


| Basic Information | |
|---|---|
| Family ID | F023228 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 211 |
| Average Sequence Length | 42 residues |
| Representative Sequence | IEAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.417 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.327 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.171 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.393 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF03481 | Sua5_C | 10.43 |
| PF01850 | PIN | 5.69 |
| PF00675 | Peptidase_M16 | 4.27 |
| PF02321 | OEP | 3.79 |
| PF05193 | Peptidase_M16_C | 2.37 |
| PF13354 | Beta-lactamase2 | 2.37 |
| PF00012 | HSP70 | 1.42 |
| PF02646 | RmuC | 0.95 |
| PF01266 | DAO | 0.95 |
| PF03167 | UDG | 0.47 |
| PF00440 | TetR_N | 0.47 |
| PF00070 | Pyr_redox | 0.47 |
| PF03712 | Cu2_monoox_C | 0.47 |
| PF00041 | fn3 | 0.47 |
| PF04264 | YceI | 0.47 |
| PF14742 | GDE_N_bis | 0.47 |
| PF00999 | Na_H_Exchanger | 0.47 |
| PF02543 | Carbam_trans_N | 0.47 |
| PF12840 | HTH_20 | 0.47 |
| PF00139 | Lectin_legB | 0.47 |
| PF00165 | HTH_AraC | 0.47 |
| PF04185 | Phosphoesterase | 0.47 |
| PF01841 | Transglut_core | 0.47 |
| PF03458 | Gly_transporter | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 7.58 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 1.42 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.95 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.47 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.47 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.47 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.47 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.47 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.89 % |
| Unclassified | root | N/A | 7.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101066727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300001413|JGI20180J14839_1006122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300002914|JGI25617J43924_10217137 | Not Available | 638 | Open in IMG/M |
| 3300002917|JGI25616J43925_10189766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300004080|Ga0062385_11116225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300004092|Ga0062389_104860303 | Not Available | 506 | Open in IMG/M |
| 3300004152|Ga0062386_100237200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1443 | Open in IMG/M |
| 3300004152|Ga0062386_100541816 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300004268|Ga0066398_10181937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 545 | Open in IMG/M |
| 3300004479|Ga0062595_101607562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300004612|Ga0068961_1370657 | Not Available | 705 | Open in IMG/M |
| 3300005165|Ga0066869_10086203 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005176|Ga0066679_10604173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300005434|Ga0070709_11509758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
| 3300005444|Ga0070694_101947005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300005468|Ga0070707_101886286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300005529|Ga0070741_10802815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300005536|Ga0070697_100066951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2937 | Open in IMG/M |
| 3300005537|Ga0070730_10783031 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005557|Ga0066704_10560732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300005559|Ga0066700_10139636 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300005568|Ga0066703_10143798 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300006086|Ga0075019_10856596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300006163|Ga0070715_10291610 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300006176|Ga0070765_100760530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 915 | Open in IMG/M |
| 3300006176|Ga0070765_100793719 | Not Available | 895 | Open in IMG/M |
| 3300006755|Ga0079222_11243081 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006893|Ga0073928_11006335 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300007255|Ga0099791_10029016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2417 | Open in IMG/M |
| 3300007255|Ga0099791_10524829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300007265|Ga0099794_10232359 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300007265|Ga0099794_10463668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300007265|Ga0099794_10689579 | Not Available | 544 | Open in IMG/M |
| 3300009038|Ga0099829_10952377 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009038|Ga0099829_11051301 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300009038|Ga0099829_11057528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300009089|Ga0099828_11593688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300009089|Ga0099828_12015322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300009137|Ga0066709_102033321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300009177|Ga0105248_10281786 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300009548|Ga0116107_1060627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300009615|Ga0116103_1001670 | All Organisms → cellular organisms → Bacteria | 9370 | Open in IMG/M |
| 3300009615|Ga0116103_1122160 | Not Available | 648 | Open in IMG/M |
| 3300009631|Ga0116115_1011559 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300009632|Ga0116102_1128049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300009640|Ga0116126_1104549 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300009760|Ga0116131_1045744 | Not Available | 1434 | Open in IMG/M |
| 3300009824|Ga0116219_10765034 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010043|Ga0126380_10565857 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300010046|Ga0126384_11946087 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_63_9 | 561 | Open in IMG/M |
| 3300010048|Ga0126373_10318530 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300010048|Ga0126373_10756724 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300010048|Ga0126373_10855953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300010048|Ga0126373_12532704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010358|Ga0126370_11748339 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010366|Ga0126379_13361974 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010376|Ga0126381_101272479 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300010396|Ga0134126_11305439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300010858|Ga0126345_1020059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300011076|Ga0138574_1165020 | Not Available | 1044 | Open in IMG/M |
| 3300011120|Ga0150983_14885757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300011269|Ga0137392_11041299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300011270|Ga0137391_11537757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300011271|Ga0137393_10042525 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
| 3300011271|Ga0137393_10209606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1646 | Open in IMG/M |
| 3300011271|Ga0137393_11610052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300012198|Ga0137364_10698059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300012199|Ga0137383_10167531 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300012202|Ga0137363_10019694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4499 | Open in IMG/M |
| 3300012202|Ga0137363_10642389 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012202|Ga0137363_11061415 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012205|Ga0137362_11752284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300012350|Ga0137372_10862328 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012379|Ga0134058_1088547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300012381|Ga0134026_1274260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012388|Ga0134031_1071351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300012401|Ga0134055_1261041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300012582|Ga0137358_10703530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012582|Ga0137358_10936834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012683|Ga0137398_10148030 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300012683|Ga0137398_10204596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300012918|Ga0137396_10262221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1275 | Open in IMG/M |
| 3300012923|Ga0137359_10787326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300012927|Ga0137416_10342143 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300012927|Ga0137416_11323205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300012927|Ga0137416_11702763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300012930|Ga0137407_12097107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012931|Ga0153915_12970139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300012948|Ga0126375_12056510 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012961|Ga0164302_11725648 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012984|Ga0164309_11966523 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300014325|Ga0163163_10834586 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300014968|Ga0157379_10523727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300015052|Ga0137411_1213067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300015053|Ga0137405_1274943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2115 | Open in IMG/M |
| 3300015241|Ga0137418_10337861 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300015241|Ga0137418_10681207 | Not Available | 792 | Open in IMG/M |
| 3300016319|Ga0182033_10275949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1377 | Open in IMG/M |
| 3300016341|Ga0182035_12132456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300016357|Ga0182032_10355683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300016404|Ga0182037_10136703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1827 | Open in IMG/M |
| 3300016404|Ga0182037_10394276 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300016404|Ga0182037_10694556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300017929|Ga0187849_1077646 | Not Available | 1457 | Open in IMG/M |
| 3300017929|Ga0187849_1265248 | Not Available | 650 | Open in IMG/M |
| 3300017933|Ga0187801_10178475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300017941|Ga0187850_10436417 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 569 | Open in IMG/M |
| 3300017943|Ga0187819_10060584 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300017943|Ga0187819_10577420 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300017943|Ga0187819_10634736 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017970|Ga0187783_10063959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2712 | Open in IMG/M |
| 3300018012|Ga0187810_10243558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300018020|Ga0187861_10356517 | Not Available | 618 | Open in IMG/M |
| 3300018024|Ga0187881_10320979 | Not Available | 640 | Open in IMG/M |
| 3300018026|Ga0187857_10318914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300018058|Ga0187766_11253967 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300018062|Ga0187784_11656289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300018085|Ga0187772_11000080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300018088|Ga0187771_10163390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1836 | Open in IMG/M |
| 3300018090|Ga0187770_10135907 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300018468|Ga0066662_10326549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1305 | Open in IMG/M |
| 3300019880|Ga0193712_1057337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300020199|Ga0179592_10455959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300020579|Ga0210407_10258618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300020579|Ga0210407_10719909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300020579|Ga0210407_10730419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300020579|Ga0210407_11050528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300020582|Ga0210395_10157573 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300020583|Ga0210401_10199294 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300021171|Ga0210405_10456612 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300021180|Ga0210396_11029453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300021181|Ga0210388_10996284 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021401|Ga0210393_10021178 | All Organisms → cellular organisms → Bacteria | 5055 | Open in IMG/M |
| 3300021404|Ga0210389_10710657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300021405|Ga0210387_10701172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300021420|Ga0210394_11475385 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300021432|Ga0210384_11888905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300021477|Ga0210398_11262470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021479|Ga0210410_11510103 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021559|Ga0210409_10530119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300021559|Ga0210409_10987197 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300021559|Ga0210409_11175860 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021559|Ga0210409_11219715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300024288|Ga0179589_10303080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300024290|Ga0247667_1022255 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300025576|Ga0208820_1060910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1018 | Open in IMG/M |
| 3300025939|Ga0207665_10114230 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300026313|Ga0209761_1277936 | Not Available | 603 | Open in IMG/M |
| 3300026334|Ga0209377_1316693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300026374|Ga0257146_1048874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300026529|Ga0209806_1203177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300026538|Ga0209056_10062172 | All Organisms → cellular organisms → Bacteria | 3258 | Open in IMG/M |
| 3300026551|Ga0209648_10139013 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300026557|Ga0179587_10556012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300026557|Ga0179587_11025650 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026783|Ga0207778_116455 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027648|Ga0209420_1059048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300027655|Ga0209388_1009760 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
| 3300027662|Ga0208565_1213678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300027671|Ga0209588_1123779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300027671|Ga0209588_1211751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300027680|Ga0207826_1118329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300027727|Ga0209328_10247733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300027745|Ga0209908_10044362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300027768|Ga0209772_10125131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300027842|Ga0209580_10045796 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300027855|Ga0209693_10355841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300027862|Ga0209701_10076616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2111 | Open in IMG/M |
| 3300027862|Ga0209701_10105912 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300027911|Ga0209698_10297196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1279 | Open in IMG/M |
| 3300028072|Ga0247675_1056835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300028877|Ga0302235_10411747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300028906|Ga0308309_11232795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300030707|Ga0310038_10229534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 870 | Open in IMG/M |
| 3300031128|Ga0170823_15241243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1105427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300031544|Ga0318534_10877488 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031546|Ga0318538_10593653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300031708|Ga0310686_110237351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3693 | Open in IMG/M |
| 3300031718|Ga0307474_11359601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300031753|Ga0307477_10354234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300031754|Ga0307475_10041629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3407 | Open in IMG/M |
| 3300031754|Ga0307475_10945235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031754|Ga0307475_11339075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031763|Ga0318537_10159319 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031768|Ga0318509_10191577 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300031771|Ga0318546_10077677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2135 | Open in IMG/M |
| 3300031823|Ga0307478_10539365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| 3300031860|Ga0318495_10480740 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031910|Ga0306923_12400284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031945|Ga0310913_10436895 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031954|Ga0306926_11962869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300031959|Ga0318530_10321764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300031962|Ga0307479_10923135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031962|Ga0307479_11236966 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031981|Ga0318531_10295361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300031981|Ga0318531_10494750 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032025|Ga0318507_10555101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300032180|Ga0307471_100465889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1406 | Open in IMG/M |
| 3300032205|Ga0307472_102588922 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032261|Ga0306920_104130522 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032782|Ga0335082_10290134 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300032782|Ga0335082_11638228 | Not Available | 517 | Open in IMG/M |
| 3300032783|Ga0335079_11296888 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300032828|Ga0335080_10745927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300032892|Ga0335081_10548488 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300032897|Ga0335071_10038263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4751 | Open in IMG/M |
| 3300033134|Ga0335073_10368464 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300033289|Ga0310914_11011992 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300033289|Ga0310914_11416686 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300034091|Ga0326724_0049170 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.32% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.47% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1010667271 | 3300000364 | Soil | DKLIEYGKYAQVMAFPGRGHGVSDPPARIILMNRVTQFFMENLGQGN* |
| JGI20180J14839_10061222 | 3300001413 | Arctic Peat Soil | GIYVEVLPFPGRGHGVNDPLARRVLMNRVTQFFLDNL* |
| JGI25617J43924_102171372 | 3300002914 | Grasslands Soil | DLIEAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| JGI25616J43925_101897661 | 3300002917 | Grasslands Soil | LSVINDLIELGKYVEVLAFPGRGHGVSDPPAQRVLMQRVTQFFLDNL* |
| Ga0062385_111162252 | 3300004080 | Bog Forest Soil | LNAAIAAGKAIEVMPFPGLGHGINDPNARRLMMERVTTFFLDNL* |
| Ga0062389_1048603031 | 3300004092 | Bog Forest Soil | KAGKYVEVISVPGRGHPISDPPARRIVFNRVTQFFVDNL* |
| Ga0062386_1002372004 | 3300004152 | Bog Forest Soil | SNTLALIDDLIKAGKYVEVMAFPGRGHGVSDLPAERLLWNRVTKFFLDNL* |
| Ga0062386_1005418163 | 3300004152 | Bog Forest Soil | INDLIEAGKYVEVLPFPGRGHGVSDPPARRVLMQRVVQFFTDNL* |
| Ga0066398_101819371 | 3300004268 | Tropical Forest Soil | QHGKYVEVMTFPGRGHGVSDPPARMVLMNRVTQFFLENLGQVH* |
| Ga0062595_1016075622 | 3300004479 | Soil | DDLMAKGKSVEVMPFPGRGHGVSDPPARIILMKRVTKFFVDNLMTGKN* |
| Ga0068961_13706573 | 3300004612 | Peatlands Soil | DDLVKAGKYVEVMALPGREHELSDPPAQRLLWDRVTKFFLDNL* |
| Ga0066869_100862031 | 3300005165 | Soil | TLSLIDQLIKDGKYVEVMPFPGRGHGVSDTPARRVLMNRVTQFFLDNL* |
| Ga0066679_106041731 | 3300005176 | Soil | LAVINDLIEAGKYVEVLPFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0070709_115097581 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ELIESGKYVEVMPFPGRGHGVSDPPARSVLMERVTQFFLDNL* |
| Ga0070694_1019470052 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | HGKYVEVMPFPGRGHGVSDPPARIVLMNRVTQFFLENLGQVH* |
| Ga0070707_1018862862 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAGKYVEVLAFPGRGHGVSDPPARRVLMQKVTQFFLDNL* |
| Ga0070741_108028153 | 3300005529 | Surface Soil | IEKKKYVEVMPFPGRGHGVSDSAARIVLMNRVTQYFLKNLAMN* |
| Ga0070697_1000669511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EKGKDVGVLPFPGRGHGVSDAPARIFLMNRVTQFFVENLGAQQ* |
| Ga0070730_107830312 | 3300005537 | Surface Soil | FPGRGHGVSDPPARIVLMNRATKFFVDNLMPAKN* |
| Ga0066704_105607321 | 3300005557 | Soil | KGKSVEVMPFPGRGHGVSDPPARIVLMNLVTKFFANNLAAK* |
| Ga0066700_101396362 | 3300005559 | Soil | VDNLLAKGKSVEVMLFPGRGHGVSDPPARIALMKRVTKFFVDNLMPAKN* |
| Ga0066703_101437981 | 3300005568 | Soil | EAGKYVEILPFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0075019_108565961 | 3300006086 | Watersheds | SAKRVEVPAFPGRGHGVSDPPVRRVLMQCVAQFFLDNL* |
| Ga0070715_102916102 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0070765_1007605301 | 3300006176 | Soil | AVINELIENEKYVEVIALPGRGHGPTDPEARVVLWNRVTKYFLDNL* |
| Ga0070765_1007937191 | 3300006176 | Soil | ELIKAGKYVEVISVPGRGHPVSDPPARRMVFTRVTQFFVDNL* |
| Ga0079222_112430812 | 3300006755 | Agricultural Soil | AGKYVEILPFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0073928_110063351 | 3300006893 | Iron-Sulfur Acid Spring | NGKYVEVMPFPGRGHGVSDAPARRLLMERVTRFFLDNL* |
| Ga0099791_100290161 | 3300007255 | Vadose Zone Soil | ELIEHEKYVEVMPFPGRGHGVSDAPARKVLMNRVTQFFLDNL* |
| Ga0099791_105248292 | 3300007255 | Vadose Zone Soil | GKYVEVMAFPGRGHGVSDPPAQRILWERVTKFFTDNL* |
| Ga0099794_102323591 | 3300007265 | Vadose Zone Soil | GKYIEVMAFPGRGHGVSDPPAQRILWERVTKFFTDNL* |
| Ga0099794_104636682 | 3300007265 | Vadose Zone Soil | LIDDLIRDGKYVEVMAFPGRGHGVSDPPAQHLLWERVTKFFTDNL* |
| Ga0099794_106895792 | 3300007265 | Vadose Zone Soil | GKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0099829_109523771 | 3300009038 | Vadose Zone Soil | NDLIEAGKYVEVLAFPGRGHGVSDPPARRVLMLRVTQFFLDNL* |
| Ga0099829_110513012 | 3300009038 | Vadose Zone Soil | LSLINKLIELGKYVEVMPFPGRGHGVSDPAARKVLMNRVTQFFLDNL* |
| Ga0099829_110575281 | 3300009038 | Vadose Zone Soil | NKLIELGKYVEVMPFPGRGHGVSDLAAHKLLMNRVTQFFLDNL* |
| Ga0099828_115936882 | 3300009089 | Vadose Zone Soil | LIELGKYAEVMPFPGRGHGVSDAAARKVLMNRVTQFFLDNL* |
| Ga0099828_120153222 | 3300009089 | Vadose Zone Soil | IEAGKYVEVLAFPGRGHGVSDPPAERVLRQRVTQFFLDNL* |
| Ga0066709_1020333213 | 3300009137 | Grasslands Soil | AGKYVEVLAFPGRGHGVGDPPARRVLMQRVAQFFLDNL* |
| Ga0105248_102817861 | 3300009177 | Switchgrass Rhizosphere | IDKLIEHGKYVEVMPFPGRGHGVSDPPARIVLMNRVTQFFLENLGQVH* |
| Ga0116107_10606273 | 3300009548 | Peatland | SNTLALVDDLIKAGKYVEVLAFPGRGHGVSDLPAERVLWNRVTKFFLDNL* |
| Ga0116103_100167014 | 3300009615 | Peatland | TLALVDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTQFFLDNL* |
| Ga0116103_11221601 | 3300009615 | Peatland | TLALVDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTKFFLDNL* |
| Ga0116115_10115594 | 3300009631 | Peatland | KAGKYVEVMAFPGRGHGVSDLAAERVLWNRVTKFFLDNL* |
| Ga0116102_11280491 | 3300009632 | Peatland | LVLIDDLVKAGKYVEVMALPGRGHEVSDPPAQRLLWDRVTKFFLDNL* |
| Ga0116126_11045492 | 3300009640 | Peatland | KAGKYVEVLALPGRGHEMSDPPAQRLLWDRVTKFFLDNL* |
| Ga0116131_10457444 | 3300009760 | Peatland | LVDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTQFFLDNL* |
| Ga0116219_107650341 | 3300009824 | Peatlands Soil | ALIDDLIKAGKYVEVMPFPGRGHGVSDLPAQRVLWNRVAKFFLDNL* |
| Ga0126380_105658572 | 3300010043 | Tropical Forest Soil | LDKLIERGKYAEVLPFPGRGHGVSDAPARILLMDRVTEFFLENLGPGH* |
| Ga0126384_119460871 | 3300010046 | Tropical Forest Soil | GKYAEVIPFPGRGHGVSDPPARIVLMNRATRFFIENLMPNKN* |
| Ga0126373_103185301 | 3300010048 | Tropical Forest Soil | GKYVEVIAAPGRGHGVSDPPARKIVWNRVTQFFLDNL* |
| Ga0126373_107567241 | 3300010048 | Tropical Forest Soil | YVEVLPFPGRGHGVSNPPARRILMNRVMQFFLDNL* |
| Ga0126373_108559532 | 3300010048 | Tropical Forest Soil | AGKYVEVMTFPGRGHDLNDPPAESVLWNRVTQFFLDNL* |
| Ga0126373_125327042 | 3300010048 | Tropical Forest Soil | IQDGKYVEVITVPGRGHEVRDLPASKMVWNRVTQFFLDNL* |
| Ga0126370_117483392 | 3300010358 | Tropical Forest Soil | AHGKDVEVMPFPGRGHGVSDPPARIVLMERATRFFEENLGKR* |
| Ga0126379_133619742 | 3300010366 | Tropical Forest Soil | YVEVMPFPGRGHGVSDPPARIVLMTRVTQFFLEHLGQVH* |
| Ga0126381_1012724791 | 3300010376 | Tropical Forest Soil | KTLAVINDLIGAGKYIEVMAFPGRGHGVSDVPAQRLLWERVTKFFLDNL* |
| Ga0134126_113054391 | 3300010396 | Terrestrial Soil | TLALIDELIESGKYVEVMPFPGRGHGVSDLPARRVLMTRVTQFFLDNL* |
| Ga0126345_10200591 | 3300010858 | Boreal Forest Soil | LSLINELIENGKYVEVMPFPGRGHGVSDPPARKVLMNRVTQFFLDNL* |
| Ga0138574_11650203 | 3300011076 | Peatlands Soil | YVEVMALPGREHELSDPPAQRLLWDRVTKFFLDNL* |
| Ga0150983_148857572 | 3300011120 | Forest Soil | SLINELIEHGKYVEVMPFPGRGHGVSDPPARKVLMNRVTQFFLDNL* |
| Ga0137392_110412991 | 3300011269 | Vadose Zone Soil | YVEVLAFPGRGHGVGDPPARRVLMQRVAQFFLDDL* |
| Ga0137391_115377572 | 3300011270 | Vadose Zone Soil | IEKGKDVEVLPFPGRGHGVSDAPARIFLMNRVTQFFVENLGQGQ* |
| Ga0137393_100425251 | 3300011271 | Vadose Zone Soil | IRDGKYVEVMAFPGRGHGVGDPPAQHLLWERVTKFFTDNL* |
| Ga0137393_102096064 | 3300011271 | Vadose Zone Soil | TLSLINKLIELGKYVEVMPFPGRGHGVSDPAARKVLMNRVTQFFLDNL* |
| Ga0137393_116100521 | 3300011271 | Vadose Zone Soil | INTLVEAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0137364_106980592 | 3300012198 | Vadose Zone Soil | DAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0137383_101675313 | 3300012199 | Vadose Zone Soil | EAGKYVEVLPFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0137363_100196941 | 3300012202 | Vadose Zone Soil | INDLIEAGKYVEVLAFPGRGHGGSDPPARRVLMQRVTQFFLDNL* |
| Ga0137363_106423891 | 3300012202 | Vadose Zone Soil | DGKYVEVMAFPGRGHGVGDPPAQRILWERVTKFFTDNL* |
| Ga0137363_110614152 | 3300012202 | Vadose Zone Soil | SLVDDLIRDGKYVEVMAFPGRGHGVGDPPAQRILWERVTKFFTDNL* |
| Ga0137362_117522842 | 3300012205 | Vadose Zone Soil | GKSVEVLPFPGRGHGVSDPPARIFLMNRVTQFFVENLGPTN* |
| Ga0137372_108623281 | 3300012350 | Vadose Zone Soil | IEEGKSVEVLPFPGRGHGVSDPPARIFLMNRVTQFFLENLGKPN* |
| Ga0134058_10885471 | 3300012379 | Grasslands Soil | GKYAEVMAFPGRGHEVSDPPAQRLLWDRVTKFFLDNL* |
| Ga0134026_12742601 | 3300012381 | Grasslands Soil | LAVINDLIEAGKYVEVLPFPGRGHGVSDPPARRVLMQRVT* |
| Ga0134031_10713511 | 3300012388 | Grasslands Soil | YVEVLPFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0134055_12610412 | 3300012401 | Grasslands Soil | GKYVEILPFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0137358_107035301 | 3300012582 | Vadose Zone Soil | ELIARGKYAEVIPFPGRGHGVSDPPARIVLMNRVTRFFVDNLAPNTN* |
| Ga0137358_109368343 | 3300012582 | Vadose Zone Soil | EFQKYVEVIPFPGRGHGVSDPAARKVLMNRVTQFFLDNL* |
| Ga0137398_101480304 | 3300012683 | Vadose Zone Soil | EAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFIDNL* |
| Ga0137398_102045961 | 3300012683 | Vadose Zone Soil | VMPFPGRGHGVSDPPARVILMKRVTKFFVENLMPAKN* |
| Ga0137396_102622211 | 3300012918 | Vadose Zone Soil | KYAEVLAFPGRGHGVSDPPARRVLMLRVTQFFLDNL* |
| Ga0137359_107873262 | 3300012923 | Vadose Zone Soil | VEVMPFPGRGHGVSDPPARILLMKRVTKFFVENLMPAKN* |
| Ga0137416_103421434 | 3300012927 | Vadose Zone Soil | YVEVMAFPGRGHGVSDPPAQRILWERVTKFFLDNL* |
| Ga0137416_113232051 | 3300012927 | Vadose Zone Soil | KYVEVLAFPGRGHGVSDPPARRVLMLRVTQFFLDNL* |
| Ga0137416_117027632 | 3300012927 | Vadose Zone Soil | GKYVEVMPLPGRGHGASDPAARKVIFNRVTEFFLDNL* |
| Ga0137407_120971071 | 3300012930 | Vadose Zone Soil | GKYVEVLAFPGRGHGVSDPPARRILMQRVTQFFLDNL* |
| Ga0153915_129701392 | 3300012931 | Freshwater Wetlands | AKGKYVEVALFPGRGHPVSDPPARIVLFRRVTQFFLDNL* |
| Ga0126375_120565101 | 3300012948 | Tropical Forest Soil | HGKYPEVLPFPGRGHGVSDPGARILLMNRVAQFFLETLGQAH* |
| Ga0164302_117256482 | 3300012961 | Soil | SLVDKLIELGKDVEVLPFPGRGHGVSDPPARIFLMSRVTQFFVDNLGVLH* |
| Ga0164309_119665232 | 3300012984 | Soil | GKDVEVLPFPGRGHGVSDPPARIFLMSRVTQFFVDNLGVLH* |
| Ga0163163_108345861 | 3300014325 | Switchgrass Rhizosphere | IEKGKYVEMMPFPGRGHGVSDPPARILLMNRVTRFFLENLGEVH* |
| Ga0157379_105237271 | 3300014968 | Switchgrass Rhizosphere | GKYVEVMPFPGRGHGVSDLPARRVLMTRVTQFFLDNL* |
| Ga0137411_12130672 | 3300015052 | Vadose Zone Soil | ELSEAGKYVEVLAFPGRGHGVSDPLARRVLMQRVTQFFLDNL* |
| Ga0137405_12749433 | 3300015053 | Vadose Zone Soil | LVDELIAKGKYVEVMPFPGRGHGVSDPAARTVLMKRVTKFFIDNLTAAKN* |
| Ga0137418_103378614 | 3300015241 | Vadose Zone Soil | SLIDDLIRDGKYVEVMAFPGRGHGVSDPPAQRILWERVTKFFLDNL* |
| Ga0137418_106812073 | 3300015241 | Vadose Zone Soil | YVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL* |
| Ga0182033_102759492 | 3300016319 | Soil | DKLLEKGKYAEVLPFPGRGHGVSDPPARIVLMNRVMQFFLENLGEAR |
| Ga0182035_121324561 | 3300016341 | Soil | ALIDNLIEAGKYVEVITFPGRGHGVSDPKAERVLWNRVTRFFLDNL |
| Ga0182032_103556832 | 3300016357 | Soil | YAEVLPFPGRGHGVSDPPARIVLMNRVMQFFLENLGETH |
| Ga0182037_101367031 | 3300016404 | Soil | SNTLTVINDLIGDGKYVEVIAAPGRGHGVSDPPARKIVWNRVTQFFLDNL |
| Ga0182037_103942761 | 3300016404 | Soil | NDLIGQGKYVEVIAAPGRGHGVSDAAARKVVWNRVTQFFLDNL |
| Ga0182037_106945562 | 3300016404 | Soil | DDGKYVEVMAFPGRGHGVGDPAAQRVLWERVTKFFVDNL |
| Ga0187849_10776461 | 3300017929 | Peatland | TLALVDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTQFFLDNL |
| Ga0187849_12652481 | 3300017929 | Peatland | TLALVDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTKFFLDNL |
| Ga0187801_101784751 | 3300017933 | Freshwater Sediment | DLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTQFFLDNL |
| Ga0187850_104364171 | 3300017941 | Peatland | LIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTKFFLDNL |
| Ga0187819_100605841 | 3300017943 | Freshwater Sediment | TLDVVNDLINDGKYVEVIAAPGRGHGVSDPAARKIVFARATQFFLDNL |
| Ga0187819_105774202 | 3300017943 | Freshwater Sediment | VGEGKYVEVIAVPGRGHGVSDPPARKIVFNRVTQFFLDNL |
| Ga0187819_106347362 | 3300017943 | Freshwater Sediment | DGKYVEVIAVPGRGHGVNDAPARKVVWNRLTQFFLDNL |
| Ga0187783_100639591 | 3300017970 | Tropical Peatland | LAVINDFIDEGKYVEVIAPPGRGHGVNDPAARKVVWTRVTQFFLDNL |
| Ga0187810_102435581 | 3300018012 | Freshwater Sediment | REGKYVEVMAFPGRGHGVSDVPAQRLLWERVTKFFLDNL |
| Ga0187861_103565172 | 3300018020 | Peatland | GKYVEVMAFPGRGHGVSDLPAERVLWNRVTKFFLDNL |
| Ga0187881_103209792 | 3300018024 | Peatland | LVDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTKFFLDNL |
| Ga0187857_103189141 | 3300018026 | Peatland | VDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTQFFLDNL |
| Ga0187766_112539671 | 3300018058 | Tropical Peatland | EGKYVEVIAAPGRGHGVSDPPARKIVFNRVTQFFLDNL |
| Ga0187784_116562892 | 3300018062 | Tropical Peatland | DVINDLIGDGKYVEVIAAPGRGHGVSDPPARKIVWARVMQFFLDNL |
| Ga0187772_110000802 | 3300018085 | Tropical Peatland | INDGKYVEVIAAPGRGHGASDPAARKIIFNRATQFFLDNL |
| Ga0187771_101633902 | 3300018088 | Tropical Peatland | LALIDDLIKAGKYVEVMAFPGRGHGVSDAKAERMLWSRVTQFFLDNL |
| Ga0187770_101359074 | 3300018090 | Tropical Peatland | LINDLIRSGKYVEVIAAPGRGHGVSDPPARKIVFNRVTQFFLDNL |
| Ga0066662_103265491 | 3300018468 | Grasslands Soil | AGKYVEVLAFPGRGHGVSDPPARRLLMQRVTQFFLDNL |
| Ga0193712_10573372 | 3300019880 | Soil | ELLETGKAAEVMPFPGRGHGVSDPEARRVLFQRVTQFFIDNL |
| Ga0179592_104559591 | 3300020199 | Vadose Zone Soil | LINELIAHGKYAEVMPAPGRGHGASDPAARKVIFNRVTQFFLDNL |
| Ga0210407_102586181 | 3300020579 | Soil | LIDDLIKAGKYVEVMTFPGRGHGASDAPAQRVLWNRVTKFFLDNL |
| Ga0210407_107199091 | 3300020579 | Soil | VEVLPFPGRGHGVSDAPARIFLMNRVTQFFVENLGQ |
| Ga0210407_107304193 | 3300020579 | Soil | GKSIEVMPFPGQGHGISDPQARKIMMRRVTQFFLDNL |
| Ga0210407_110505281 | 3300020579 | Soil | KYAEVMPFPGRGHGVSDPPARKVLMNRVTQFFLDNL |
| Ga0210395_101575733 | 3300020582 | Soil | NDLINRGIYVEVIAAPGRGHGVSDPPARKVVFNRVTQFFLDNL |
| Ga0210401_101992941 | 3300020583 | Soil | TLSLINDLIRDGKYVEVMAFPGRGHGVSDMPAQRILWERVTKFFTDNL |
| Ga0210405_104566123 | 3300021171 | Soil | LVDDLIRDGKYVEVMAFPGRGHGVGDPPAQRILWERVTKFFTDNL |
| Ga0210396_110294532 | 3300021180 | Soil | SLVDDLIRDGKYVEVMAFPGRGHGVSDPPAQRILWERVTKFFTDNL |
| Ga0210388_109962842 | 3300021181 | Soil | LLRDGKYVEVRAFPGRGHGVSDPPAQRILWERVTKFFTDNL |
| Ga0210393_100211781 | 3300021401 | Soil | KYVEVLAFPGRGHGASDPEARRVLMNRVTQFFLDNL |
| Ga0210389_107106572 | 3300021404 | Soil | KYVEVMAFPGRGHGASDPEARRVLMNRVTQFFLDNL |
| Ga0210387_107011721 | 3300021405 | Soil | TLALLDELIKHGKYVEVISAPGRGHPISDPPARRIVFTRVTQFFLDNL |
| Ga0210394_114753851 | 3300021420 | Soil | VVNERIEDEKYVEVIALPGRGHGPTDPEARVVLWNRVTKYFLDNL |
| Ga0210384_118889051 | 3300021432 | Soil | IEAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL |
| Ga0210398_112624701 | 3300021477 | Soil | ALLDAAIPAGKSIEVMPFPGQGHGISDPQARKIMMRRVTQFFLDNL |
| Ga0210410_115101032 | 3300021479 | Soil | ESGKYVEVMAFPGRGHGVTDAPARRVLMQRVTQFFLDNL |
| Ga0210409_105301193 | 3300021559 | Soil | GKYVEVMAFPGRGHGVSDPPAQRILWERVTKFFTDNL |
| Ga0210409_109871971 | 3300021559 | Soil | GKYVEVMAFPGRGHGVGDPPAQRILWEHVTKFFTDNL |
| Ga0210409_111758601 | 3300021559 | Soil | LINELIESGKYAEVMAFPGRGHGVTDPPARRVLMQCVTQFFLDNL |
| Ga0210409_112197152 | 3300021559 | Soil | YVEVMAFPGRGHGVSDPPARKVLMQRVTQYFLDNL |
| Ga0179589_103030801 | 3300024288 | Vadose Zone Soil | VEVLPFPGRGHGVSDAPARIFLMNRVTQFFVENLGAQQ |
| Ga0247667_10222553 | 3300024290 | Soil | QKYVEVMPFPGRGHGVNDPAARKVLMNRVTQFFLDNL |
| Ga0208820_10609104 | 3300025576 | Peatland | VKAGKYVEVLALPGRGHEMSDPPAQRLLWDRVTKFFLDNL |
| Ga0207665_101142302 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DKLIEEGKSAEVLPFPGRGHGVSDPPARIFLMNRVTQFFLENLGKPN |
| Ga0209761_12779361 | 3300026313 | Grasslands Soil | VINDLVEAGKYVEVLAFPGRGHGVSDPPARCVLMQRVTRFFLDNL |
| Ga0209377_13166931 | 3300026334 | Soil | INDLIEAGKYVEVLAFPGRGHGVSDPPARRVLMHRVTQFFLDNL |
| Ga0257146_10488741 | 3300026374 | Soil | GKYVEVLAFPGRGHGVSDPSARRMLMQRVTQFFLDNL |
| Ga0209806_12031772 | 3300026529 | Soil | DLIEAGKYVEVLPFPGRGHGVSDPPARRVLMQRVTQFFLDNL |
| Ga0209056_100621722 | 3300026538 | Soil | DKLIEEGKSVEVLPFPGRGHGVSDPPARIFLMNRVTQFFLENLGQPN |
| Ga0209648_101390135 | 3300026551 | Grasslands Soil | HEKYVEVMPFPGRGHGVTDPPARKVLMNRVTQFFLDNL |
| Ga0179587_105560122 | 3300026557 | Vadose Zone Soil | IENGKYVEVMPFPGRGHGVSDPEARKVLMNRVTQFFLDNL |
| Ga0179587_110256501 | 3300026557 | Vadose Zone Soil | ALISEGKYVEVMPFPGRGHGVGDAPAQRILWERVTKFFTDNL |
| Ga0207778_1164552 | 3300026783 | Tropical Forest Soil | QGKYVEVIAAPGRGHGVSDPEARKIVWSRVTQFFLDNL |
| Ga0209420_10590481 | 3300027648 | Forest Soil | IEAGKYVEVMAFPGRGHGASDPAARRVLMNRVTQFFLDNL |
| Ga0209388_10097601 | 3300027655 | Vadose Zone Soil | DLIEAGKYVEVLAFPGRGHGVSDPPARRVLMQRVTQFFLDNL |
| Ga0208565_12136781 | 3300027662 | Peatlands Soil | NAGKYVEVMTFPERGHGVSDPPAERVLWNRVTQFFLDNL |
| Ga0209588_11237792 | 3300027671 | Vadose Zone Soil | NELIEHGKYVEVMPFPGRGHGVSDPAARKVLMNRVTQFFLDNL |
| Ga0209588_12117512 | 3300027671 | Vadose Zone Soil | GKYVEVLAFPGRGHGVTDPPARRILMQRVTQFFLDNL |
| Ga0207826_11183292 | 3300027680 | Tropical Forest Soil | TLALVDDLIREGKFVEVIAAPGRGHGVSDPPARKIVWERVTQFFLNNL |
| Ga0209328_102477332 | 3300027727 | Forest Soil | NKLIEEGKYAEVMPFPGRGHGVSDPPARRVLMQRVTQFFLDNL |
| Ga0209908_100443621 | 3300027745 | Thawing Permafrost | SIEVMPFPGLGHGINDPNARRLMMQRVTKFFLDNL |
| Ga0209772_101251312 | 3300027768 | Bog Forest Soil | ELIGAGKYVEVMAFPGRGHGASDPEARRVLMNRVTQFFLDNL |
| Ga0209580_100457961 | 3300027842 | Surface Soil | AEVVPIPGRGHGASDPPARILLFNRVTQFFLSNLGEVH |
| Ga0209693_103558412 | 3300027855 | Soil | IKAGKYVEVMTFPGRGHGASDAPAQRVLWNRVTKFFLDNL |
| Ga0209701_100766161 | 3300027862 | Vadose Zone Soil | KYVEVMPFPGRGHGVSDPAARKVLMNRVTQFFLDNL |
| Ga0209701_101059123 | 3300027862 | Vadose Zone Soil | SVINDLLEAGKYVEVLAFPGRGHGVSDPPARRVLWQHVTQFFLDNL |
| Ga0209698_102971964 | 3300027911 | Watersheds | GKYVEVLPFPGRGHGVSDPAARRVLMKKVTQFYLDNL |
| Ga0247675_10568352 | 3300028072 | Soil | TLSLVDDLLAKGKSVEVMPFPGRGHGVSDPPARIILMKRVTKFFVDNLMTGKN |
| Ga0302235_104117471 | 3300028877 | Palsa | SIEVMPFPGLGHGINDLNARRLLMQRVTRFFLENL |
| Ga0308309_112327951 | 3300028906 | Soil | ALIDDLIKAGKYVEVMTFPGRGHGASDAPAQRVLWNRVTKFFLDNL |
| Ga0310038_102295341 | 3300030707 | Peatlands Soil | GKYVEVMAFPGRGHGVSDLPAERLLWNRVTKFFLDNL |
| Ga0170823_152412431 | 3300031128 | Forest Soil | DKLIELGKPVEVLPFPGRGHAVSDAPARIFLMNRVTQFFVENLGAGQ |
| (restricted) Ga0255312_11054272 | 3300031248 | Sandy Soil | ELIKAGKYVEVIAAPGRGHGVSDPPARRVVFNRVTQFFLANL |
| Ga0318534_108774882 | 3300031544 | Soil | SLIDELIKNGLYVEVIAAPGRGHGVSDPPARRIVWNRVTQFFLDNL |
| Ga0318538_105936531 | 3300031546 | Soil | GKYVEVMAFPGRGHGVGDPAAQRVLWERVTKFFVDNL |
| Ga0310686_1102373511 | 3300031708 | Soil | LIDDLIRDGKYVEVIAAPGRGHGVSDPPARKVVFTRVTQFFVDNL |
| Ga0307474_113596012 | 3300031718 | Hardwood Forest Soil | ANTLSLVNELIKNGLYVEVMAAPGRGHGVSDPPARRVVWNRVTQFFLDNL |
| Ga0307477_103542341 | 3300031753 | Hardwood Forest Soil | INDLIEAGKYVEVLAFPGRGHGVGDPPARRVLMQRVMQFFLGNL |
| Ga0307475_100416291 | 3300031754 | Hardwood Forest Soil | NGKYAEIMAFPGRGHGVTDPPARRVLMRRVTQFFLDNL |
| Ga0307475_109452352 | 3300031754 | Hardwood Forest Soil | GKYAEVMPFPGRGHGVSDPPARKVLMNRVTQFFLDNL |
| Ga0307475_113390751 | 3300031754 | Hardwood Forest Soil | GKYVEVMPFPGRGHGVSDPAARKVLMNRVTQFFLDNL |
| Ga0318537_101593193 | 3300031763 | Soil | TLLLINDLIAAGKYVEVIAAPGRGHGVSDPPARKIVWNRVTQFFLDNL |
| Ga0318509_101915773 | 3300031768 | Soil | IKNGHYVEVIAAPGRGHGVSDPPARRIVWDRVTQFFLDNL |
| Ga0318546_100776774 | 3300031771 | Soil | IDELIKAQKYVEVMAFPGRGHGVNDPPARRVLMNRVTQFFLDNL |
| Ga0307478_105393651 | 3300031823 | Hardwood Forest Soil | ALINELIENGKYVEVLPFPGRGHGVSDAPARRLLMERVTRFFLDNL |
| Ga0318495_104807402 | 3300031860 | Soil | LSFVNELIKNGLYVEVIAAPGRGHGVSDPPARRLVWNRVTQFFLDNL |
| Ga0306923_124002842 | 3300031910 | Soil | DLIKAGRYVEVMAFPGRGHGLNDPPAERLLWNRVTKFFLDNL |
| Ga0310913_104368951 | 3300031945 | Soil | KNGLYVEVIAAPGRGHGVSDPPERRIVWNRVTQFFLDNL |
| Ga0306926_119628691 | 3300031954 | Soil | ELIENGKYAEVMAFPGRGHGVTDPPARRVLMRRVTQFFLDNL |
| Ga0318530_103217641 | 3300031959 | Soil | LIKNGLYVEVIAAPGRGHGVSDPPARRVVWNRVTQFFLDNL |
| Ga0307479_109231352 | 3300031962 | Hardwood Forest Soil | ELGKYVEVMPFPGRGHGVSDDTARKVLMNRVTQFFLDNL |
| Ga0307479_112369661 | 3300031962 | Hardwood Forest Soil | VEVVPIPGRGHGASDPPARILLFNRITQFFITNLLEVH |
| Ga0318531_102953611 | 3300031981 | Soil | NDLIGDGKYVEVIAAPGRGHGVSDPPARKIVWNRVTQFFLDNL |
| Ga0318531_104947501 | 3300031981 | Soil | TLSLVNELIKNGLYVEVIAAPGRGHGVSDPPARRIVWNRVTQFFLDNL |
| Ga0318507_105551011 | 3300032025 | Soil | ALIDDLIDAGKYVEVMTFPGRGHDLNDPRAESILWNHVTQFFLDNL |
| Ga0307471_1004658891 | 3300032180 | Hardwood Forest Soil | AVINDLIEAGKYVEVLAFPGRGHGVSDPAARRVLMQRVMQFFMDNL |
| Ga0307472_1025889222 | 3300032205 | Hardwood Forest Soil | LIRDGKYVEVIAAPGRGHGVSDPPARKIVFTRVTQFFLDNL |
| Ga0306920_1041305221 | 3300032261 | Soil | TLALINDLIGQGKYVEVIAAPGRGHGVSDAAARKVVWNRVTQFFLDNL |
| Ga0335082_102901341 | 3300032782 | Soil | ALINDLINQGKYVEVIAAPGRGHGVSDPAARKIVWSRVTQFFLDNL |
| Ga0335082_116382282 | 3300032782 | Soil | QGKYVEVIAAPGRGHGVTDPPARRIVWTRVTQFFLDNL |
| Ga0335079_112968881 | 3300032783 | Soil | GDGKYIEVIAAPGRGHGVSDAPARKIVWARVTQFFLDNL |
| Ga0335080_107459271 | 3300032828 | Soil | SNTLAVVDDLIEAGKAVEVMPFPGRGHGISDNPARRLMMARVTQFFLDNL |
| Ga0335081_105484883 | 3300032892 | Soil | QGKYVEVIAFPGRGHGVSDVPAQRLLWERVTKFFLDNL |
| Ga0335071_100382637 | 3300032897 | Soil | LALINDLINQGKYVEVIAAPGRGHGVSDPAARKIVWSRVTQFFLDNL |
| Ga0335073_103684641 | 3300033134 | Soil | YVEVIAAPGRGHGVSDPPARKIVFNRVTQFFLDNL |
| Ga0310914_110119921 | 3300033289 | Soil | NTLSLVNELIKNGLYVEVIAAPGRGHGVSDPPARRIVWNRVTQFFLDNL |
| Ga0310914_114166862 | 3300033289 | Soil | LIKNGLYVEVIAAPGRGHGVSDPPARRIVWNRVTQFFLDNL |
| Ga0326724_0049170_2949_3086 | 3300034091 | Peat Soil | LIDDLIKAGKYVEVMAFPGRGHGVSDLPAERVLWNRVTNFFLDNL |
| ⦗Top⦘ |