


| Basic Information | |
|---|---|
| Family ID | F023081 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 211 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.99 % |
| % of genes near scaffold ends (potentially truncated) | 26.54 % |
| % of genes from short scaffolds (< 2000 bps) | 77.73 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.469 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.436 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.810 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.450 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 34.25% β-sheet: 0.00% Coil/Unstructured: 65.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF04893 | Yip1 | 12.32 |
| PF02321 | OEP | 10.43 |
| PF03450 | CO_deh_flav_C | 1.42 |
| PF16576 | HlyD_D23 | 0.95 |
| PF13533 | Biotin_lipoyl_2 | 0.95 |
| PF13185 | GAF_2 | 0.95 |
| PF00581 | Rhodanese | 0.47 |
| PF05768 | Glrx-like | 0.47 |
| PF03595 | SLAC1 | 0.47 |
| PF00005 | ABC_tran | 0.47 |
| PF12700 | HlyD_2 | 0.47 |
| PF00990 | GGDEF | 0.47 |
| PF00512 | HisKA | 0.47 |
| PF01344 | Kelch_1 | 0.47 |
| PF12838 | Fer4_7 | 0.47 |
| PF02738 | MoCoBD_1 | 0.47 |
| PF02518 | HATPase_c | 0.47 |
| PF12704 | MacB_PCD | 0.47 |
| PF01370 | Epimerase | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 20.85 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG1275 | Tellurite resistance protein TehA and related permeases | Defense mechanisms [V] | 0.47 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.47 % |
| Unclassified | root | N/A | 8.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10253172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300001545|JGI12630J15595_10067498 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100663676 | Not Available | 920 | Open in IMG/M |
| 3300002558|JGI25385J37094_10015979 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300002562|JGI25382J37095_10259593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300002568|C688J35102_118928222 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300002568|C688J35102_120900777 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300003321|soilH1_10353961 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300003324|soilH2_10198001 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300004153|Ga0063455_100846636 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005167|Ga0066672_10050475 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
| 3300005167|Ga0066672_10221617 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005171|Ga0066677_10026538 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
| 3300005171|Ga0066677_10175523 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300005171|Ga0066677_10212099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300005171|Ga0066677_10310721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300005174|Ga0066680_10189135 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300005174|Ga0066680_10207213 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300005175|Ga0066673_10061231 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300005175|Ga0066673_10850842 | Not Available | 520 | Open in IMG/M |
| 3300005176|Ga0066679_10300684 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300005176|Ga0066679_10515806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300005176|Ga0066679_10975862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300005177|Ga0066690_10008770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 5039 | Open in IMG/M |
| 3300005177|Ga0066690_10319814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1050 | Open in IMG/M |
| 3300005178|Ga0066688_10264684 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300005178|Ga0066688_10686718 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005179|Ga0066684_10002856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 7290 | Open in IMG/M |
| 3300005179|Ga0066684_10093333 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300005179|Ga0066684_10142941 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300005179|Ga0066684_10497041 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005179|Ga0066684_10661540 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005180|Ga0066685_10019173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4062 | Open in IMG/M |
| 3300005180|Ga0066685_10175202 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005181|Ga0066678_10634495 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005184|Ga0066671_10252152 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300005187|Ga0066675_11206240 | Not Available | 561 | Open in IMG/M |
| 3300005187|Ga0066675_11320739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300005336|Ga0070680_100920740 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005434|Ga0070709_10184257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1468 | Open in IMG/M |
| 3300005445|Ga0070708_100000600 | All Organisms → cellular organisms → Bacteria | 27071 | Open in IMG/M |
| 3300005445|Ga0070708_100509371 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300005459|Ga0068867_100871019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300005518|Ga0070699_101295375 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005529|Ga0070741_10022889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 9535 | Open in IMG/M |
| 3300005530|Ga0070679_100458659 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300005549|Ga0070704_101281940 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005552|Ga0066701_10040025 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300005552|Ga0066701_10070056 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300005556|Ga0066707_10282739 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005557|Ga0066704_10210287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1317 | Open in IMG/M |
| 3300005559|Ga0066700_10474829 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005561|Ga0066699_10097224 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300005568|Ga0066703_10584745 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005569|Ga0066705_10218323 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005575|Ga0066702_10310093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300005576|Ga0066708_10130767 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300005576|Ga0066708_10229646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1174 | Open in IMG/M |
| 3300005576|Ga0066708_10473859 | Not Available | 805 | Open in IMG/M |
| 3300005598|Ga0066706_10068020 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300005598|Ga0066706_10338965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1190 | Open in IMG/M |
| 3300005640|Ga0075035_1550425 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300005644|Ga0075036_1747463 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300005646|Ga0075040_1331981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 998 | Open in IMG/M |
| 3300005650|Ga0075038_10026357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4071 | Open in IMG/M |
| 3300005895|Ga0075277_1004945 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300006028|Ga0070717_10509527 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300006031|Ga0066651_10378079 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006032|Ga0066696_10180371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1336 | Open in IMG/M |
| 3300006032|Ga0066696_10872342 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006046|Ga0066652_100026317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 4094 | Open in IMG/M |
| 3300006049|Ga0075417_10700068 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006162|Ga0075030_101086229 | Not Available | 629 | Open in IMG/M |
| 3300006755|Ga0079222_11264287 | Not Available | 668 | Open in IMG/M |
| 3300006794|Ga0066658_10583040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300006796|Ga0066665_10133227 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300006797|Ga0066659_10245159 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300006800|Ga0066660_10172831 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300006800|Ga0066660_11202490 | Not Available | 595 | Open in IMG/M |
| 3300006804|Ga0079221_10349418 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300006852|Ga0075433_10017804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 5894 | Open in IMG/M |
| 3300006854|Ga0075425_100517000 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300006854|Ga0075425_100990852 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006871|Ga0075434_100903300 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006871|Ga0075434_101351098 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006904|Ga0075424_100908605 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006914|Ga0075436_100660218 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300006954|Ga0079219_10125808 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300007255|Ga0099791_10285462 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300007258|Ga0099793_10462815 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300007258|Ga0099793_10575024 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300007265|Ga0099794_10003594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 5946 | Open in IMG/M |
| 3300007265|Ga0099794_10247391 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300007265|Ga0099794_10404742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300007788|Ga0099795_10393885 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300009012|Ga0066710_100224403 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
| 3300009012|Ga0066710_104843577 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009038|Ga0099829_10000009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 100127 | Open in IMG/M |
| 3300009038|Ga0099829_10164064 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300009038|Ga0099829_10408540 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300009038|Ga0099829_10731189 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300009089|Ga0099828_10343551 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300009137|Ga0066709_100013194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 7769 | Open in IMG/M |
| 3300009143|Ga0099792_10130749 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300009143|Ga0099792_10967070 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009147|Ga0114129_10489511 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300009147|Ga0114129_12994004 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010046|Ga0126384_10960153 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010304|Ga0134088_10613899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300010358|Ga0126370_11331700 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010360|Ga0126372_11492884 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010859|Ga0126352_1162612 | Not Available | 598 | Open in IMG/M |
| 3300010880|Ga0126350_12116847 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300012096|Ga0137389_11724445 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012189|Ga0137388_10991802 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012202|Ga0137363_10068573 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300012203|Ga0137399_10000676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 14123 | Open in IMG/M |
| 3300012203|Ga0137399_10079661 | All Organisms → cellular organisms → Bacteria | 2482 | Open in IMG/M |
| 3300012203|Ga0137399_10137224 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300012205|Ga0137362_10258845 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300012205|Ga0137362_11506666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300012361|Ga0137360_11648994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012469|Ga0150984_104231431 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012582|Ga0137358_10469933 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012917|Ga0137395_10967637 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012918|Ga0137396_10045690 | All Organisms → cellular organisms → Bacteria | 2980 | Open in IMG/M |
| 3300012918|Ga0137396_10427173 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012918|Ga0137396_10895769 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012927|Ga0137416_10156233 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300012929|Ga0137404_11615679 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012929|Ga0137404_11632292 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012930|Ga0137407_10027360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4390 | Open in IMG/M |
| 3300012930|Ga0137407_10031999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 4112 | Open in IMG/M |
| 3300012930|Ga0137407_10055466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3239 | Open in IMG/M |
| 3300012930|Ga0137407_10666709 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300012944|Ga0137410_10315825 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300012955|Ga0164298_11311744 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012975|Ga0134110_10207892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300012975|Ga0134110_10365327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300012984|Ga0164309_10891860 | Not Available | 724 | Open in IMG/M |
| 3300015053|Ga0137405_1382904 | All Organisms → cellular organisms → Bacteria | 4070 | Open in IMG/M |
| 3300015196|Ga0167627_1005469 | All Organisms → cellular organisms → Bacteria | 6378 | Open in IMG/M |
| 3300015242|Ga0137412_10716646 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300015245|Ga0137409_10598202 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300018029|Ga0187787_10034181 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300018060|Ga0187765_11185316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300018431|Ga0066655_10100215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1622 | Open in IMG/M |
| 3300018431|Ga0066655_10987808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300018433|Ga0066667_10182329 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300018433|Ga0066667_10473463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300018433|Ga0066667_11871276 | Not Available | 546 | Open in IMG/M |
| 3300018468|Ga0066662_10469273 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300018482|Ga0066669_10758798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300020199|Ga0179592_10054554 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300021086|Ga0179596_10422581 | Not Available | 673 | Open in IMG/M |
| 3300021086|Ga0179596_10551920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300021860|Ga0213851_1776250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 37216 | Open in IMG/M |
| 3300021953|Ga0213880_10164531 | Not Available | 611 | Open in IMG/M |
| 3300025921|Ga0207652_10648283 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300026216|Ga0209903_1003557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3440 | Open in IMG/M |
| 3300026220|Ga0209855_1005399 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300026297|Ga0209237_1275271 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026298|Ga0209236_1251152 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300026301|Ga0209238_1017437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2764 | Open in IMG/M |
| 3300026310|Ga0209239_1286783 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026312|Ga0209153_1167648 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300026312|Ga0209153_1298590 | Not Available | 515 | Open in IMG/M |
| 3300026315|Ga0209686_1006892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sorangiineae incertae sedis → Minicystis → Minicystis rosea | 4900 | Open in IMG/M |
| 3300026318|Ga0209471_1000063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 85320 | Open in IMG/M |
| 3300026318|Ga0209471_1258963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300026325|Ga0209152_10156456 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300026331|Ga0209267_1040110 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300026335|Ga0209804_1135088 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300026523|Ga0209808_1310593 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026524|Ga0209690_1018116 | All Organisms → cellular organisms → Bacteria | 3600 | Open in IMG/M |
| 3300026529|Ga0209806_1066227 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300026538|Ga0209056_10177133 | Not Available | 1591 | Open in IMG/M |
| 3300026542|Ga0209805_1002365 | All Organisms → cellular organisms → Bacteria | 11001 | Open in IMG/M |
| 3300026550|Ga0209474_10098784 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300026550|Ga0209474_10221477 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300026551|Ga0209648_10075887 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300026552|Ga0209577_10105889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2272 | Open in IMG/M |
| 3300027181|Ga0208997_1024148 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027591|Ga0209733_1010833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2402 | Open in IMG/M |
| 3300027603|Ga0209331_1008331 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2742 | Open in IMG/M |
| 3300027643|Ga0209076_1082140 | Not Available | 916 | Open in IMG/M |
| 3300027655|Ga0209388_1065865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300027655|Ga0209388_1132731 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300027671|Ga0209588_1002445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sorangiineae incertae sedis → Minicystis → Minicystis rosea | 5038 | Open in IMG/M |
| 3300027846|Ga0209180_10253690 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300027882|Ga0209590_10009744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 4435 | Open in IMG/M |
| 3300027903|Ga0209488_10044648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3257 | Open in IMG/M |
| 3300027903|Ga0209488_10177964 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300027903|Ga0209488_11066728 | Not Available | 554 | Open in IMG/M |
| 3300028536|Ga0137415_10156547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2114 | Open in IMG/M |
| 3300028536|Ga0137415_10266630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1519 | Open in IMG/M |
| 3300028536|Ga0137415_10280600 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300029901|Ga0247051_1005079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sorangiineae incertae sedis → Minicystis → Minicystis rosea | 6104 | Open in IMG/M |
| 3300030998|Ga0073996_10903771 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031740|Ga0307468_101835143 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031820|Ga0307473_10196643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1193 | Open in IMG/M |
| 3300031962|Ga0307479_10006993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 10394 | Open in IMG/M |
| 3300032074|Ga0308173_10736517 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300032174|Ga0307470_10763326 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300032180|Ga0307471_100744644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1146 | Open in IMG/M |
| 3300032205|Ga0307472_100135160 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300032205|Ga0307472_102253313 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300032783|Ga0335079_10220637 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300033502|Ga0326731_1142689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300033513|Ga0316628_103428241 | Not Available | 574 | Open in IMG/M |
| 3300034268|Ga0372943_0885542 | Not Available | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.47% |
| Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.47% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.47% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015196 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300026220 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029901 | Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_102531722 | 3300001305 | Soil | MRRRLPPQHVLALLVAGLLCLMALGVATMYKYGPKRGHIYAALQRDR* |
| JGI12630J15595_100674982 | 3300001545 | Forest Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKSGHIYAARER* |
| JGIcombinedJ26739_1006636762 | 3300002245 | Forest Soil | LRERYHPSMRRLLPPQQVIGLLVAGLLCLMAAGFAVMRKYGPARGHLYADLQRH* |
| JGI25385J37094_100159794 | 3300002558 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR* |
| JGI25382J37095_102595932 | 3300002562 | Grasslands Soil | LRLESELRYPDMRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR* |
| C688J35102_1189282222 | 3300002568 | Soil | MPRLVPPRQTIWLLVAGLLCLMAAGIASMSKFGPPRGHIYAARER* |
| C688J35102_1209007772 | 3300002568 | Soil | MQRLLPPRQTIWLLVAGLLCLMAAGIASMSKFGPPRGHIYAARQR* |
| soilH1_103539613 | 3300003321 | Sugarcane Root And Bulk Soil | MRRLLPPRQTIWLLVVGLLCLMAAGVASMSKFGPKRGHVYAVRGQ* |
| soilH2_101980012 | 3300003324 | Sugarcane Root And Bulk Soil | MPRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAENPR* |
| Ga0063455_1008466361 | 3300004153 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAAQG |
| Ga0066672_100504753 | 3300005167 | Soil | MPRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR* |
| Ga0066672_102216173 | 3300005167 | Soil | MRRLFPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYA |
| Ga0066677_100265381 | 3300005171 | Soil | MRRRLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR* |
| Ga0066677_101755232 | 3300005171 | Soil | MRRGLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0066677_102120992 | 3300005171 | Soil | MRRRLPPQHVLALFVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR* |
| Ga0066677_103107212 | 3300005171 | Soil | MRRLFPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR* |
| Ga0066680_101891353 | 3300005174 | Soil | ASMRRFLPPQQVVALLVAGLLCLMAAGVATMAKYGPRRGHIYAAVQEHR* |
| Ga0066680_102072132 | 3300005174 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAERAR* |
| Ga0066673_100612313 | 3300005175 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER* |
| Ga0066673_108508421 | 3300005175 | Soil | MPFMPRRMPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0066679_103006842 | 3300005176 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAERGR* |
| Ga0066679_105158062 | 3300005176 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQPGHVYAANR* |
| Ga0066679_109758622 | 3300005176 | Soil | LLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRSGHVYAAVQRNR* |
| Ga0066690_100087704 | 3300005177 | Soil | MRRMLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHR* |
| Ga0066690_103198141 | 3300005177 | Soil | MRRFLPPQQVVALLVAGLLCLMAAGVATMAKYGPQRGHIYAAVQEHR* |
| Ga0066688_102646842 | 3300005178 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRSGHVYAAVQRNH* |
| Ga0066688_106867182 | 3300005178 | Soil | MRRFLPPQQVVALLVAGLLCLMAAGVATMAKYGPRRGHIYAAVQEHR* |
| Ga0066684_100028566 | 3300005179 | Soil | MAWMRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0066684_100933332 | 3300005179 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRGHVYAANR* |
| Ga0066684_101429413 | 3300005179 | Soil | MPFMPRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0066684_104970411 | 3300005179 | Soil | MPSMRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHHR* |
| Ga0066684_106615402 | 3300005179 | Soil | MRQLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAERGR* |
| Ga0066685_100191734 | 3300005180 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAEEGAEPIYQAGG* |
| Ga0066685_101752022 | 3300005180 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRSGHVYAAVQRNR* |
| Ga0066678_106344952 | 3300005181 | Soil | MASMRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHVYAAVQTNH* |
| Ga0066671_102521521 | 3300005184 | Soil | PGVRMAAMRRFLPPQQVVALLVAGLLCLMAAGVATMAKYGPQRGHIYAAVQEHR* |
| Ga0066675_112062401 | 3300005187 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPRSGHIYAAAR* |
| Ga0066675_113207392 | 3300005187 | Soil | MRAMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPPRGHVYAAVQRNH* |
| Ga0070680_1009207402 | 3300005336 | Corn Rhizosphere | LPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYADRQH* |
| Ga0070709_101842572 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRLPPQHVVALFVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR* |
| Ga0070708_10000060011 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRHIYAERQR* |
| Ga0070708_1005093712 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARYAQLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRGHIYAERGR* |
| Ga0068867_1008710192 | 3300005459 | Miscanthus Rhizosphere | MPRLLPPRQTIWLLVVGLLCLMAAGVASMSKFGPKRGHVYAERQH* |
| Ga0070699_1012953751 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRHIYAERQR* |
| Ga0070741_100228893 | 3300005529 | Surface Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYADRQH* |
| Ga0070679_1004586591 | 3300005530 | Corn Rhizosphere | PPRQAIWLLVAGLLCLMAAGVASMWKFGPPRGHIYADRQH* |
| Ga0070704_1012819401 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PRLLPPRQTIWLLVVGLLCLMAAGVASMSKFGPKRGHVYAERQH* |
| Ga0066701_100400252 | 3300005552 | Soil | MRRMLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRRHTYAALQQDHR* |
| Ga0066701_100700561 | 3300005552 | Soil | MRPLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR* |
| Ga0066707_102827392 | 3300005556 | Soil | MRRMPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0066704_102102873 | 3300005557 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAERGR |
| Ga0066700_104748291 | 3300005559 | Soil | LPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHHYAALQQDHR* |
| Ga0066699_100972243 | 3300005561 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPPRGHVYAALQKNH* |
| Ga0066703_105847452 | 3300005568 | Soil | MTAMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRGHVYAAMQKNR* |
| Ga0066705_102183233 | 3300005569 | Soil | MVPMRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHVYAAVQEITE |
| Ga0066702_103100931 | 3300005575 | Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRRHVYAALQQDHR* |
| Ga0066708_101307672 | 3300005576 | Soil | MRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHHR* |
| Ga0066708_102296462 | 3300005576 | Soil | MRRPLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHHYAALQQDHR* |
| Ga0066708_104738592 | 3300005576 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRSGHVYAAVQRN |
| Ga0066706_100680204 | 3300005598 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAE |
| Ga0066706_103389652 | 3300005598 | Soil | MRRLFPPRPTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR* |
| Ga0075035_15504253 | 3300005640 | Permafrost Soil | RNGVTMPAMRHLLPPRQTIWLLIAGLFCLMAAGFASMRKFGPPRGHVYAALPNHSARP* |
| Ga0075036_17474632 | 3300005644 | Permafrost Soil | MRHLLPPRQTIWLLIAGLFCLMAAGFASMRKFGPPRGHVYAALPNHSARP* |
| Ga0075040_13319812 | 3300005646 | Permafrost Soil | MRHLLPPRQTIWLLVAGLFCLMAAGFASMRKFGPARGHVYAALQSRGSRR* |
| Ga0075038_100263574 | 3300005650 | Permafrost Soil | MPAMRHLLPPRQTIWLLIAGLFCLMAAGFASMRKFGPPRGHVYAALPNHSARP* |
| Ga0075277_10049452 | 3300005895 | Rice Paddy Soil | MQRMLPPRQTIWLLIAGLLCLMAAGVASMSKFGPPRGHIYAVRQP* |
| Ga0070717_105095271 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRMRHLLPPRQTIWLLVAGLLCLMAAGFASMRKFGP |
| Ga0066651_103780791 | 3300006031 | Soil | MRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0066696_101803711 | 3300006032 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYA |
| Ga0066696_108723422 | 3300006032 | Soil | MASMRRLLPPQQVVALLVAGLLCLMAAGVATMAKYGPRRGHIYAAVQEHR* |
| Ga0066652_1000263176 | 3300006046 | Soil | MRRLLPPRQTIWLIVAGLLCLMAAGVASMSKFGPRGHIYAERGR* |
| Ga0075417_107000682 | 3300006049 | Populus Rhizosphere | ELGCSAMRRPLPPQQVVGLLVAGLLCLIAAGVATMAKYGPKRGHIYTALQQEHH* |
| Ga0075030_1010862292 | 3300006162 | Watersheds | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPPRGRVYAAVTKDR* |
| Ga0079222_112642872 | 3300006755 | Agricultural Soil | MQRLLPPRQTIWLLIAGLLCLMAAGVASMSKFGPPRGHIYAVRQP* |
| Ga0066658_105830402 | 3300006794 | Soil | ASMRRGLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALGR* |
| Ga0066665_101332272 | 3300006796 | Soil | MRRLFPTRQTIWLLVAGLLCVMAAGVASMWKFGPPRGHIYAALGR* |
| Ga0066659_102451592 | 3300006797 | Soil | MRRLLPPRQTIWLIVAGLLCLMAAGVASMSKFGPPRGHIYAQSGR* |
| Ga0066660_101728313 | 3300006800 | Soil | MRRMLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRG |
| Ga0066660_112024902 | 3300006800 | Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRRHVYAALQRDHR* |
| Ga0079221_103494182 | 3300006804 | Agricultural Soil | MRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHVYAAVHEHR* |
| Ga0075433_100178046 | 3300006852 | Populus Rhizosphere | MRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHVYTALQAEHH* |
| Ga0075425_1005170002 | 3300006854 | Populus Rhizosphere | MRRPLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0075425_1009908521 | 3300006854 | Populus Rhizosphere | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRGHVYAERQR* |
| Ga0075434_1009033001 | 3300006871 | Populus Rhizosphere | RGMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRHIYAERQR* |
| Ga0075434_1013510982 | 3300006871 | Populus Rhizosphere | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRGHIYAERQR* |
| Ga0075424_1009086052 | 3300006904 | Populus Rhizosphere | AEPELRCRGMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRGHIYAERQR* |
| Ga0075436_1006602182 | 3300006914 | Populus Rhizosphere | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0079219_101258082 | 3300006954 | Agricultural Soil | MRRLLPPRQTIWLIVAGLLCLMAAGVASMSKFGPPRGHIYAERGR* |
| Ga0099791_102854621 | 3300007255 | Vadose Zone Soil | LLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYATRER* |
| Ga0099793_104628151 | 3300007258 | Vadose Zone Soil | MRRLLAPRQTIWLLVAGLLFLMAAGVASMPKFGPKRGHIYAARGR* |
| Ga0099793_105750241 | 3300007258 | Vadose Zone Soil | MRRFLPPQQVVGLIVAGLLCLMAAGIATMAKYGPKRGHIYAALQQDHR* |
| Ga0099794_100035945 | 3300007265 | Vadose Zone Soil | MRRLLPPQQVVGLLVAGLLCLMAAGIATMAKYGPKRGHTYAALQQDHR* |
| Ga0099794_102473912 | 3300007265 | Vadose Zone Soil | MRRLLAPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARGR* |
| Ga0099794_104047422 | 3300007265 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYATRER* |
| Ga0099795_103938852 | 3300007788 | Vadose Zone Soil | LGWLAMRRMPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHH* |
| Ga0066710_1002244033 | 3300009012 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRSGHVYAAVQRNR |
| Ga0066710_1048435772 | 3300009012 | Grasslands Soil | MRRLFPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIY |
| Ga0099829_100000099 | 3300009038 | Vadose Zone Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHR* |
| Ga0099829_101640642 | 3300009038 | Vadose Zone Soil | MPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDQDHR* |
| Ga0099829_104085402 | 3300009038 | Vadose Zone Soil | MRRLPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDR* |
| Ga0099829_107311892 | 3300009038 | Vadose Zone Soil | MRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDR* |
| Ga0099828_103435512 | 3300009089 | Vadose Zone Soil | MAPMRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPPRGHVYAAVQRNH* |
| Ga0066709_1000131946 | 3300009137 | Grasslands Soil | MLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHR* |
| Ga0099792_101307492 | 3300009143 | Vadose Zone Soil | MQRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRHIYAERQR* |
| Ga0099792_109670701 | 3300009143 | Vadose Zone Soil | MAAMRRMPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYTALQQEHH* |
| Ga0114129_104895113 | 3300009147 | Populus Rhizosphere | MRRMPPQHVVALLVAGLLCLMAAGVATMAKYGPKRGHIYTALQQEHH* |
| Ga0114129_129940042 | 3300009147 | Populus Rhizosphere | MRRHLPPQHVVGLLVAGLLCLMAAGFATMAKYGPKRGHIYAALQQDHHR* |
| Ga0126384_109601532 | 3300010046 | Tropical Forest Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRGHIYAASSR* |
| Ga0134088_106138991 | 3300010304 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIFAARER* |
| Ga0126370_113317001 | 3300010358 | Tropical Forest Soil | MRKPLPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHHYAALQHDR* |
| Ga0126372_114928841 | 3300010360 | Tropical Forest Soil | MRRRPLPPQQVVALLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0126352_11626122 | 3300010859 | Boreal Forest Soil | MRRFLPPRQTIWLLVAGLLCLMAAGVASMSKFGPPRGHVYAALQKNR* |
| Ga0126350_121168472 | 3300010880 | Boreal Forest Soil | MRRFLPPRQTIWLLVAGLLCLMAAGVASMSKFGPPRGHVYATLQRNR* |
| Ga0137389_117244451 | 3300012096 | Vadose Zone Soil | MTGMRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPPRGHVYAAL |
| Ga0137388_109918022 | 3300012189 | Vadose Zone Soil | MTGMRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPPRGHVYAALQKDR* |
| Ga0137363_100685734 | 3300012202 | Vadose Zone Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAAL |
| Ga0137399_1000067613 | 3300012203 | Vadose Zone Soil | MRRFLPPQQVVGLIVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0137399_100796613 | 3300012203 | Vadose Zone Soil | MRRMPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR* |
| Ga0137399_101372243 | 3300012203 | Vadose Zone Soil | LPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRRHVYAALHQEHR* |
| Ga0137362_102588451 | 3300012205 | Vadose Zone Soil | MRPLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAAL |
| Ga0137362_115066662 | 3300012205 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRHIYAERQR* |
| Ga0137360_116489941 | 3300012361 | Vadose Zone Soil | RRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRHIYAERQR* |
| Ga0150984_1042314312 | 3300012469 | Avena Fatua Rhizosphere | LLPPRQTIWLLVVGLLCLMAAGVASMSKFGPKRGHVYAERQH* |
| Ga0137358_104699332 | 3300012582 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPK |
| Ga0137395_109676371 | 3300012917 | Vadose Zone Soil | MPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDR* |
| Ga0137396_100456904 | 3300012918 | Vadose Zone Soil | MRPLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRG |
| Ga0137396_104271732 | 3300012918 | Vadose Zone Soil | LPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER* |
| Ga0137396_108957692 | 3300012918 | Vadose Zone Soil | MRRMPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHH* |
| Ga0137416_101562333 | 3300012927 | Vadose Zone Soil | MRRLLPPQQVVGLLVAGLLCLMAAGIATMAKYGPKRGHIYAALQQDHR* |
| Ga0137404_116156791 | 3300012929 | Vadose Zone Soil | QTIWLLVAGLLCLMAAGVASMSKFGPQRHIYAERQR* |
| Ga0137404_116322922 | 3300012929 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAA |
| Ga0137407_100273604 | 3300012930 | Vadose Zone Soil | MRRLLPPQHVVGLLVAGLLCLMAAGIATMAKYGPKRGHIYAALQQEHH* |
| Ga0137407_100319991 | 3300012930 | Vadose Zone Soil | GMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIFAARER* |
| Ga0137407_100554665 | 3300012930 | Vadose Zone Soil | GMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER* |
| Ga0137407_106667091 | 3300012930 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHI |
| Ga0137410_103158251 | 3300012944 | Vadose Zone Soil | RQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYATRER* |
| Ga0164298_113117442 | 3300012955 | Soil | PPRQTVWLLVVGLLLLMAAGMATMRKFGPQGGQLYAVRHRNR* |
| Ga0134110_102078922 | 3300012975 | Grasslands Soil | MRRLLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR* |
| Ga0134110_103653272 | 3300012975 | Grasslands Soil | MRRMLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR* |
| Ga0164309_108918602 | 3300012984 | Soil | MRRFLPPQQVVGLLVAALFCLMAAGVGMMARFGPPRGHLYAALHR* |
| Ga0137405_13829041 | 3300015053 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKSGHIYAAAKR* |
| Ga0167627_10054693 | 3300015196 | Glacier Forefield Soil | VTSAEAGVRILEMQKLLPPRQTIGLLVAGLLCLMAAGVATMSKFGPPRGHVYAALQRHR* |
| Ga0137412_107166462 | 3300015242 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKSGHIYAARQR* |
| Ga0137409_105982022 | 3300015245 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYA |
| Ga0187787_100341812 | 3300018029 | Tropical Peatland | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYADRQP |
| Ga0187765_111853162 | 3300018060 | Tropical Peatland | MRRMLPPRQTIWLLVAGLLCLMAAGVASMSKFGPARGHVYAVLQK |
| Ga0066655_101002152 | 3300018431 | Grasslands Soil | MRRRLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR |
| Ga0066655_109878081 | 3300018431 | Grasslands Soil | MPAMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER |
| Ga0066667_101823293 | 3300018433 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR |
| Ga0066667_104734632 | 3300018433 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER |
| Ga0066667_118712762 | 3300018433 | Grasslands Soil | MLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHR |
| Ga0066662_104692732 | 3300018468 | Grasslands Soil | MRRGLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR |
| Ga0066669_107587982 | 3300018482 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPRSGHIYAAAR |
| Ga0179592_100545542 | 3300020199 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKSGHIYAARQR |
| Ga0179596_104225812 | 3300021086 | Vadose Zone Soil | MRRMPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDQDHR |
| Ga0179596_105519202 | 3300021086 | Vadose Zone Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHR |
| Ga0213851_177625026 | 3300021860 | Watersheds | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPPRGHVYAVLQKER |
| Ga0213880_101645312 | 3300021953 | Exposed Rock | MPNLPPRQTIWLLVAGLLCLMSAGVASMWKYGPPRGHVYAALNR |
| Ga0207652_106482832 | 3300025921 | Corn Rhizosphere | PRMPRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYADRQH |
| Ga0209903_10035574 | 3300026216 | Soil | MPAMRHLLPPRQTIWLLIAGLFCLMAAGFASMRKFGPPRGHVYAALPNHSARP |
| Ga0209855_10053993 | 3300026220 | Permafrost Soil | MRHLLPPRQTIWLLIAGLFCLMAAGFASMRKFGPPRGHVYAALPNHSARP |
| Ga0209237_12752711 | 3300026297 | Grasslands Soil | MRRLLPPQHVVGLLVAGLLCLMAAGIATMAKYGPKRGHIYAALQQEHH |
| Ga0209236_12511522 | 3300026298 | Grasslands Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIFAARER |
| Ga0209238_10174371 | 3300026301 | Grasslands Soil | MRRRLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRER |
| Ga0209239_12867832 | 3300026310 | Grasslands Soil | MRPLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR |
| Ga0209153_11676482 | 3300026312 | Soil | MAWMRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR |
| Ga0209153_12985902 | 3300026312 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRGHVYAANR |
| Ga0209686_10068922 | 3300026315 | Soil | MRRMLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHR |
| Ga0209471_100006319 | 3300026318 | Soil | MTGMRRLLPPRQTIWLLVAGLLCLMAAGVASMRKFGPPRGHVYAALQKNH |
| Ga0209471_12589631 | 3300026318 | Soil | LLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRSGHVYAAVQRNR |
| Ga0209152_101564561 | 3300026325 | Soil | MRRLFPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAAL |
| Ga0209267_10401101 | 3300026331 | Soil | MRRLFPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALG |
| Ga0209804_11350881 | 3300026335 | Soil | PPRQTIWLLVAGLLCLMAAGVASMRKFGPPRGHVYAALQKNH |
| Ga0209808_13105932 | 3300026523 | Soil | SMRRRLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR |
| Ga0209690_10181163 | 3300026524 | Soil | MRRMLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR |
| Ga0209806_10662271 | 3300026529 | Soil | MRRLFPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR |
| Ga0209056_101771332 | 3300026538 | Soil | MRRPLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHHYAALQQDHR |
| Ga0209805_10023653 | 3300026542 | Soil | MPRLLPPRQTIWLLVAGLLCLMAAGVASMWKFGPPRGHIYAALGR |
| Ga0209474_100987843 | 3300026550 | Soil | MRRLLPPQHVLALLVAGLLCLMAAGVATMYKYGPKRGHIYAALQRDR |
| Ga0209474_102214772 | 3300026550 | Soil | MPSMRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQQDHHR |
| Ga0209648_100758871 | 3300026551 | Grasslands Soil | MRRLLPPRQTIWLLIAGLLCLMAAGVASMSKFGPPRGHVYAARR |
| Ga0209577_101058893 | 3300026552 | Soil | MRRFLPPQQVVALLVAGLLCLMAAGVATMAKYGPQRGHIYAAVQEHR |
| Ga0208997_10241482 | 3300027181 | Forest Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKSGHIYAARER |
| Ga0209733_10108333 | 3300027591 | Forest Soil | MRRLLPPQQVVGLLVAGLLCLMAAGFAVMRKYGPPRGHVYAALQQR |
| Ga0209331_10083312 | 3300027603 | Forest Soil | MRRLLPPQQVIGLLVAGLLCLMAAGFAVMRKYGPARGHLYADLQRH |
| Ga0209076_10821401 | 3300027643 | Vadose Zone Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRRHVYAALQQEHR |
| Ga0209388_10658652 | 3300027655 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYATRER |
| Ga0209388_11327311 | 3300027655 | Vadose Zone Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPRRGHIYAE |
| Ga0209588_10024455 | 3300027671 | Vadose Zone Soil | MRRLLPPQQVVGLLVAGLLCLMAAGIATMAKYGPKRGHTYAALQQDHR |
| Ga0209180_102536902 | 3300027846 | Vadose Zone Soil | MRRLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDR |
| Ga0209590_100097443 | 3300027882 | Vadose Zone Soil | MRRLPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDR |
| Ga0209488_100446484 | 3300027903 | Vadose Zone Soil | MRRMPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQEHH |
| Ga0209488_101779642 | 3300027903 | Vadose Zone Soil | MRRLLPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQPEHR |
| Ga0209488_110667282 | 3300027903 | Vadose Zone Soil | MQRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQRHIYAERQR |
| Ga0137415_101565473 | 3300028536 | Vadose Zone Soil | MRRFLPPQQVVGLIVAGLLCLMAARIATMAKYGPKRGHIYAALQQDHR |
| Ga0137415_102666302 | 3300028536 | Vadose Zone Soil | MRRMPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR |
| Ga0137415_102806001 | 3300028536 | Vadose Zone Soil | PELRWRGMRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPKRGHIYAARER |
| Ga0247051_10050793 | 3300029901 | Cryconite | MQKLLPPRQTIGLLVAGLLCLMAAGVATMSKFGPPRGHVYAALQRHR |
| Ga0073996_109037711 | 3300030998 | Soil | PFPSPSMRRPLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR |
| Ga0307468_1018351432 | 3300031740 | Hardwood Forest Soil | PLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQHDR |
| Ga0307473_101966432 | 3300031820 | Hardwood Forest Soil | MRRLLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQQGHR |
| Ga0307479_100069934 | 3300031962 | Hardwood Forest Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPPRGRVYAQQR |
| Ga0308173_107365172 | 3300032074 | Soil | MQRMLPPRQTIWLLIAGLLCLMAAGVASMSKFGPPRGHIYAVRQP |
| Ga0307470_107633261 | 3300032174 | Hardwood Forest Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMSKFGPQR |
| Ga0307471_1007446442 | 3300032180 | Hardwood Forest Soil | MRRPLPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQQGHR |
| Ga0307472_1001351603 | 3300032205 | Hardwood Forest Soil | MRRPLPPQHVVGLLVAGLLCLMAAGVATMAKYGPKRGHIYAALQQDHR |
| Ga0307472_1022533131 | 3300032205 | Hardwood Forest Soil | MRRPLPPQQVVGLLVAGLLCLMAAGVATMAKYGPKRGHTYAALQHDHR |
| Ga0335079_102206372 | 3300032783 | Soil | MRRLLPPRQTIWLFVAGLLCLMAAGVASMSKFGPARGHVYAALQK |
| Ga0326731_11426892 | 3300033502 | Peat Soil | MRRLLPPRQTIWLFVAGLLCLMAAGVASMWKFGPPRGHIYADRQP |
| Ga0316628_1034282412 | 3300033513 | Soil | MRRLLPPRQTIWLLVAGLLCLMAAGVASMARFGPPRGHVYAAMQRNR |
| Ga0372943_0885542_129_284 | 3300034268 | Soil | MTRAMQRLPPQHVLALLVAGLLCLMAAGVATMYKFGPARGHIYAALQGNQR |
| ⦗Top⦘ |