


| Basic Information | |
|---|---|
| Family ID | F023161 |
| Family Type | Metagenome |
| Number of Sequences | 211 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ARTYYESQNKPIYALREVKSHRKELGDSAESARPSGNSER |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.58 % |
| % of genes from short scaffolds (< 2000 bps) | 90.05 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.12 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.204 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.436 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.701 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.341 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.12 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF01613 | Flavin_Reduct | 36.49 |
| PF03301 | Trp_dioxygenase | 30.81 |
| PF00535 | Glycos_transf_2 | 4.27 |
| PF03807 | F420_oxidored | 4.27 |
| PF13231 | PMT_2 | 2.84 |
| PF01436 | NHL | 0.95 |
| PF01402 | RHH_1 | 0.47 |
| PF08240 | ADH_N | 0.47 |
| PF04255 | DUF433 | 0.47 |
| PF03449 | GreA_GreB_N | 0.47 |
| PF13424 | TPR_12 | 0.47 |
| PF04055 | Radical_SAM | 0.47 |
| PF05163 | DinB | 0.47 |
| PF00821 | PEPCK_GTP | 0.47 |
| PF07228 | SpoIIE | 0.47 |
| PF13581 | HATPase_c_2 | 0.47 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.47 |
| PF01933 | CofD | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 36.49 |
| COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 30.81 |
| COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.47 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.47 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.20 % |
| Unclassified | root | N/A | 12.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101099169 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300000789|JGI1027J11758_12492591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300001661|JGI12053J15887_10201405 | Not Available | 1012 | Open in IMG/M |
| 3300002908|JGI25382J43887_10207819 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300004080|Ga0062385_10769902 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004082|Ga0062384_101447650 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300004267|Ga0066396_10044878 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005164|Ga0066815_10045220 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005166|Ga0066674_10171291 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005176|Ga0066679_10115122 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300005332|Ga0066388_101046512 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300005332|Ga0066388_101918955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1058 | Open in IMG/M |
| 3300005332|Ga0066388_104137552 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005332|Ga0066388_106930608 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005367|Ga0070667_101676504 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005434|Ga0070709_10236693 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300005447|Ga0066689_10016564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3513 | Open in IMG/M |
| 3300005518|Ga0070699_102041985 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005537|Ga0070730_10271194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
| 3300005541|Ga0070733_10671112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300005555|Ga0066692_10008359 | All Organisms → cellular organisms → Bacteria | 4765 | Open in IMG/M |
| 3300005575|Ga0066702_10786110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300005607|Ga0070740_10172417 | Not Available | 922 | Open in IMG/M |
| 3300005764|Ga0066903_101314203 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005842|Ga0068858_101016919 | Not Available | 812 | Open in IMG/M |
| 3300006032|Ga0066696_10361529 | Not Available | 946 | Open in IMG/M |
| 3300006041|Ga0075023_100432726 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006102|Ga0075015_100220944 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006175|Ga0070712_100086741 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300006354|Ga0075021_10573623 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300007255|Ga0099791_10427631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300007265|Ga0099794_10595569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300007788|Ga0099795_10620772 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009012|Ga0066710_101216634 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300009012|Ga0066710_102216590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300009012|Ga0066710_104075912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300009038|Ga0099829_11779503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009088|Ga0099830_10203866 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300009090|Ga0099827_11171326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300009137|Ga0066709_102926382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300009552|Ga0116138_1034516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300009700|Ga0116217_10335320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300010048|Ga0126373_12901334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010333|Ga0134080_10459802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300010359|Ga0126376_11408228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300010359|Ga0126376_12024656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300010360|Ga0126372_10113566 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300010361|Ga0126378_10544165 | Not Available | 1276 | Open in IMG/M |
| 3300010361|Ga0126378_10873146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300010361|Ga0126378_11310851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300010371|Ga0134125_11422588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300010376|Ga0126381_102740234 | Not Available | 704 | Open in IMG/M |
| 3300010376|Ga0126381_104452558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300010400|Ga0134122_11525621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300011269|Ga0137392_10121835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2081 | Open in IMG/M |
| 3300011269|Ga0137392_10219798 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300011269|Ga0137392_10598224 | Not Available | 915 | Open in IMG/M |
| 3300011269|Ga0137392_11065027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300011270|Ga0137391_10615964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 909 | Open in IMG/M |
| 3300011270|Ga0137391_11228942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300011271|Ga0137393_10262178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1468 | Open in IMG/M |
| 3300012096|Ga0137389_11008993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300012096|Ga0137389_11023347 | Not Available | 708 | Open in IMG/M |
| 3300012189|Ga0137388_11641013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300012200|Ga0137382_11034149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012201|Ga0137365_10909519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300012210|Ga0137378_11055801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300012211|Ga0137377_11006575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300012211|Ga0137377_11157866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300012285|Ga0137370_10483571 | Not Available | 757 | Open in IMG/M |
| 3300012285|Ga0137370_10621583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012351|Ga0137386_10520127 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012351|Ga0137386_10656071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300012357|Ga0137384_11236367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012361|Ga0137360_10058896 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
| 3300012361|Ga0137360_11028236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300012361|Ga0137360_11287577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300012361|Ga0137360_11858281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012363|Ga0137390_10141744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2385 | Open in IMG/M |
| 3300012363|Ga0137390_10839866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 875 | Open in IMG/M |
| 3300012582|Ga0137358_10883148 | Not Available | 587 | Open in IMG/M |
| 3300012683|Ga0137398_10124828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1648 | Open in IMG/M |
| 3300012685|Ga0137397_10549581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300012917|Ga0137395_10600973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300012917|Ga0137395_11111278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 559 | Open in IMG/M |
| 3300012924|Ga0137413_11751693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 512 | Open in IMG/M |
| 3300012925|Ga0137419_10981027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300012927|Ga0137416_11534314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300012927|Ga0137416_11721765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300012930|Ga0137407_11659900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300012930|Ga0137407_12389284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 505 | Open in IMG/M |
| 3300012944|Ga0137410_11237109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300012948|Ga0126375_11009181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012958|Ga0164299_10726880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300012971|Ga0126369_13627822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300014151|Ga0181539_1038733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2359 | Open in IMG/M |
| 3300014325|Ga0163163_13208821 | Not Available | 510 | Open in IMG/M |
| 3300014501|Ga0182024_10069310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5357 | Open in IMG/M |
| 3300015054|Ga0137420_1018737 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300015054|Ga0137420_1431393 | All Organisms → cellular organisms → Bacteria | 3066 | Open in IMG/M |
| 3300015168|Ga0167631_1039990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300015242|Ga0137412_11273512 | Not Available | 514 | Open in IMG/M |
| 3300015264|Ga0137403_11038532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300016270|Ga0182036_10429104 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300017823|Ga0187818_10016015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3203 | Open in IMG/M |
| 3300017934|Ga0187803_10133310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300017948|Ga0187847_10845461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300017961|Ga0187778_10118282 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300017972|Ga0187781_10028545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3854 | Open in IMG/M |
| 3300018006|Ga0187804_10140376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300018007|Ga0187805_10024097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2675 | Open in IMG/M |
| 3300018088|Ga0187771_10193239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1687 | Open in IMG/M |
| 3300018482|Ga0066669_11710724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300019890|Ga0193728_1244981 | Not Available | 722 | Open in IMG/M |
| 3300020018|Ga0193721_1067188 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300020140|Ga0179590_1057379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300020140|Ga0179590_1068929 | Not Available | 930 | Open in IMG/M |
| 3300020199|Ga0179592_10069855 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300020199|Ga0179592_10374141 | Not Available | 624 | Open in IMG/M |
| 3300020579|Ga0210407_10452908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300020579|Ga0210407_10554544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300020579|Ga0210407_10774352 | Not Available | 741 | Open in IMG/M |
| 3300020579|Ga0210407_11292517 | Not Available | 545 | Open in IMG/M |
| 3300020580|Ga0210403_10106291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2277 | Open in IMG/M |
| 3300020580|Ga0210403_11017185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300020581|Ga0210399_10244856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
| 3300020581|Ga0210399_11188379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300021086|Ga0179596_10354612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300021168|Ga0210406_10578176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300021168|Ga0210406_10723802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300021178|Ga0210408_10412237 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300021181|Ga0210388_11815269 | Not Available | 502 | Open in IMG/M |
| 3300021401|Ga0210393_10191517 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300021420|Ga0210394_10009491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9808 | Open in IMG/M |
| 3300021420|Ga0210394_10150856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2019 | Open in IMG/M |
| 3300021433|Ga0210391_10870637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300021474|Ga0210390_10380011 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300021475|Ga0210392_10001844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 10970 | Open in IMG/M |
| 3300021475|Ga0210392_10187721 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300021478|Ga0210402_10567692 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300021479|Ga0210410_10061084 | Not Available | 3292 | Open in IMG/M |
| 3300021560|Ga0126371_10287983 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300021560|Ga0126371_10574591 | Not Available | 1276 | Open in IMG/M |
| 3300024288|Ga0179589_10274553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300024323|Ga0247666_1032622 | Not Available | 1083 | Open in IMG/M |
| 3300024330|Ga0137417_1319014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6996 | Open in IMG/M |
| 3300025439|Ga0208323_1041986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300025625|Ga0208219_1108381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300025905|Ga0207685_10801835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300025934|Ga0207686_11396969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300026214|Ga0209838_1011296 | Not Available | 1229 | Open in IMG/M |
| 3300026298|Ga0209236_1307078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300026304|Ga0209240_1106498 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300026312|Ga0209153_1180109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300026333|Ga0209158_1154595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300026335|Ga0209804_1106284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300026356|Ga0257150_1054852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300026361|Ga0257176_1033734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300026467|Ga0257154_1081173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 517 | Open in IMG/M |
| 3300026550|Ga0209474_10545614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300026551|Ga0209648_10680792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300026557|Ga0179587_10344538 | Not Available | 966 | Open in IMG/M |
| 3300026920|Ga0208575_1017945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300026921|Ga0207860_1008582 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300027035|Ga0207776_1038788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300027313|Ga0207780_1025957 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300027587|Ga0209220_1143901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300027645|Ga0209117_1053323 | Not Available | 1190 | Open in IMG/M |
| 3300027655|Ga0209388_1025053 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300027671|Ga0209588_1048275 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300027674|Ga0209118_1178326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300027681|Ga0208991_1165775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300027725|Ga0209178_1000935 | All Organisms → cellular organisms → Bacteria | 8901 | Open in IMG/M |
| 3300027768|Ga0209772_10293241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300027824|Ga0209040_10120250 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300027854|Ga0209517_10473919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300027862|Ga0209701_10507915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300027862|Ga0209701_10604598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300027869|Ga0209579_10362748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300027889|Ga0209380_10508455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300027910|Ga0209583_10549936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300027911|Ga0209698_10421055 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300027911|Ga0209698_10725544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300028138|Ga0247684_1026640 | Not Available | 918 | Open in IMG/M |
| 3300028800|Ga0265338_10615412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300030693|Ga0302313_10096478 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300031057|Ga0170834_104769115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031231|Ga0170824_127277886 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031251|Ga0265327_10331600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300031474|Ga0170818_108600773 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 619 | Open in IMG/M |
| 3300031546|Ga0318538_10485432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii | 670 | Open in IMG/M |
| 3300031718|Ga0307474_10710688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300031718|Ga0307474_10769955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300031718|Ga0307474_11130870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031744|Ga0306918_10971063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300031823|Ga0307478_10099687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2247 | Open in IMG/M |
| 3300031823|Ga0307478_11109639 | Not Available | 660 | Open in IMG/M |
| 3300031896|Ga0318551_10753928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031912|Ga0306921_12175310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031942|Ga0310916_10905633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300031942|Ga0310916_11018944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300031959|Ga0318530_10157068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300031962|Ga0307479_11072521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300031962|Ga0307479_11308716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300032180|Ga0307471_101093498 | Not Available | 963 | Open in IMG/M |
| 3300032180|Ga0307471_102104453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300032261|Ga0306920_104008222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300032828|Ga0335080_11389746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300032954|Ga0335083_11035636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300032955|Ga0335076_10336796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
| 3300033134|Ga0335073_12091090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.47% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1010991692 | 3300000364 | Soil | EIMARTYYESQNKPIYTLREVKSHRKEIDSTEQTRPSGNNER* |
| JGI1027J11758_124925911 | 3300000789 | Soil | TYYESQNKPIYSVREVKSHREESGGPTEXKRQFGXSDX* |
| JGI12053J15887_102014052 | 3300001661 | Forest Soil | LGEIIARTYYESQNKPIYSLREVKSHRKEMSDPAEPARPSGSSER* |
| JGI25382J43887_102078191 | 3300002908 | Grasslands Soil | EIIARTYYESQNKPIYALREVKSRRKEMGDSTESTRPSGNPDR* |
| Ga0062385_107699022 | 3300004080 | Bog Forest Soil | RTYYESQNKPIYALREVKSHRKEMGDSAEQARPSGNSER* |
| Ga0062384_1014476501 | 3300004082 | Bog Forest Soil | GEISSRTYYESQNKPIYALREVKSHRKEAGDSAESTRPSGNSDR* |
| Ga0066396_100448781 | 3300004267 | Tropical Forest Soil | EISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0066815_100452201 | 3300005164 | Soil | LMSRTYYESQNKPIYTLREIKSHRKELGDSAEQARPSGNSER* |
| Ga0066674_101712911 | 3300005166 | Soil | GLLGEISSRTYYESQNKSVYALREVKSHRKETGDSAESSRASGSSER* |
| Ga0066679_101151221 | 3300005176 | Soil | ARTYYESQNKPIYALREVKTHRKEMGDSAESTHPSGNPDR* |
| Ga0066388_1010465121 | 3300005332 | Tropical Forest Soil | LGEIMARTYYESQNKPIYTLREIKSHRKEIGDSAEPARPSGNSER* |
| Ga0066388_1019189552 | 3300005332 | Tropical Forest Soil | GEIMARTYYESQNKPIYTLREVKSHRKEIGDSAEPARPSGNSER* |
| Ga0066388_1041375522 | 3300005332 | Tropical Forest Soil | ELMARTYYESQNKPIYTLREVKSHRKELGDSAEQARPSGSSER* |
| Ga0066388_1069306081 | 3300005332 | Tropical Forest Soil | LLGELMARTYYESQNKPIYALREVKSHHKEIGDSAESRRPSGTSEH* |
| Ga0070667_1016765042 | 3300005367 | Switchgrass Rhizosphere | ELMARTYYESQNKPIYTLREVKSHRKELGDSTEQARPSGNSER* |
| Ga0070709_102366933 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IARTYYESQNKSIYSLREVKSHRKEMSDPAEPARPSGSSER* |
| Ga0066689_100165641 | 3300005447 | Soil | EIIARTYYESQNKPIYALREVKSHRKEMGDSTESPRPSGSSER* |
| Ga0070699_1020419852 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0070730_102711941 | 3300005537 | Surface Soil | SRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0070733_106711122 | 3300005541 | Surface Soil | ESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0066692_100083596 | 3300005555 | Soil | LGEMLARTYYESQNKPIYALREVKSHRKELGDSAESARSPGPSER* |
| Ga0066702_107861102 | 3300005575 | Soil | ESQNKPIYALREVKSHRKEMGDSTESPRPSGNSER* |
| Ga0070740_101724171 | 3300005607 | Surface Soil | YESQNKPIYALREVKSHRKETGDSAESARSSGSSER* |
| Ga0066903_1013142031 | 3300005764 | Tropical Forest Soil | TYYESQNKSIYALREVKSHRKETGDSAESSRASGSSER* |
| Ga0068858_1010169191 | 3300005842 | Switchgrass Rhizosphere | TYYESQNKPIYALREVKSHQKEVGDSTESRRPSGTSDH* |
| Ga0066696_103615292 | 3300006032 | Soil | TSRTYYESQNKSIYALREVKSHRKETGDSAESSRASGSSER* |
| Ga0075023_1004327262 | 3300006041 | Watersheds | TYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER* |
| Ga0075015_1002209443 | 3300006102 | Watersheds | TYYESQNKPIYALREVKSHRKELGDSTESTRPSGNTDR* |
| Ga0070712_1000867411 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TYYESQNKPIYALREVKSHRKEMGDSAEQTRPSGNNER* |
| Ga0075021_105736231 | 3300006354 | Watersheds | EIMARTYYESQNKSIYTLREVKSRRNELGDSAESSQPSRP* |
| Ga0099791_104276311 | 3300007255 | Vadose Zone Soil | LLGELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0099794_105955691 | 3300007265 | Vadose Zone Soil | IARTYYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER* |
| Ga0099795_106207722 | 3300007788 | Vadose Zone Soil | MARTYYESQNKSIYTLREVKSRRNELGDSAESSQPSRP* |
| Ga0066710_1012166341 | 3300009012 | Grasslands Soil | EIIARTYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER |
| Ga0066710_1022165902 | 3300009012 | Grasslands Soil | MGLLGEIIAHTNYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0066710_1040759121 | 3300009012 | Grasslands Soil | ISARTYYESQNKPIYALREVKSHRKELGGAAEQSRPSGSSDR |
| Ga0099829_117795031 | 3300009038 | Vadose Zone Soil | LIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0099830_102038661 | 3300009088 | Vadose Zone Soil | LGEMLARTYYESQNKPIYALREVKSHRKEAGDSAEQARPSGSSER* |
| Ga0099827_111713262 | 3300009090 | Vadose Zone Soil | GEIIARTYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER* |
| Ga0066709_1029263821 | 3300009137 | Grasslands Soil | RTYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPDR* |
| Ga0116138_10345163 | 3300009552 | Peatland | SRTYYESQNKAIYSLREVKSHRKEQGDSAESARPFGSTER* |
| Ga0116217_103353201 | 3300009700 | Peatlands Soil | ESQNKAIYSLREVKSHRKEQGDSAESAQPFGSSER* |
| Ga0126373_129013342 | 3300010048 | Tropical Forest Soil | RTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0134080_104598022 | 3300010333 | Grasslands Soil | YYESQNKPIYALREVKSHRKEMGDSTESPRPSGNSER* |
| Ga0126376_114082281 | 3300010359 | Tropical Forest Soil | SQNKPIYTLREVKSHRKEMGDSAESARPSGNPER* |
| Ga0126376_120246561 | 3300010359 | Tropical Forest Soil | ISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSER* |
| Ga0126372_101135661 | 3300010360 | Tropical Forest Soil | RTYYESQNKPIYALREVKSHRKEIDSTEQTRPSSGNER* |
| Ga0126378_105441652 | 3300010361 | Tropical Forest Soil | GEISSRTYYESQNKPIYALREVKSHRKELGDSAESARPSGNSDR* |
| Ga0126378_108731463 | 3300010361 | Tropical Forest Soil | YYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0126378_113108512 | 3300010361 | Tropical Forest Soil | SSRTYYESQNKPIYALREVKSHRKESDPAEPARPSGNTER* |
| Ga0134125_114225882 | 3300010371 | Terrestrial Soil | LLGEIIARTYYESQNKPIYALREVKSHRKDLSDSTEQARPSGPTER* |
| Ga0126381_1027402342 | 3300010376 | Tropical Forest Soil | GEISSRTYYESQNKPIYALREVKSHRKELGDSAESARPSGNCDR* |
| Ga0126381_1044525582 | 3300010376 | Tropical Forest Soil | GEISSRTYYESQNKPIYALREVKSHRKETGDSAESPRASGSSER* |
| Ga0134122_115256211 | 3300010400 | Terrestrial Soil | YESQNKPIYALREVKSHRKELGDSTEQARPSGNSER* |
| Ga0137392_101218354 | 3300011269 | Vadose Zone Soil | LLGEIIARTYYESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER* |
| Ga0137392_102197983 | 3300011269 | Vadose Zone Soil | LGELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0137392_105982242 | 3300011269 | Vadose Zone Soil | ARTYYESQNKPIYALREVKSHRKETGDSAESSRASGSSER* |
| Ga0137392_110650271 | 3300011269 | Vadose Zone Soil | IIARTYYESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER* |
| Ga0137391_106159642 | 3300011270 | Vadose Zone Soil | YESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0137391_112289422 | 3300011270 | Vadose Zone Soil | ARTYYESQNKPVYALREVKSHRKEMGDSTESAHPSGNPER* |
| Ga0137393_102621781 | 3300011271 | Vadose Zone Soil | SSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0137389_110089932 | 3300012096 | Vadose Zone Soil | IARTYYESQNKPIYALREVKSHRKEMGDSAESTRPSGNPER* |
| Ga0137389_110233472 | 3300012096 | Vadose Zone Soil | LGEMMARTYYESQNKPIYALREVKSHREELGDSAESSHTSKNP* |
| Ga0137388_116410131 | 3300012189 | Vadose Zone Soil | IIARTYYESQNKPVYALREVKSHRKEMGDSTESAHPSGNPER* |
| Ga0137382_110341491 | 3300012200 | Vadose Zone Soil | SQNKPIYALREVKSHRKEMGDSTESPRPSGNSER* |
| Ga0137365_109095191 | 3300012201 | Vadose Zone Soil | YESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER* |
| Ga0137378_110558012 | 3300012210 | Vadose Zone Soil | YYESQNKPIYALREVKSHRKEMGDSTESPRPSGSSER* |
| Ga0137377_110065752 | 3300012211 | Vadose Zone Soil | LGEIIARTYYESQNKPIYALREVKSHRKEMGDSTESPRPSGNSER* |
| Ga0137377_111578662 | 3300012211 | Vadose Zone Soil | TYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPDR* |
| Ga0137370_104835711 | 3300012285 | Vadose Zone Soil | RTYYESQNKPIYALREVKSHRKELGDSAEQTRPSGNNER* |
| Ga0137370_106215832 | 3300012285 | Vadose Zone Soil | EIIARTYYESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER* |
| Ga0137386_105201271 | 3300012351 | Vadose Zone Soil | YYESQNKPIYALREVKSHRKELGDSAESARSPGPSER* |
| Ga0137386_106560711 | 3300012351 | Vadose Zone Soil | EIMARTYYESQNKPIYTLREVKSHRKETGDSAEPARPSGNSER* |
| Ga0137384_112363672 | 3300012357 | Vadose Zone Soil | GLLGEISSRTYYESQNKSVYALREVKSHRKEMGDSTESPRPSGNSER* |
| Ga0137360_100588965 | 3300012361 | Vadose Zone Soil | YESQNKPVYALREVKSHRKDVGDAEQTRPSGSSER* |
| Ga0137360_110282362 | 3300012361 | Vadose Zone Soil | YYESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER* |
| Ga0137360_112875771 | 3300012361 | Vadose Zone Soil | TYYESQNKPIYALREVKSHRKEMGDSTEQTRPSGNSER* |
| Ga0137360_118582812 | 3300012361 | Vadose Zone Soil | MVRTYYESQHKPIYTLREVKTQRKEARDSAEQARPFGTSDH* |
| Ga0137390_101417441 | 3300012363 | Vadose Zone Soil | TYYESQNKPVYALREVKSHRKEMGDSTESAHPSGNPER* |
| Ga0137390_108398662 | 3300012363 | Vadose Zone Soil | GELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0137358_108831483 | 3300012582 | Vadose Zone Soil | SQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0137398_101248281 | 3300012683 | Vadose Zone Soil | YYESQNKPIYSLREIKSHREESGGPTEPKRQFGSSDH* |
| Ga0137397_105495811 | 3300012685 | Vadose Zone Soil | EIIARTYYESQNKPIYALREVKSHRKELGDSTESTRPSGNPER* |
| Ga0137395_106009732 | 3300012917 | Vadose Zone Soil | YYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0137395_111112782 | 3300012917 | Vadose Zone Soil | TYYESQNKPIYTLREVKSHRKEAGDSAEQARPFGTSDR* |
| Ga0137413_117516931 | 3300012924 | Vadose Zone Soil | RTYYESQNKPIYTLREVKSHRKETGDSAEQARPFGTSDH* |
| Ga0137419_109810271 | 3300012925 | Vadose Zone Soil | TYYESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER* |
| Ga0137416_115343142 | 3300012927 | Vadose Zone Soil | IARTYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPDR* |
| Ga0137416_117217652 | 3300012927 | Vadose Zone Soil | LARTYYESQNKPIYALREVKSHRKEMGDPAEPARPSGSSER* |
| Ga0137407_116599002 | 3300012930 | Vadose Zone Soil | LLGEIIARTYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER* |
| Ga0137407_123892842 | 3300012930 | Vadose Zone Soil | GEISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0137410_112371092 | 3300012944 | Vadose Zone Soil | LLGEIMARTYYESQNKPIYTLREVKSHRKEIGDSAEPARPSGNSER* |
| Ga0126375_110091811 | 3300012948 | Tropical Forest Soil | LLGEIIARTYYESQSKPIYALREVKSHRKELGDSAEPARPSGSSER* |
| Ga0164299_107268802 | 3300012958 | Soil | YYESQNKPIYTLREIKSHRKELGDSAEQARPSGNSER* |
| Ga0126369_136278221 | 3300012971 | Tropical Forest Soil | ITSRTYYESQNKAIYALREVKSHRKELGDSAESARPSGSSER* |
| Ga0181539_10387331 | 3300014151 | Bog | SSRTYYESQNKAIYSLREVKSHRKEQGDSAESAQPFGSSER* |
| Ga0163163_132088212 | 3300014325 | Switchgrass Rhizosphere | YESQNKPIYTLREVKTHQKEIGDSTESRRPSGTSEH* |
| Ga0182024_100693107 | 3300014501 | Permafrost | LGEIIARTYYESQNKPIYALREVKSHRKEMGDSTEQTRPSGNSER* |
| Ga0137420_10187371 | 3300015054 | Vadose Zone Soil | ESQNKPIYALREVKSHRKELGDSTESTRPSGNPER* |
| Ga0137420_14313933 | 3300015054 | Vadose Zone Soil | MLGELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER* |
| Ga0167631_10399902 | 3300015168 | Glacier Forefield Soil | EIIARTYYESQNKPIYSLREVKSHRKEMSDPAEPARPSGSSER* |
| Ga0137412_112735121 | 3300015242 | Vadose Zone Soil | IMPRTYYESQNKPIYTLREVKSHRKEIGDSAEPARPSGNSER* |
| Ga0137403_110385322 | 3300015264 | Vadose Zone Soil | RTYYESQNKPIYTLREVKSHRKEIGDSAEPARPSGNSER* |
| Ga0182036_104291043 | 3300016270 | Soil | SRTYYESQNKPIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0187818_100160151 | 3300017823 | Freshwater Sediment | TYYESQNKPIYALREVKSHRKELGGAAEQSRPSGSSDR |
| Ga0187803_101333101 | 3300017934 | Freshwater Sediment | TYYESQNKAIYALREVKSHRKEQGDSAESAQPFGSSER |
| Ga0187847_108454611 | 3300017948 | Peatland | LGEISSRTYYESQNKPIYALREVKSHRKEAGDSAESTRPSGNSDR |
| Ga0187778_101182824 | 3300017961 | Tropical Peatland | IARTYYESQNKPIYALREVKSHRKEMGDSAESPRASGNPDR |
| Ga0187781_100285455 | 3300017972 | Tropical Peatland | SSRTYYESQNKPIYALREVKSHRKEDSAETARPSGSSER |
| Ga0187804_101403763 | 3300018006 | Freshwater Sediment | GEISSRTYYESQNKAIYALREVKSHRKEMGDSAESARPSGSSER |
| Ga0187805_100240971 | 3300018007 | Freshwater Sediment | EISARTYYESQNKPIYALREVKSHRKELGGAAEQSRPSGSSDR |
| Ga0187771_101932391 | 3300018088 | Tropical Peatland | RTYYESQNKPIYALREVKSHRKELGDSAEPARPSGSSDR |
| Ga0066669_117107241 | 3300018482 | Grasslands Soil | IIARTYYESQNKPIYALREVKSHRKEMGDSTESPRPSGNSER |
| Ga0193728_12449811 | 3300019890 | Soil | LLGELMARTYYESQNKPIYTLREVKSHRKETGDSAEQARPFGTSDH |
| Ga0193721_10671881 | 3300020018 | Soil | IARTYYESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER |
| Ga0179590_10573791 | 3300020140 | Vadose Zone Soil | LGEISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0179590_10689291 | 3300020140 | Vadose Zone Soil | YESQNKPIYALREVKSHRKETGDSAESTRPSGNSER |
| Ga0179592_100698553 | 3300020199 | Vadose Zone Soil | ARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER |
| Ga0179592_103741412 | 3300020199 | Vadose Zone Soil | EISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0210407_104529081 | 3300020579 | Soil | ARTYYESQNKPIYALREVKSHRKELGDSAESARPSGNSER |
| Ga0210407_105545443 | 3300020579 | Soil | IARTYYESQNKPIYALREVKSHRKELGDSTESTRPSGNPER |
| Ga0210407_107743523 | 3300020579 | Soil | YYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0210407_112925172 | 3300020579 | Soil | ESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0210403_101062911 | 3300020580 | Soil | YESQDKPIYALREVKSHRKEMGDSTEQTRPSGNSER |
| Ga0210403_110171852 | 3300020580 | Soil | RTYYESQNKPIYALREVKSHRKELGDSTESTRPSGNPER |
| Ga0210399_102448561 | 3300020581 | Soil | SARTYYESQNKPIYALREVKSHRKELGDSAESARPSGNSER |
| Ga0210399_111883791 | 3300020581 | Soil | ELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER |
| Ga0179596_103546122 | 3300021086 | Vadose Zone Soil | ESQNKPIYALREVKSHRKEMGDSTESPRPSGNSER |
| Ga0210406_105781761 | 3300021168 | Soil | LIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER |
| Ga0210406_107238023 | 3300021168 | Soil | ISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0210408_104122373 | 3300021178 | Soil | YESQNKPIYALREVKSHRKELGDSTESTRPSGNPER |
| Ga0210388_118152691 | 3300021181 | Soil | LLGEIIARTYYESQNKPIYALRELKSHRKEMGEGTEQTRPSGPTER |
| Ga0210393_101915171 | 3300021401 | Soil | ESQNKPIYALRELKSHRKEMGEGTEQTRPSGPTER |
| Ga0210394_100094911 | 3300021420 | Soil | ARTYYESQNKAIYALREVKSHRKEMGDSAESTRPSGNSER |
| Ga0210394_101508564 | 3300021420 | Soil | GEISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0210391_108706371 | 3300021433 | Soil | IIARTYYESQNKPIYALREVKSHRKEMGDSTEQTRPSGNSER |
| Ga0210390_103800113 | 3300021474 | Soil | LGEIIARTYYESQNKPIYALREVKSHRKELGDSTEQTRPSGNSER |
| Ga0210392_100018441 | 3300021475 | Soil | LLGEITSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0210392_101877213 | 3300021475 | Soil | ARTYYESQNKPIYALREVKSHRKEAGDSAESTRPSGSER |
| Ga0210402_105676922 | 3300021478 | Soil | YESQNKPIYSLREVKSHRKELGGAAEQSRPSGSSDR |
| Ga0210410_100610841 | 3300021479 | Soil | GEIIARTYYESQNKPIYALREVKSHRKEMGDSAEQARPSGNSKR |
| Ga0126371_102879832 | 3300021560 | Tropical Forest Soil | GEISSRTYYESQNKPIYALREVKSHRKELGDSAESARPSGSSDR |
| Ga0126371_105745912 | 3300021560 | Tropical Forest Soil | GEISSRTYYESQNKPIYALREVKSHRKELGDSAESARPSGNSDR |
| Ga0179589_102745533 | 3300024288 | Vadose Zone Soil | YYESPNKAIYALREVTSHRKELGDSAEPARPSGSSER |
| Ga0247666_10326221 | 3300024323 | Soil | LGEIMARTYYESQNKPIYALREIKSHRKEMGDSAEPARPSGNTER |
| Ga0137417_13190141 | 3300024330 | Vadose Zone Soil | LGEIIARTYYESQNSRFYALREVKSHRKELGDSAEQTRPSGSSDR |
| Ga0208323_10419862 | 3300025439 | Peatland | EFGSRTYYESQNKAIYALREVKSHRKEQGDSAESAQPFGSSER |
| Ga0208219_11083811 | 3300025625 | Arctic Peat Soil | ESQNKPIYSLREVKSHRKEMSDPAEPARPSGSSER |
| Ga0207685_108018351 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | IMARTYYESQNKPIYTLREVKSHRKEIGDSAEPARPSGNSER |
| Ga0207686_113969692 | 3300025934 | Miscanthus Rhizosphere | ARTYYESQNKPIYALREVKSHRKELGDSTEQARPSGNSER |
| Ga0209838_10112961 | 3300026214 | Soil | TYYESQNKPIYALREVKSHRKEMGDSAESARPSGSSER |
| Ga0209236_13070782 | 3300026298 | Grasslands Soil | YYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0209240_11064981 | 3300026304 | Grasslands Soil | LGEIMARTYYESQNKPIYTLREVKTHRKEAGDSAEQARPFGTSDH |
| Ga0209153_11801091 | 3300026312 | Soil | LLGEIIARTYYESQNKPIYALREVKSHRKEMGDSTESPRPSGNSER |
| Ga0209158_11545952 | 3300026333 | Soil | TYYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0209804_11062841 | 3300026335 | Soil | YYESQNKPIYALREVKSHRKEMGDSTESPRPSGSSER |
| Ga0257150_10548522 | 3300026356 | Soil | IMARTYYESQNKPIYTLREVKTHRKETGDSAEQARPFGTSDH |
| Ga0257176_10337342 | 3300026361 | Soil | ESQDKPIYALREVKSHRKEMGDSAESPRPSGNSER |
| Ga0257154_10811731 | 3300026467 | Soil | RTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0209474_105456141 | 3300026550 | Soil | YESQNKSIYALREVKSHRKETGDSAESSRASGSSER |
| Ga0209648_106807922 | 3300026551 | Grasslands Soil | LGELIARTYYESQNKPVYALREVKSHRKDVGDAEQTRPSGSSER |
| Ga0179587_103445381 | 3300026557 | Vadose Zone Soil | GEIIARTYYESQNKPIYALREVKTHRKELGDSTESTRPSGSSER |
| Ga0208575_10179451 | 3300026920 | Soil | ESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0207860_10085821 | 3300026921 | Tropical Forest Soil | LLGEISSRTYYESQNKPIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0207776_10387882 | 3300027035 | Tropical Forest Soil | TYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0207780_10259571 | 3300027313 | Tropical Forest Soil | ESQNKPIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0209220_11439011 | 3300027587 | Forest Soil | TYYESQNKPIYSLREVKSHRKEMSDPAEPARPSGSSER |
| Ga0209117_10533233 | 3300027645 | Forest Soil | GELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER |
| Ga0209388_10250531 | 3300027655 | Vadose Zone Soil | LGEIIARTYYESQNKPIYALREVKSHRKEMGDSAEQTRPSGSSDR |
| Ga0209588_10482753 | 3300027671 | Vadose Zone Soil | LGEIIARTYYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0209118_11783261 | 3300027674 | Forest Soil | YESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER |
| Ga0208991_11657752 | 3300027681 | Forest Soil | IARTYYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0209178_10009351 | 3300027725 | Agricultural Soil | GEISSRTYYESQNKPIYALREVKSHRKETGDSAESSRASGGSER |
| Ga0209772_102932412 | 3300027768 | Bog Forest Soil | ESQNKPIYALREVRSHRKETGDSAESTRPSGNSER |
| Ga0209040_101202501 | 3300027824 | Bog Forest Soil | GEISSRTYYESQDKPIYALREVKSHRQELGDSAEPARPSGSSER |
| Ga0209517_104739191 | 3300027854 | Peatlands Soil | RTYYESQNKPIYAVREVKSHRKEMGGATEQSRPSGSSDR |
| Ga0209701_105079152 | 3300027862 | Vadose Zone Soil | YESQNKPIYALREVKSHRKEMGDSAESPRPSGNSER |
| Ga0209701_106045981 | 3300027862 | Vadose Zone Soil | MLARTYYESQNKPIYALREVKSHRKEAGDSAEQARPSGSSER |
| Ga0209579_103627481 | 3300027869 | Surface Soil | GEIIARTYYESQNKPIYALREVKSHRKEAGDSAESARPSGNSER |
| Ga0209380_105084551 | 3300027889 | Soil | EIIARTYYESQNKPIYALREVKSHRKEMGDSTEQTRPSGNSER |
| Ga0209583_105499361 | 3300027910 | Watersheds | TYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER |
| Ga0209698_104210553 | 3300027911 | Watersheds | ISSRTYYESQNKPIYALREVKSHRKEAGDSAESTRPSGNSDR |
| Ga0209698_107255442 | 3300027911 | Watersheds | ESQNKPIYALREVKSHRKELGDSTESTRPSGNTDR |
| Ga0247684_10266402 | 3300028138 | Soil | RIYYESQNKPIYSTREIKSHREESGGSTEPKRQFGSSDH |
| Ga0265338_106154121 | 3300028800 | Rhizosphere | RTYYESQNKSIYALREVKSHRKEIGDNAEPARPSGSER |
| Ga0302313_100964781 | 3300030693 | Palsa | YYESQNKPIYALREVKSHRKEMGDSAEQARPSGNSER |
| Ga0170834_1047691152 | 3300031057 | Forest Soil | YYESQNKSIYSLREVKSHRKEMSDPAEPARPSGSSER |
| Ga0170824_1272778862 | 3300031231 | Forest Soil | LGEIIARTYYESQNKPIYALREVKSHRKEMGDSTESTRPSGNPER |
| Ga0265327_103316001 | 3300031251 | Rhizosphere | EISSRTYYESQNKSIYALREVKSHRKEIGDNAEPARPSGSER |
| Ga0170818_1086007732 | 3300031474 | Forest Soil | SRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0318538_104854323 | 3300031546 | Soil | ARTYYESQNKPIYTLREVKSHRKELGDSTEQARPSGNSER |
| Ga0307474_107106881 | 3300031718 | Hardwood Forest Soil | LGELIARTYYESQNKPVYALREVKSHRKDVGDTEQTRPSGSSER |
| Ga0307474_107699551 | 3300031718 | Hardwood Forest Soil | YYESQNKPIYALREVKSHRKELGGAAEQSRPSGSSDR |
| Ga0307474_111308701 | 3300031718 | Hardwood Forest Soil | EIMARTYYESQNKPIYTLREVKTHRKEAGDSAEQARPFGTSDH |
| Ga0306918_109710631 | 3300031744 | Soil | YESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0307478_100996874 | 3300031823 | Hardwood Forest Soil | GEISARTYYESQNKPIYALREVKSHRKELGGAAEQSRPSGSSDR |
| Ga0307478_111096391 | 3300031823 | Hardwood Forest Soil | LLGEISSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0318551_107539281 | 3300031896 | Soil | IGLLGEITSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0306921_121753101 | 3300031912 | Soil | LGEITSRTYYESQNKAIYALREVKSHRKELGDSAESARPSGSSER |
| Ga0310916_109056332 | 3300031942 | Soil | GEITSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0310916_110189441 | 3300031942 | Soil | SSRTYYESQNKAIYALREVKTHRKELGDSAEPARPSGSSER |
| Ga0318530_101570681 | 3300031959 | Soil | GLLGEITSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0307479_110725211 | 3300031962 | Hardwood Forest Soil | EINARTYYESQSKPIYALREVKSHRKEMGDSTESTRPSGNPER |
| Ga0307479_113087161 | 3300031962 | Hardwood Forest Soil | YESQSKPIYALREVKSHRKEMGDSTESTRPSGNPER |
| Ga0307471_1010934981 | 3300032180 | Hardwood Forest Soil | EIISRTYYESQNKPIYALREVKSHRKEMGDSAESPRPSGSSER |
| Ga0307471_1021044531 | 3300032180 | Hardwood Forest Soil | RTYYESQNKPIYALREVKSHRKELGDSTESTRPSGSSER |
| Ga0306920_1040082221 | 3300032261 | Soil | SIGLLGEITSRTYYESQNKAIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0335080_113897461 | 3300032828 | Soil | YYESQNKPIYALREVKSHRKELGDSAEPARPSGSSER |
| Ga0335083_110356362 | 3300032954 | Soil | TYYESQNKPIYALREVKSHRKEDSAEPARPTGTDR |
| Ga0335076_103367961 | 3300032955 | Soil | LLGEISSRTYYESQNKPIYALREVKSHRKEDSAEPARPSGGSDR |
| Ga0335073_120910901 | 3300033134 | Soil | RTYYESQNKPIYALREVKSHRKELGDSAEPARPSGSSER |
| ⦗Top⦘ |