNALFGGWGLLIGFVAGGVSAWWVARRIFDE* |
| Ga0066689_105451021 | 3300005447 | Soil | VRLLKALINLVVATLVGALGDKLLGAWGMVLGFIAGGLAA |
| Ga0070707_1001594452 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLLKALINLIVATLVGALGNQVFGAWGLVLGFIAGGVAAWWVARRLFE* |
| Ga0070730_100050111 | 3300005537 | Surface Soil | MKLLKGLVNLIVATLVGALGDKLIGPWGMLLGFIAGGIAGWWVVQKFDF* |
| Ga0066697_104038491 | 3300005540 | Soil | LLKTLVNLIVATLVGAMGDKVFGAWGLVLGFIAGGVAAWWVARHLP* |
| Ga0070695_1015107191 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLKGLVNLIVATLVSALGDKLIGPWGMLLGFIAGGIAGWWVVQKFDF* |
| Ga0066701_100208373 | 3300005552 | Soil | VRLLKTLVNLIAATLVGALGNNWFGAWGLVVGFIAGGLAAWWVARRVFD* |
| Ga0066695_106961501 | 3300005553 | Soil | VVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVGRRIFDE* |
| Ga0066695_107806361 | 3300005553 | Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGL |
| Ga0066692_109903783 | 3300005555 | Soil | VKLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWW |
| Ga0066704_100858903 | 3300005557 | Soil | VKLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRVFDT* |
| Ga0066704_104696452 | 3300005557 | Soil | VRLLKALINLVVATLVGALGDKLLGAWGMVLGFIAGGLAAWWVARRVFDW* |
| Ga0066698_108203592 | 3300005558 | Soil | VTLLKALVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFA* |
| Ga0075287_10495512 | 3300005873 | Rice Paddy Soil | VRLLKTLVNLVVATLVSALGSKLLGAWGMILGFVAGGLAAWWVARNVFDA* |
| Ga0066656_101746944 | 3300006034 | Soil | VRLLKTLVNLIVATLVGALGNNWFGAWGLVVGFIAGGLAAWWV |
| Ga0066656_101871994 | 3300006034 | Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVVGGVSAWWV |
| Ga0066652_1010168432 | 3300006046 | Soil | VRLLKTLVNLVVATLVGALGDKLFGASGMVLGFIAGGLAAWWVARRVST* |
| Ga0075024_1008229481 | 3300006047 | Watersheds | VRLLKTLVSFVVATLVGALGDQLFGAFGMIVGFIAGGVAAWWVARRIMDG* |
| Ga0070716_1008983572 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLLKTLVNLIVATLVGALGDKVFGAWGLVLGFIAGGVAAWWVARHLP* |
| Ga0079222_104543363 | 3300006755 | Agricultural Soil | MRLLKALINLIVGTLVGALGNQVFGAWGLVLGFIAGGVAAWWVARRLFE* |
| Ga0079222_117980252 | 3300006755 | Agricultural Soil | VRLLKTLVSFVVATLVGVLGNQLFGAFGMVVGFVACGVAAWWVARRIMDG* |
| Ga0066653_101986283 | 3300006791 | Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVGGGVSAWWVGRRIFDE* |
| Ga0066660_100998553 | 3300006800 | Soil | MRLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARRVFD* |
| Ga0079221_101201611 | 3300006804 | Agricultural Soil | VRLLKTLVNLIVATLVGALGDKVFGAWELVLGFIAGGVAAWWVARHLP* |
| Ga0079220_101632842 | 3300006806 | Agricultural Soil | VRLLKTLVNLIVATLVGTLGDKVFGAWGLVLGFIAGGVAAWWVARHLP* |
| Ga0079220_106850873 | 3300006806 | Agricultural Soil | VKLLKLLVNVIVATLVGALGSKLLGAWGMIVGFVAGGLAAWWVARKVFDG* |
| Ga0075430_1007242302 | 3300006846 | Populus Rhizosphere | MRLLKTLVNLVVATIVGALGNQLFGAWGMLLGFIAGGLAAWWVAKRVFD* |
| Ga0075433_100812154 | 3300006852 | Populus Rhizosphere | VRLLKTLVSFVVATLVGVLGNQLFGAFGMVVGFVAGGVAAWWVARRIMDG* |
| Ga0075425_1003821391 | 3300006854 | Populus Rhizosphere | MRLLKALINLIVGTLVGALGNQVFGAWGLVLGFIAGGVAAWW |
| Ga0075434_1008393472 | 3300006871 | Populus Rhizosphere | VRLLKTLVSFVVATLVGVLGNQLFGAFGMVVGFVAGGVAAWWVARRIMDD* |
| Ga0099793_105702932 | 3300007258 | Vadose Zone Soil | MKLLKGLINLVVATLVGAAGEKVLGAWGMILGFIAGGLAAWWVVRRYFDF* |
| Ga0099794_103880972 | 3300007265 | Vadose Zone Soil | MRLLKLLVNFVVATVVGVLGNGLLGPWGLVVGFVAGGWAGWWVARRLT* |
| Ga0066710_1004129113 | 3300009012 | Grasslands Soil | VNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD |
| Ga0066710_1015291281 | 3300009012 | Grasslands Soil | ATLVGALGDKLFGVWGMLLGFIAGGLAAWWAARRVFD |
| Ga0066710_1018696533 | 3300009012 | Grasslands Soil | VKLLKVLVNFVVATLVGVLGNALFGGWGLLIGFVVGGVSAWWVARRIFDE |
| Ga0066710_1034448731 | 3300009012 | Grasslands Soil | VRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVAR |
| Ga0066710_1038220602 | 3300009012 | Grasslands Soil | VKLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRMFDT |
| Ga0099829_100398483 | 3300009038 | Vadose Zone Soil | MRLLKLLVNFVVATVVGAVGNALVGPWGLVVGFVAGGWAGWWVARRLFT* |
| Ga0099829_105675392 | 3300009038 | Vadose Zone Soil | MKLLKLLVNLIVATLVGALGDKLLGAWGMLLGFLAGGIAGWWVVRRLDV* |
| Ga0099827_104803953 | 3300009090 | Vadose Zone Soil | MRLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRMFDG* |
| Ga0099827_113117621 | 3300009090 | Vadose Zone Soil | MRLLKTLVNLVVATLVGVLGDRLFGGWGMLLGFIAGGLAAWWVARRVFET* |
| Ga0066709_1042775251 | 3300009137 | Grasslands Soil | VKLLKALINLIVATLVGAAGDKAQVAWGMVLGFIAGGVAAWWIARRVFDA* |
| Ga0099792_101821822 | 3300009143 | Vadose Zone Soil | VKLLKALVNLVVATLVSAGGEKLFGPWGMILGFIAGGLAGWWVVKRYFDF* |
| Ga0114129_122052062 | 3300009147 | Populus Rhizosphere | MKLLKTLVNLVVATIVGALGNQLFGAWGMLLGFIAGGLAAWWVAKRVFD* |
| Ga0075423_110246333 | 3300009162 | Populus Rhizosphere | VTLLKTLVNFIVATIAGAIGNTLFGPWGMILGFIAGGVAGWWVAKRVFE* |
| Ga0105347_12299743 | 3300009609 | Soil | LKLLKALVNLVVATLVSVGGEKVLGPWGMILGFIAGGVAGWWVMQRFFDA* |
| Ga0134088_102474952 | 3300010304 | Grasslands Soil | AVRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRMFDS* |
| Ga0134064_102184642 | 3300010325 | Grasslands Soil | MTLLKTLVNLVVATLVGAMGDKLFGVWGMLLGFIAGGLAAWWVARRVFA* |
| Ga0134064_104642661 | 3300010325 | Grasslands Soil | VKLLKALINLIVATLVGAAGDKVLGAWGMVLGFIAGGVAA |
| Ga0134111_101997411 | 3300010329 | Grasslands Soil | VVATLVGVLGNALFGGWGLLIGFVVGGVSAWWVARRIFDE* |
| Ga0134063_102733712 | 3300010335 | Grasslands Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFA* |
| Ga0134063_103339271 | 3300010335 | Grasslands Soil | GALGNTLFGGWGLLIGFVAGGVSAWWVGRRIFDE* |
| Ga0134071_100620194 | 3300010336 | Grasslands Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVVGGVSAWWVARRIFDE* |
| Ga0126376_117076192 | 3300010359 | Tropical Forest Soil | VRLLKTLVSFVVATLVGALGNQLFGAFGMVVGFVAGGVAAWWVARRITDG* |
| Ga0126377_100015654 | 3300010362 | Tropical Forest Soil | MKLLKALVNLIVATLVSVAGEKVFGVWGMLLGFIAGGLAAWWVGQRFLDL* |
| Ga0136847_114432792 | 3300010391 | Freshwater Sediment | VRLLKILVNLIVATLVGVAGEKLLGAWGLILGFIAGGVAAWWVARRMQQ* |
| Ga0126383_112385521 | 3300010398 | Tropical Forest Soil | VRLLKTLVSLVVATLVGVLGNQLFGAFGMVVGFVAGGVAAWWVARRV |
| Ga0137314_11701711 | 3300011420 | Soil | LKLLKALVNLVVATLVSVGGEKVLGPWGMILGFIAGGVAGWWV |
| Ga0137462_10225894 | 3300011421 | Soil | LKLLKALVNLVVATLVSVGGEKVLGPWGMILGFIAGGVAGWWVVQRFFDA* |
| Ga0137452_10966941 | 3300011441 | Soil | LKLLKALVNLVVATLVSVGGEKVLGPWGMILGFIAGGVAGWWVMQRF |
| Ga0137364_105640211 | 3300012198 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWW |
| Ga0137364_106530561 | 3300012198 | Vadose Zone Soil | LKTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRVFD* |
| Ga0137383_100118944 | 3300012199 | Vadose Zone Soil | MRLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRVFDA* |
| Ga0137383_100163253 | 3300012199 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALGEKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0137383_101141522 | 3300012199 | Vadose Zone Soil | VKLLKALINLIVATLVGAAGDKVLGAWGMVLGFIAGGLAAWWIARRVFDA* |
| Ga0137382_100316683 | 3300012200 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALADRLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0137382_101163131 | 3300012200 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARR |
| Ga0137382_109377981 | 3300012200 | Vadose Zone Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAW |
| Ga0137365_100892034 | 3300012201 | Vadose Zone Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVVRRIFDE* |
| Ga0137365_102385562 | 3300012201 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALGETLFGVWGMLLGFIAGGLAAWWVARRMFD* |
| Ga0137380_100276333 | 3300012206 | Vadose Zone Soil | MRLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRMFDT* |
| Ga0137380_100771092 | 3300012206 | Vadose Zone Soil | VKLLKVLVNFVVATLVGALGNALFGGWGLLIGFVAGGVSAWWVGRRIFDE* |
| Ga0137380_101284593 | 3300012206 | Vadose Zone Soil | VRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRVST* |
| Ga0137380_101926521 | 3300012206 | Vadose Zone Soil | LLVNFVVATLVGALGNALFGGWGLLIGFVAGGMSAWWVARRLFDA* |
| Ga0137380_106683172 | 3300012206 | Vadose Zone Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFIAGGLAAWWVARRVFD* |
| Ga0137381_101684813 | 3300012207 | Vadose Zone Soil | VKLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRMFDT* |
| Ga0137376_100213324 | 3300012208 | Vadose Zone Soil | MRLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWVARRVFDG* |
| Ga0137376_111532323 | 3300012208 | Vadose Zone Soil | VKLLKALINLIVATLVGAAGDKVLGAWGMVLGFIAGGLAAWWIA |
| Ga0137376_117201431 | 3300012208 | Vadose Zone Soil | VKLLKALINLIVATLIGAAGDKVLGAWGMVLGFIAGGVAAWWIARRVFDA* |
| Ga0137376_117905472 | 3300012208 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALADKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0137379_108032622 | 3300012209 | Vadose Zone Soil | MKLLKGLVNLIVATLVGALGDKLIGPWGMLLGFIAGGIAGWWVVRKFDF* |
| Ga0137378_101799952 | 3300012210 | Vadose Zone Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRMFD* |
| Ga0137434_10514032 | 3300012225 | Soil | VKLLKALVSFVVATLVGAAGHKLLGTFGLVLGFVVGGIAAWWVARRLS* |
| Ga0137435_11077572 | 3300012232 | Soil | VKLLKGLVNLVVATLVSVAGEKLFGPWGMILGFIAGGLAGWWVAQRYVDF* |
| Ga0137435_12202572 | 3300012232 | Soil | LKLLKALVNLVVATLVSVGGEKVLGPWGMILGLIAGGVAGWWVMQRFFDA* |
| Ga0137387_100242004 | 3300012349 | Vadose Zone Soil | VKLLKVLVNFVAATLVGALGNTLFGGWGLLIGFIAGGVSAWWVARRIFDE* |
| Ga0137387_100347882 | 3300012349 | Vadose Zone Soil | MRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRMFDS* |
| Ga0137387_107502072 | 3300012349 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALGDKLFGAWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0137372_107750822 | 3300012350 | Vadose Zone Soil | VRLLKILVNLVAATLAGALGSKLFGAWGVIVGFVAGGVAAWWVGRRVFDG* |
| Ga0137366_103149654 | 3300012354 | Vadose Zone Soil | VRLLKVLVNLVVATLAGALGSKLFGAWGVIVGFVAGGVAAWWVGRRVFDA* |
| Ga0137366_103293172 | 3300012354 | Vadose Zone Soil | VKLLKVLVNFVAATLVGALGNALFGGWGLLIGFVAGGVSAWWVARRIFDE* |
| Ga0137384_102384113 | 3300012357 | Vadose Zone Soil | VTLLKTLVNLVVATLVGALGEKLFGVWGMLLGFIAGGLAAWWVARRVVD* |
| Ga0137384_107103651 | 3300012357 | Vadose Zone Soil | KLLKTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRMFD* |
| Ga0137385_100463444 | 3300012359 | Vadose Zone Soil | MKLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRMFDT* |
| Ga0137385_101244021 | 3300012359 | Vadose Zone Soil | VLVNFVVATLVGALGNALFGGWGLLIGFLAGGVSAWWVARRIFDE* |
| Ga0137375_105393832 | 3300012360 | Vadose Zone Soil | MRLLKTLVNLTVGTIVGALGDRLFGGWGALLGFIAGGLAAWWVARRVFDW* |
| Ga0137375_111694012 | 3300012360 | Vadose Zone Soil | MRLLKALVNLSVATVVGALGDRLFGAWGALLGFIAGGVAAWWVARRVFDW* |
| Ga0137360_101873861 | 3300012361 | Vadose Zone Soil | DPPRAARDLRVKLLKALINLIVATLVGAAGDKVLGAWGMVLGFIAGGVAAWWIVRRVFDA |
| Ga0137361_119609572 | 3300012362 | Vadose Zone Soil | LVNLVVATLVGAAGEKLLGAWGMILGFIAGGLAGWWVGRRVFDA* |
| Ga0137395_103274151 | 3300012917 | Vadose Zone Soil | MKLLKGLINLVVATLVGAAGEKVFGAWGMILGFIAGGLAAWWVVRRYFDL* |
| Ga0137419_108443013 | 3300012925 | Vadose Zone Soil | MLVNLVVATLVSAAGDKLFGPWGLVLGFIAGGVAAWWVARRMFDV* |
| Ga0153915_113814132 | 3300012931 | Freshwater Wetlands | VRLLKILVNLVVATLVSALGSKLFGAWGLIAGFVAGGVAAWWVAARVFD* |
| Ga0134075_100315534 | 3300014154 | Grasslands Soil | MKLLKALVNLVVATVVAALGNQVFGAWGLLVGFIAGGLAAWWVGRQVFE* |
| Ga0134078_102245951 | 3300014157 | Grasslands Soil | MTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAG |
| Ga0180076_10233472 | 3300014867 | Soil | LKLLKALVNLVVATLVSVGGEKLLGPWGMILGFIAGGVAVWWVMQRFFDA* |
| Ga0137418_109107842 | 3300015241 | Vadose Zone Soil | MRLLKTLVNLVVATLVGALGNALFGAWGMLLGFLAGGLAAWWVARRIWE* |
| Ga0134085_105561003 | 3300015359 | Grasslands Soil | TLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD* |
| Ga0132258_111650234 | 3300015371 | Arabidopsis Rhizosphere | VKLLKFLVNLVVATLVSALGSKLLGAWGMVLGFIAGGVAAWWVARRMFDV* |
| Ga0132258_127351182 | 3300015371 | Arabidopsis Rhizosphere | MRLLKALINLIVGTLVGALGNQMFGAWGLVLGFIAGGVVAWWVARRLFE* |
| Ga0134112_104349922 | 3300017656 | Grasslands Soil | MKLLKALVNLVVATVVAALGNQVFGAWGLLVGFIVGGLAAWWVGRQVFE |
| Ga0134074_10187184 | 3300017657 | Grasslands Soil | VKLLKVLVNFVVATLVGALGNALFGGWGLLIGFVAGGVSAWWVGRRIFDE |
| Ga0134083_103096512 | 3300017659 | Grasslands Soil | LKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRVFT |
| Ga0187824_101715322 | 3300017927 | Freshwater Sediment | VRLLKTLVSFVVATLVGVLGNQLFGAFGMIVGFVAGGVAAWWVARRIMDG |
| Ga0187779_100025815 | 3300017959 | Tropical Peatland | VKLLKTLVNLIVATLVGAGASKVLGAWGMIVGFIAGGLVAWWVARRLLD |
| Ga0187779_107156193 | 3300017959 | Tropical Peatland | VRLLKTLVSFVVATLVGALGNQLFGAFGLVLGFVAGGVAAWWVARRVIDV |
| Ga0187776_102345782 | 3300017966 | Tropical Peatland | VRLLKTLVSFVVATLVGALGDQLFGAFGLVLGFVVGGVAAWWVARRVIDL |
| Ga0187780_100038607 | 3300017973 | Tropical Peatland | VKLLKTLVNLIVATLVGAAASKVLGAWGMIVGFIAGGLVAWWVARRLLD |
| Ga0184610_11754742 | 3300017997 | Groundwater Sediment | VRLLKALIHFIVATVVGALGSQVFGVWGALLGALAGGLASWWVVRRYFQGL |
| Ga0184605_1000012314 | 3300018027 | Groundwater Sediment | VKLLKTLVNLIVATLVGALGDKLFGAWGMMLGFIAGGLAAWWVARRVFD |
| Ga0187773_100922153 | 3300018064 | Tropical Peatland | MRLLKTLVSFVVATLVGALGDQLIGPFGLVLGFVIGGVAAWWVARRITGD |
| Ga0184618_103222992 | 3300018071 | Groundwater Sediment | VKLLKTLVNLIVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRVFD |
| Ga0184629_100803384 | 3300018084 | Groundwater Sediment | MRLLKTLVNLVVATVVGALGNQLFGAWGMLLGFIAGGLAAWWVAKRVFD |
| Ga0190265_100211172 | 3300018422 | Soil | VKLLKALVNLIVATLVSVGGEKLFGPWGMILGFIAGVVAGWWVVRRYVDF |
| Ga0066655_100442023 | 3300018431 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARRVFD |
| Ga0066655_101160222 | 3300018431 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRVFD |
| Ga0066655_108140102 | 3300018431 | Grasslands Soil | MTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD |
| Ga0066655_111486462 | 3300018431 | Grasslands Soil | VKLLKVLVNFVVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVGRRIFDE |
| Ga0066667_100950382 | 3300018433 | Grasslands Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFA |
| Ga0066662_100316623 | 3300018468 | Grasslands Soil | VRLLKTLVNLIVATLVGALGNNWFGAWGLVVGFIAGGLAAWWVARRVFD |
| Ga0066662_105699633 | 3300018468 | Grasslands Soil | VRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRMFDS |
| Ga0066662_117128312 | 3300018468 | Grasslands Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD |
| Ga0190270_109374432 | 3300018469 | Soil | VKLLKALVNLIVATLVSVGGEKLFGPWGMIVGFIAGGGAGWGVVRRYFDF |
| Ga0066669_100874341 | 3300018482 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVAR |
| Ga0066669_102840341 | 3300018482 | Grasslands Soil | KTLVNLVVATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRVFD |
| Ga0066669_107257382 | 3300018482 | Grasslands Soil | MTLLKTLVNLVVGTLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD |
| Ga0193720_10391682 | 3300019868 | Soil | VKLLKTLVNLIVATLVGALGDKLFGAWGMMLGFIAGGLAAW |
| Ga0215015_102448443 | 3300021046 | Soil | MRLLKLLVNFVVATVVGAVGSALVGPWGLVVGLVAGGWAGWWVARRLFT |
| Ga0210404_102191202 | 3300021088 | Soil | MRLLKTLVNLIVATLVGALGDKLFGAWGMLVGFVAGGLAAWWVARRVFDA |
| Ga0247686_10513693 | 3300024177 | Soil | MKLLKGLVNLIVATLVSALGDKLIGPWGMLLGFVAGGIAGW |
| Ga0247694_10060592 | 3300024178 | Soil | MKLLKGLVNLIVATLVSALGDKLIGPWGMLLGFVAGGIAGWWVVQKFDF |
| Ga0247680_10667062 | 3300024246 | Soil | MKLLKGLVNLIVATLVSALGDKLIGPWGMLLGFIAGGIAGWWVVQKFDF |
| Ga0247667_10277032 | 3300024290 | Soil | VRLLKALINLIVATLVGALGNQVFGAWGLVLGFIAGGVAAWWVARRLFE |
| Ga0209640_103190142 | 3300025324 | Soil | MRLLKTLVNLVVATLVGVLGNNRFGAWGMLLGFIAGGLAAWWVARRVFDE |
| Ga0209640_113822152 | 3300025324 | Soil | MRLLKLLVNFIVATLVSVLGNKLFGTWGMLVGFVAGGVAAWWVVRRMDF |
| Ga0207684_100348193 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLLKALVNFVVATLMGALGNALFGGWGLLIGFVAGGVSAWWVARRIFDE |
| Ga0207646_118833012 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLKTLVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRVST |
| Ga0208777_10213121 | 3300025996 | Rice Paddy Soil | VRLLKTLVNLVVATLVSALGSKLLGAWGMILGFVAGGLAAWWVARNVFDA |
| Ga0209234_10363982 | 3300026295 | Grasslands Soil | MNLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARQVFD |
| Ga0209234_12798791 | 3300026295 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARRV |
| Ga0209237_10323752 | 3300026297 | Grasslands Soil | VRLLKALINLVVATLVGALGDKLLGAWGMVLGFIAGGLAAWWVARRVFDG |
| Ga0209027_11092113 | 3300026300 | Grasslands Soil | MKLLKTLVNLVVATVVSALGSKLFGAWGMILGFVAGGLAAWWVARQVFD |
| Ga0209471_12709261 | 3300026318 | Soil | KLLKTLVNLVVATVVSTLGSKLFGAWGMILGFVAGGLAAWWVARRVFD |
| Ga0209802_11880873 | 3300026328 | Soil | MRLLKALINLIVGTLVGALGNQVFGAWGLVLGFIAGGLAAWWVARRLFE |
| Ga0209375_12414381 | 3300026329 | Soil | ATVVSALGSKLFGAWGMLLGFVAGGLAAWWVARRVFD |
| Ga0209377_10199265 | 3300026334 | Soil | VRLLKTLVNLIAATLVGALGNNWFGAWGLVVGFIAGGLAAWWVARRVFD |
| Ga0209690_10959484 | 3300026524 | Soil | VTLLKTLVNLVVATLVGALGDKLFGVWGMLLGFIAGGLA |
| Ga0209058_12426152 | 3300026536 | Soil | VTLLKALVNLVVATLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFA |
| Ga0209056_101559781 | 3300026538 | Soil | VVATLVGALGNTLFGGWGLLIGFVAGGVSAWWVGRRIFDE |
| Ga0209161_102299361 | 3300026548 | Soil | LVNLVVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRVST |
| Ga0209161_104203892 | 3300026548 | Soil | TLVGALGDKLFGVWGMLLGFIAGGLAAWWVARRVFD |
| Ga0209648_100223596 | 3300026551 | Grasslands Soil | MRLLKLLVNFVVATVVGAVGNGLLGPWGLVVGFVAGGWAGWWVARRLFT |
| Ga0208474_1011812 | 3300026700 | Soil | MRLLKALINLIVGTLVGALGNQVFGAWGLVLGFIAGGVAAWWVARRLFE |
| Ga0209588_12246282 | 3300027671 | Vadose Zone Soil | MRLLKLLVNFVVATVVGVLGNGLLGPWGLVVGFVAGGWAGWWVARRLT |
| Ga0209178_11961313 | 3300027725 | Agricultural Soil | VRLLKTLVNLIVATLVGALGDKVFGAWELVLGFIAGGVAAWWVARHLP |
| Ga0209180_101256932 | 3300027846 | Vadose Zone Soil | MRLLKLLVNFVVATVVGAVGNALVGPWGLVVGFVAGGWAGWWVARRLFT |
| Ga0209166_100145831 | 3300027857 | Surface Soil | MKLLKGLVNLIVATLVGALGDKLIGPWGMLLGFIAGGIAGWWVVQKFDF |
| Ga0209590_102644232 | 3300027882 | Vadose Zone Soil | MRLLKALINLIVATLVGAAGDKLLGAWGMVLGFIAGGLAAWWIARRMFDG |
| Ga0137415_112559542 | 3300028536 | Vadose Zone Soil | MKLLKGLINLVVATLVGAAGEKVLGAWGMILGFIAGGLAAWWVVRRYFDF |
| Ga0307287_103735542 | 3300028796 | Soil | VRLLKALVNLVVATLVGVAGDKVFGPWGMIFGFIAGGLAGWWVAQRFLDS |
| Ga0307296_100852012 | 3300028819 | Soil | VKLFKTLVNLIVATLVGALGDKLFGAWGMVLGFIAGGLAAWWVARRVFD |
| Ga0307278_103578292 | 3300028878 | Soil | VRLLKALVNLVVATLVGVAGDKVFGPWGMILGFIAGGVAGWWVAQRFLDL |
| Ga0247727_101439783 | 3300031576 | Biofilm | VNLIVATLVGVAGEKLLGAWGLILGFIAGGVAAWWVGRRMQQ |
| Ga0247727_103758062 | 3300031576 | Biofilm | LRLLKILVNLIVATLVGVAGEKLLGAWGLILGFIAGGMAAWWVARRVQQ |
| Ga0247727_104011203 | 3300031576 | Biofilm | LRLLKILVNLIVATLVGVAGEKLLGAWGLILGFIAGGVAAWWVARRVQQ |
| Ga0307469_100138974 | 3300031720 | Hardwood Forest Soil | VRLLKTLVSFVVATLVGALGDQLFGAFGMIVGFIAGGVAAWWVARRIMDG |
| Ga0307469_100751612 | 3300031720 | Hardwood Forest Soil | VRLLKTLVNLIVATLVGVLGDKVFGAWGLVLGFIAGGVAAWWVARRVFD |
| Ga0307469_103015361 | 3300031720 | Hardwood Forest Soil | MKLLKLLVNLVVATLVSAAGEQVFGAWGMVLGFIAGGLAAWWVARRVFDA |
| Ga0307477_1000061513 | 3300031753 | Hardwood Forest Soil | MRLLKTLVNLTVATLVGALGNKMLGAWGLVVGVVLGGLAAWWVGRRVFDA |
| Ga0307473_100409903 | 3300031820 | Hardwood Forest Soil | VRLLKTLVSFVVATLVGVLGNQLFGAFGMVVGFVAGGVAAWWVARRIMDG |
| Ga0307473_106650631 | 3300031820 | Hardwood Forest Soil | ALVNLIVGTLVGVLGNNLFGAFGAVLGFIAGGIAAWWVARRVFDA |
| Ga0307479_107604722 | 3300031962 | Hardwood Forest Soil | MRLLKLLVNFVVATVVGAVGNSLFGAWGLVVGFVAGGCAAWWVARRLFS |
| Ga0307479_109679063 | 3300031962 | Hardwood Forest Soil | MRLLKLLVNFVVATIVGAVGNTLFGAWGLVVGFVAGGCVAWWVARRLFS |
| Ga0315912_106229983 | 3300032157 | Soil | VKLLKGLVNLVVATLVSAGGERLFGPWGMILGFIAGGLAGWWVAQRYVDF |
| Ga0307471_1026833052 | 3300032180 | Hardwood Forest Soil | MKLLKLLVNLIVATLVSAAGEKVSGAWGMVLGFIAGGLAAWWVARRVFDA |
| Ga0335070_103628713 | 3300032829 | Soil | MRLLKTLVNLVVATLVGVGATKLIGPWGMMIGFIAGGLAAWWLAQRLFDY |
| Ga0364938_039271_395_541 | 3300034114 | Sediment | VKLLKALVSFVVATLVGAAGHKLLGAFGLVLGFVVGGIAAWWVARRLS |
| ⦗Top⦘ |