


| Basic Information | |
|---|---|
| Family ID | F022939 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TLGYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.47 % |
| % of genes near scaffold ends (potentially truncated) | 99.53 % |
| % of genes from short scaffolds (< 2000 bps) | 94.81 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.679 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.811 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.245 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 19.44% Coil/Unstructured: 76.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF09364 | XFP_N | 3.77 |
| PF00296 | Bac_luciferase | 3.77 |
| PF07238 | PilZ | 2.36 |
| PF01022 | HTH_5 | 1.89 |
| PF00072 | Response_reg | 1.42 |
| PF05368 | NmrA | 1.42 |
| PF00654 | Voltage_CLC | 1.42 |
| PF01061 | ABC2_membrane | 1.42 |
| PF06172 | Cupin_5 | 1.42 |
| PF12704 | MacB_PCD | 1.42 |
| PF17189 | Glyco_hydro_30C | 0.94 |
| PF01565 | FAD_binding_4 | 0.94 |
| PF00464 | SHMT | 0.94 |
| PF12840 | HTH_20 | 0.94 |
| PF08241 | Methyltransf_11 | 0.94 |
| PF01425 | Amidase | 0.94 |
| PF02627 | CMD | 0.47 |
| PF05532 | CsbD | 0.47 |
| PF00092 | VWA | 0.47 |
| PF11925 | DUF3443 | 0.47 |
| PF13847 | Methyltransf_31 | 0.47 |
| PF03551 | PadR | 0.47 |
| PF01055 | Glyco_hydro_31 | 0.47 |
| PF13489 | Methyltransf_23 | 0.47 |
| PF14022 | DUF4238 | 0.47 |
| PF12695 | Abhydrolase_5 | 0.47 |
| PF03681 | Obsolete Pfam Family | 0.47 |
| PF16576 | HlyD_D23 | 0.47 |
| PF05015 | HigB-like_toxin | 0.47 |
| PF13624 | SurA_N_3 | 0.47 |
| PF07978 | NIPSNAP | 0.47 |
| PF02880 | PGM_PMM_III | 0.47 |
| PF13174 | TPR_6 | 0.47 |
| PF13518 | HTH_28 | 0.47 |
| PF02954 | HTH_8 | 0.47 |
| PF05163 | DinB | 0.47 |
| PF12146 | Hydrolase_4 | 0.47 |
| PF01300 | Sua5_yciO_yrdC | 0.47 |
| PF00180 | Iso_dh | 0.47 |
| PF13243 | SQHop_cyclase_C | 0.47 |
| PF02405 | MlaE | 0.47 |
| PF01590 | GAF | 0.47 |
| PF00248 | Aldo_ket_red | 0.47 |
| PF13414 | TPR_11 | 0.47 |
| PF13528 | Glyco_trans_1_3 | 0.47 |
| PF01381 | HTH_3 | 0.47 |
| PF00154 | RecA | 0.47 |
| PF00675 | Peptidase_M16 | 0.47 |
| PF00871 | Acetate_kinase | 0.47 |
| PF13633 | Obsolete Pfam Family | 0.47 |
| PF03460 | NIR_SIR_ferr | 0.47 |
| PF13384 | HTH_23 | 0.47 |
| PF09348 | DUF1990 | 0.47 |
| PF07719 | TPR_2 | 0.47 |
| PF13936 | HTH_38 | 0.47 |
| PF13683 | rve_3 | 0.47 |
| PF00413 | Peptidase_M10 | 0.47 |
| PF13649 | Methyltransf_25 | 0.47 |
| PF08240 | ADH_N | 0.47 |
| PF02416 | TatA_B_E | 0.47 |
| PF13544 | Obsolete Pfam Family | 0.47 |
| PF07927 | HicA_toxin | 0.47 |
| PF05960 | DUF885 | 0.47 |
| PF07963 | N_methyl | 0.47 |
| PF12867 | DinB_2 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.77 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 1.42 |
| COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 1.42 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.94 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.94 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.47 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.47 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.47 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG1501 | Alpha-glucosidase/xylosidase, GH31 family | Carbohydrate transport and metabolism [G] | 0.47 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.47 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.47 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.47 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.47 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.47 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.47 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.47 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.47 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.47 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.09 % |
| Unclassified | root | N/A | 9.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10215236 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300001593|JGI12635J15846_10655570 | Not Available | 607 | Open in IMG/M |
| 3300001661|JGI12053J15887_10273279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300004080|Ga0062385_10603545 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300004091|Ga0062387_101691857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300004092|Ga0062389_100406122 | Not Available | 1482 | Open in IMG/M |
| 3300004092|Ga0062389_103337436 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300004152|Ga0062386_101059908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300005435|Ga0070714_100420529 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300005437|Ga0070710_10507790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300005439|Ga0070711_100910469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300005444|Ga0070694_101126334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300005471|Ga0070698_101063758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 757 | Open in IMG/M |
| 3300005526|Ga0073909_10244380 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005534|Ga0070735_10292495 | Not Available | 983 | Open in IMG/M |
| 3300005537|Ga0070730_10259475 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005538|Ga0070731_10867304 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005541|Ga0070733_10143485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1546 | Open in IMG/M |
| 3300005560|Ga0066670_10955866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005568|Ga0066703_10216233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
| 3300005568|Ga0066703_10895630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300005575|Ga0066702_10189649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
| 3300005602|Ga0070762_10381209 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006041|Ga0075023_100070042 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300006052|Ga0075029_100034699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2879 | Open in IMG/M |
| 3300006052|Ga0075029_100075096 | Not Available | 1993 | Open in IMG/M |
| 3300006052|Ga0075029_100693070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300006162|Ga0075030_100365578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300006162|Ga0075030_100722111 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006162|Ga0075030_101390669 | Not Available | 550 | Open in IMG/M |
| 3300006174|Ga0075014_100137675 | Not Available | 1180 | Open in IMG/M |
| 3300006175|Ga0070712_100890403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300006176|Ga0070765_100896477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 838 | Open in IMG/M |
| 3300006176|Ga0070765_100941447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 817 | Open in IMG/M |
| 3300006176|Ga0070765_102064853 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006354|Ga0075021_10105822 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300006354|Ga0075021_11145836 | Not Available | 510 | Open in IMG/M |
| 3300006638|Ga0075522_10078245 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300006893|Ga0073928_11021174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300007076|Ga0075435_100372730 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300007258|Ga0099793_10673716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300007265|Ga0099794_10277196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 867 | Open in IMG/M |
| 3300009525|Ga0116220_10580486 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009645|Ga0116106_1306179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300009665|Ga0116135_1242002 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300009700|Ga0116217_10393352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300010048|Ga0126373_10120537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2452 | Open in IMG/M |
| 3300010048|Ga0126373_10319036 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300010048|Ga0126373_10600209 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300010048|Ga0126373_11503616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 738 | Open in IMG/M |
| 3300010339|Ga0074046_10182733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1325 | Open in IMG/M |
| 3300010343|Ga0074044_10229503 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300010361|Ga0126378_11272211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium heidelbergense | 831 | Open in IMG/M |
| 3300010362|Ga0126377_10319820 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300010366|Ga0126379_12736493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300010379|Ga0136449_101563062 | Not Available | 1005 | Open in IMG/M |
| 3300010379|Ga0136449_101675308 | Not Available | 960 | Open in IMG/M |
| 3300011086|Ga0138564_1072627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300011269|Ga0137392_10961287 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012349|Ga0137387_10754047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300012357|Ga0137384_11211501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012362|Ga0137361_11924964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300012362|Ga0137361_11930954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 507 | Open in IMG/M |
| 3300012582|Ga0137358_11061217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012683|Ga0137398_10182554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1377 | Open in IMG/M |
| 3300012685|Ga0137397_10318431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300012922|Ga0137394_10565013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300012924|Ga0137413_10240562 | Not Available | 1238 | Open in IMG/M |
| 3300012924|Ga0137413_10366674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300012930|Ga0137407_10016004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5479 | Open in IMG/M |
| 3300012944|Ga0137410_10210173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1510 | Open in IMG/M |
| 3300012960|Ga0164301_10098440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1672 | Open in IMG/M |
| 3300012971|Ga0126369_10320317 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300012976|Ga0134076_10627840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012986|Ga0164304_10310566 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300013296|Ga0157374_11258477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 762 | Open in IMG/M |
| 3300013307|Ga0157372_13440869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300014155|Ga0181524_10473015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300014165|Ga0181523_10104084 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300014165|Ga0181523_10330657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 856 | Open in IMG/M |
| 3300014495|Ga0182015_10053919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2927 | Open in IMG/M |
| 3300014969|Ga0157376_12778652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300015242|Ga0137412_10414217 | Not Available | 1041 | Open in IMG/M |
| 3300015371|Ga0132258_13120187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1145 | Open in IMG/M |
| 3300016270|Ga0182036_10302550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
| 3300016270|Ga0182036_11596878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300016319|Ga0182033_10114083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2016 | Open in IMG/M |
| 3300016319|Ga0182033_12018613 | Not Available | 525 | Open in IMG/M |
| 3300016387|Ga0182040_10660037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300017934|Ga0187803_10099033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1145 | Open in IMG/M |
| 3300017934|Ga0187803_10223783 | Not Available | 743 | Open in IMG/M |
| 3300017955|Ga0187817_10261492 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300017972|Ga0187781_11197299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300017975|Ga0187782_10597754 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300017993|Ga0187823_10365640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300017995|Ga0187816_10541946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018035|Ga0187875_10120661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1480 | Open in IMG/M |
| 3300018047|Ga0187859_10364774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300018057|Ga0187858_10592250 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300018062|Ga0187784_11648505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300018085|Ga0187772_10859768 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300018085|Ga0187772_10868577 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018090|Ga0187770_10054778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2882 | Open in IMG/M |
| 3300019082|Ga0187852_1124879 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300019362|Ga0173479_10159620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300020199|Ga0179592_10368298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300020580|Ga0210403_10188012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1694 | Open in IMG/M |
| 3300020580|Ga0210403_10203945 | Not Available | 1623 | Open in IMG/M |
| 3300020583|Ga0210401_10721895 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300021046|Ga0215015_11046443 | Not Available | 767 | Open in IMG/M |
| 3300021168|Ga0210406_10682209 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300021168|Ga0210406_10900265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300021170|Ga0210400_10747598 | Not Available | 803 | Open in IMG/M |
| 3300021170|Ga0210400_11550049 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021171|Ga0210405_10079349 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300021171|Ga0210405_11265760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300021178|Ga0210408_10752755 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300021180|Ga0210396_10898127 | Not Available | 755 | Open in IMG/M |
| 3300021181|Ga0210388_10232494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1617 | Open in IMG/M |
| 3300021181|Ga0210388_10869368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300021401|Ga0210393_10174157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. B05 | 1735 | Open in IMG/M |
| 3300021403|Ga0210397_10262298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300021407|Ga0210383_10737469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300021407|Ga0210383_11630836 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021433|Ga0210391_10236064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300021433|Ga0210391_11390218 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021433|Ga0210391_11438047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300021474|Ga0210390_11135390 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300021474|Ga0210390_11449600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300021475|Ga0210392_11478251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300021478|Ga0210402_10904999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300021479|Ga0210410_10605019 | Not Available | 973 | Open in IMG/M |
| 3300021479|Ga0210410_11190860 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300021559|Ga0210409_10397691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300021559|Ga0210409_11537419 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021560|Ga0126371_10449134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300021861|Ga0213853_10990997 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300022717|Ga0242661_1163092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300022726|Ga0242654_10072589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300023075|Ga0224520_1070542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → Micavibrio aeruginosavorus → Micavibrio aeruginosavorus EPB | 789 | Open in IMG/M |
| 3300024219|Ga0247665_1026002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli → Fimbriimonas ginsengisoli Gsoil 348 | 747 | Open in IMG/M |
| 3300025916|Ga0207663_11060576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300025927|Ga0207687_10998278 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300025929|Ga0207664_10222340 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300025937|Ga0207669_11751282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300026320|Ga0209131_1093833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1594 | Open in IMG/M |
| 3300026551|Ga0209648_10423858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300026783|Ga0207778_110976 | Not Available | 653 | Open in IMG/M |
| 3300026890|Ga0207781_1029200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300027376|Ga0209004_1070558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300027376|Ga0209004_1086562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300027388|Ga0208995_1020611 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300027439|Ga0209332_1021181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300027565|Ga0209219_1016674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1769 | Open in IMG/M |
| 3300027635|Ga0209625_1047890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 954 | Open in IMG/M |
| 3300027660|Ga0209736_1063177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
| 3300027826|Ga0209060_10453369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300027826|Ga0209060_10586987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300027857|Ga0209166_10037340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2912 | Open in IMG/M |
| 3300027867|Ga0209167_10172794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300027884|Ga0209275_10151328 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300027889|Ga0209380_10119332 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300027889|Ga0209380_10382257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300027894|Ga0209068_10081450 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300027911|Ga0209698_10296868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300027911|Ga0209698_11373081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300027986|Ga0209168_10020919 | All Organisms → cellular organisms → Bacteria | 3701 | Open in IMG/M |
| 3300028381|Ga0268264_11777821 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Dictyosteliales → Dictyosteliaceae → Polysphondylium → Polysphondylium violaceum | 627 | Open in IMG/M |
| 3300028536|Ga0137415_10699823 | Not Available | 826 | Open in IMG/M |
| 3300028673|Ga0257175_1011459 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300028906|Ga0308309_11152740 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300030007|Ga0311338_11508935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300030617|Ga0311356_10818894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300030847|Ga0075405_10642700 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031090|Ga0265760_10089183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300031231|Ga0170824_123722485 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031231|Ga0170824_128292658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300031236|Ga0302324_101943526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300031240|Ga0265320_10342363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300031446|Ga0170820_12365446 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031525|Ga0302326_11709588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300031544|Ga0318534_10561127 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031546|Ga0318538_10807340 | Not Available | 509 | Open in IMG/M |
| 3300031573|Ga0310915_10622238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300031668|Ga0318542_10215014 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300031708|Ga0310686_107047300 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300031708|Ga0310686_113946631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300031719|Ga0306917_10191864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1542 | Open in IMG/M |
| 3300031720|Ga0307469_10963103 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031753|Ga0307477_11051404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300031754|Ga0307475_10323190 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300031754|Ga0307475_10785776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300031754|Ga0307475_11441911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300031770|Ga0318521_10972362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300031942|Ga0310916_10097693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2355 | Open in IMG/M |
| 3300031945|Ga0310913_10517093 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031946|Ga0310910_11445334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300031954|Ga0306926_12411307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300032001|Ga0306922_10451654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300032010|Ga0318569_10344140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300032160|Ga0311301_12126419 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032174|Ga0307470_10765276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 744 | Open in IMG/M |
| 3300032174|Ga0307470_11694886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300032180|Ga0307471_100198638 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 2003 | Open in IMG/M |
| 3300032180|Ga0307471_104344594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300032770|Ga0335085_10888786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300032783|Ga0335079_11393530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300032805|Ga0335078_11706640 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300032828|Ga0335080_11172547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300033004|Ga0335084_11459904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300034163|Ga0370515_0073346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
| 3300034282|Ga0370492_0257121 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.30% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.47% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.47% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_102152361 | 3300001593 | Forest Soil | YTQANGATGKPHKLEVRLKSSFGKKGHDYVVLAKNGYYVH* |
| JGI12635J15846_106555702 | 3300001593 | Forest Soil | NGATGKPHKLDIRLKSSFGKKGHDYVMLAKSGYYVH* |
| JGI12053J15887_102732793 | 3300001661 | Forest Soil | TRYTLGYYTSVNGAEGKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR* |
| Ga0062385_106035451 | 3300004080 | Bog Forest Soil | RALIQRIKTRYTLGYYTNATAALGKPHKLDVRLASSFGKKGKDYVILSKNGFYVH* |
| Ga0062387_1016918572 | 3300004091 | Bog Forest Soil | YYTSVNGANGKPHKLDVRLAPSFGTKGKDYSILSKNSFYFH* |
| Ga0062389_1004061222 | 3300004092 | Bog Forest Soil | TLGFYTNATGGEGKPHKLDVRLASSFGKKGKDYNILAKSSYYIH* |
| Ga0062389_1033374361 | 3300004092 | Bog Forest Soil | NLITRIKTRYTLGYYTSVNGANGKPHKLDVRLAPSFGTKGKDYSILSKNSFYFH* |
| Ga0062386_1010599082 | 3300004152 | Bog Forest Soil | IKTRYTLGYYTSATAALGKPHKLDLRLAPSFGKKGRDYSVLSKSAFYVH* |
| Ga0070714_1004205292 | 3300005435 | Agricultural Soil | DRIKTRYTLGYYTSATGAAGKPHKLDVRLASSFGKKGHDYIVLAKNGYYVH* |
| Ga0070710_105077903 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YTQATGAEGKPHKLDLRLASSFGKKGHDYVVLAKRGYYVH* |
| Ga0070711_1009104692 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VFDVQNVANLDSTFRALIQRIKTRYTIGYYTKATAAEGKQHKLDLRLVPSFGKKGREYVVLTKTAFYVH* |
| Ga0070694_1011263342 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | IERIKTRYTLGYYTKASAAEGKPHRLDVRLVASHGKKGKDYAVLSKNGFYVH* |
| Ga0070698_1010637583 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | YTKASAALGKPHKLDVRLAASFGKKGKDYVVLSKNGFYVH* |
| Ga0073909_102443802 | 3300005526 | Surface Soil | IKTRYTLGYYTKASAAEGKPHKLDVHLAPSFGKKGRDYVVLSKNGFYVH* |
| Ga0070735_102924951 | 3300005534 | Surface Soil | YTLGYYTSANGAEGKPHKLDVRLVRSFGTKGRSYAILAKSGYFIP* |
| Ga0070730_102594754 | 3300005537 | Surface Soil | AEGKAHKLDVRLASSFGKKGKDYVVLCKNGFYVH* |
| Ga0070731_108673041 | 3300005538 | Surface Soil | ATAAEGKAHKLDVRLASSFGKKGKDYVVLCKNGFYVH* |
| Ga0070733_101434851 | 3300005541 | Surface Soil | AEGKPHKLEVRLASSFGKKGRDYTILAKTGYFIP* |
| Ga0066670_109558661 | 3300005560 | Soil | TRYTLGYYTHATAAEGKPHKLDIRLAPMFGKKGRDYVVLAKTGFYVH* |
| Ga0066703_102162331 | 3300005568 | Soil | SANGAEGKPHKLDVRLAASFGKKGRDYAILAKRGYFIP* |
| Ga0066703_108956301 | 3300005568 | Soil | SANGAEGKPHKLDVRLASSFGKKGRDYAILAKSGYFIP* |
| Ga0066702_101896493 | 3300005575 | Soil | DSTFRALIERIKPRYTLRYYTAANGAQGKPHKLEVRLASSFGKKGRDYSILAKSGYFIP* |
| Ga0070762_103812091 | 3300005602 | Soil | IQRIKTRYTLGYYTNASAALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH* |
| Ga0075023_1000700421 | 3300006041 | Watersheds | YYTSANGAEGKPHKLDVRLAPSFGKKGRDYFILSKNSYYFR* |
| Ga0075029_1000346995 | 3300006052 | Watersheds | GYYTAANGAGGKPHKLDVRLTSSFGKKGRDYTILSKNGYYVH* |
| Ga0075029_1000750961 | 3300006052 | Watersheds | GYYTSANGAEGKPHKLDVRLAPSFGKKGRDYTILSKNSYYFR* |
| Ga0075029_1006930702 | 3300006052 | Watersheds | ALIERIKTRYTLGYYTNATGATGKPHQLDLRLASSFGKKGHDYVVLAKSGYYVH* |
| Ga0075030_1003655781 | 3300006162 | Watersheds | FGALIQRIKTRYTLGYYTNATGELAKPHKLDVRLKSQFGTKGKNYIVLSKNGFFVQ* |
| Ga0075030_1007221111 | 3300006162 | Watersheds | AEGKPHKLEVRLASSFGAKGRDYIILSKNSYYFR* |
| Ga0075030_1013906691 | 3300006162 | Watersheds | YYTSANGAQGKPHKLDVRLTPSFGKKGRDYTILSKNSYYFR* |
| Ga0075014_1001376752 | 3300006174 | Watersheds | TLGYYTMANGAEGKPHKLDVRLVSSFGKKGKDYTILSKNGYYVH* |
| Ga0070712_1008904031 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KASAALGKPHKLDVRLAPSFGKKGKDYVVLSKNGFYVH* |
| Ga0070765_1008964772 | 3300006176 | Soil | TGAAGKPHKLDVHLASSFGKKGRDYVVLAKSGYYVH* |
| Ga0070765_1009414471 | 3300006176 | Soil | KTRYTLGYYTNATGEMGKPHKLDVRLGPSFGTKGKNYIVLSKNGFYVQ* |
| Ga0070765_1020648531 | 3300006176 | Soil | GYYTNASAALGKPHKLDIRLVSSFGKKGRDYVVLSKNGFYVH* |
| Ga0075021_101058224 | 3300006354 | Watersheds | GYYTSVNGADGKPHKLDVRLAPSFGAKGRNYAVLAKTSFYFR* |
| Ga0075021_111458362 | 3300006354 | Watersheds | RIKTRYTLGYYTNATGELAKPHKLDVRLQSQFGTKGKNYIVLSKNGFFVQ* |
| Ga0075522_100782453 | 3300006638 | Arctic Peat Soil | RYTLGYYTSANGAEGKPHKLDVRLAASFGKKGAAYSILAKNAYYFGP* |
| Ga0073928_110211741 | 3300006893 | Iron-Sulfur Acid Spring | ANGAEGKPHKLDVRLVSSFGKKGRDYVILAKSGYFIP* |
| Ga0075435_1003727302 | 3300007076 | Populus Rhizosphere | FRALIERIKTRYTLGYYTKASAAEGKPHRLDVRLVASHGKKGKDYAVLSKNGFYVH* |
| Ga0099793_106737161 | 3300007258 | Vadose Zone Soil | TSVNGAEGKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR* |
| Ga0099794_102771961 | 3300007265 | Vadose Zone Soil | TNGADGKPHKLDVRLAPSFGVKGRNYNLLAKTSFYFR* |
| Ga0116220_105804862 | 3300009525 | Peatlands Soil | YTMANGAEGKPHKLDVRLASSFGKKGRDYSILAKNGYYIH* |
| Ga0116106_13061791 | 3300009645 | Peatland | RIRTRYTLGYYTSANGASGKPHKLDVRLTRSFGTKGKDYVVLARNSYYFGP* |
| Ga0116135_12420022 | 3300009665 | Peatland | EATGAKGKPHKLDLRLTSSFGKKGRDYVVLAKNGYYVH* |
| Ga0116217_103933521 | 3300009700 | Peatlands Soil | AEGKPHKLDVVLAPSFGKKGKDYLLLSKTGYYIR* |
| Ga0126373_101205371 | 3300010048 | Tropical Forest Soil | LISRIKTRYTVGYYTNANGANGKPHKLDVRLASSFGKKGHDYVILSKSGYYVH* |
| Ga0126373_103190364 | 3300010048 | Tropical Forest Soil | ALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH* |
| Ga0126373_106002091 | 3300010048 | Tropical Forest Soil | TAALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH* |
| Ga0126373_115036163 | 3300010048 | Tropical Forest Soil | YTNATAALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH* |
| Ga0074046_101827334 | 3300010339 | Bog Forest Soil | YTKATGAEGKPHKLEVRLTSSFGKKGHDYVVLAKNGYYVH* |
| Ga0074044_102295031 | 3300010343 | Bog Forest Soil | RALIQRIKTRYTLGYYTNATAALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH* |
| Ga0126378_112722111 | 3300010361 | Tropical Forest Soil | LGYYTKASAAEGKPHKLDVRLTASFGKKGRDYVVLSKNGFYVH* |
| Ga0126377_103198201 | 3300010362 | Tropical Forest Soil | TRYTLGYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH* |
| Ga0126379_127364932 | 3300010366 | Tropical Forest Soil | KASAAEGKPHKLDVRLATSFGKKGRDYVVLSKNGFYVH* |
| Ga0136449_1015630621 | 3300010379 | Peatlands Soil | GADGKPHKLDVRLVRSFGTKGRNYAILAKSGYFIP* |
| Ga0136449_1016753081 | 3300010379 | Peatlands Soil | YTDATGELAKPHKLEVRLTPQFGTKGKNYIVLAKNGFFVQ* |
| Ga0138564_10726272 | 3300011086 | Peatlands Soil | ANGAEGKPHKLDVRLAPSFGAKGRNYSILAKSEYYFRP* |
| Ga0137392_109612872 | 3300011269 | Vadose Zone Soil | RYTLGYYTKASAAEGKPHKLDLRLASSFGKKGHDYLMLSKGGFYVH* |
| Ga0137387_107540471 | 3300012349 | Vadose Zone Soil | AVFHALMERIKTRYSLGYYTSVNGAEGKPHKLDVRLAPSLGVKGRNYVILSKSGFYFR* |
| Ga0137384_112115012 | 3300012357 | Vadose Zone Soil | TSANGAEGKPHKLDVRLASPFGTKGRNYTILSKNGYYFVP* |
| Ga0137361_119249642 | 3300012362 | Vadose Zone Soil | YTLGYYTKASAALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH* |
| Ga0137361_119309543 | 3300012362 | Vadose Zone Soil | YTSINGADGKPHKLDVRLAPSFGAKGRNYNLLAKTSFYFR* |
| Ga0137358_110612172 | 3300012582 | Vadose Zone Soil | YYTSVNGAEGKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR* |
| Ga0137398_101825541 | 3300012683 | Vadose Zone Soil | RYTLGYYTSVNGADGKQHKLDVRLAPSFGARGRNYNLLAKTSFYFR* |
| Ga0137397_103184311 | 3300012685 | Vadose Zone Soil | IERIKTRYTLGYYTKASAALGRPHKLDVRLASSFGKKGKDYVVLSKNGFYVH* |
| Ga0137394_105650131 | 3300012922 | Vadose Zone Soil | NGAEGKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR* |
| Ga0137413_102405621 | 3300012924 | Vadose Zone Soil | NGAEGKPHKLDIRLAPSFGKKGRDYVILAKNSYYFR* |
| Ga0137413_103666742 | 3300012924 | Vadose Zone Soil | AAEGKAHKLDLRLLPSFGKKGKDYVVLSKNGFYVH* |
| Ga0137407_100160041 | 3300012930 | Vadose Zone Soil | ALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH* |
| Ga0137410_102101732 | 3300012944 | Vadose Zone Soil | YTLGYYTSVNGAEGKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR* |
| Ga0164301_100984401 | 3300012960 | Soil | VFRALIDRIKTRYTLGYYTNATAALGKPHKLDVHLSSSFGKKNRDYVVLTKTGFYVH* |
| Ga0126369_103203172 | 3300012971 | Tropical Forest Soil | ASAAEGKPHKLDVRLAASFGKKGRDYMVLSKNGFYVH* |
| Ga0134076_106278401 | 3300012976 | Grasslands Soil | AAEGKPHKLDIRLAPMFGKKGRDYVVLAKTGFYVH* |
| Ga0164304_103105662 | 3300012986 | Soil | TRYTLGYYTMATGGEGRPHKLDVRLASSFGKKGRDYTILSKNGYYIH* |
| Ga0157374_112584771 | 3300013296 | Miscanthus Rhizosphere | TRYTLGYYTKASAAEGKPHRLDVRLVASHGKKGKDYAVLSKNGFYVH* |
| Ga0157372_134408692 | 3300013307 | Corn Rhizosphere | RASGAEGKPHKLDVRLKSSFGNKGRDYTLLSKSSYYVP* |
| Ga0181524_104730152 | 3300014155 | Bog | LGYYTSANGAEGKPHKLDVRLAPSFGTKGRNYVILAKSGYYFR* |
| Ga0181523_101040841 | 3300014165 | Bog | TRYNIGYYTNATAATGKPHKVDVRLTSSYGKKGHDYVVLAKSSFYVH* |
| Ga0181523_103306571 | 3300014165 | Bog | AEGKPHKLEVRLSPSFGKKGRDYVILAKSGYYIP* |
| Ga0182015_100539191 | 3300014495 | Palsa | VFSALLERIRTRYTLGYYTSASEVGGKPHKLDVRLAPSFGTKGRDYIILSKNSYYFRP* |
| Ga0157376_127786521 | 3300014969 | Miscanthus Rhizosphere | KTRYTLGYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH* |
| Ga0137412_104142172 | 3300015242 | Vadose Zone Soil | NGAEGKPHKLDIRLAPSFGKKGRDYAILAKNSYYFR* |
| Ga0132258_131201871 | 3300015371 | Arabidopsis Rhizosphere | AEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH* |
| Ga0182036_103025502 | 3300016270 | Soil | IKTRYTLGYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0182036_115968782 | 3300016270 | Soil | QRIKTRYTLGYYTNATAALGKPHKIDVRLAPSFGKKGHDYTALSRSAFYVH |
| Ga0182033_101140831 | 3300016319 | Soil | SAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0182033_120186131 | 3300016319 | Soil | KTRYTLGYYTNATAALGKPHKIDVRLGPSFGKKGHDYTAFSRSAFYVH |
| Ga0182040_106600371 | 3300016387 | Soil | SHLDETFRALIERIKTRYTLEYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0187803_100990332 | 3300017934 | Freshwater Sediment | YYTSANGAEGKPHKLDVRLTSSFGAKGRNYIVLAKSGYYFR |
| Ga0187803_102237832 | 3300017934 | Freshwater Sediment | NGAEGKPHKLDVRLAPSFGTKGRNYVVLAKSGYYFR |
| Ga0187817_102614922 | 3300017955 | Freshwater Sediment | VFSALIQRIKTRYTLGYYTMANGAELKPHKLDVRLASSFGKKGHDYNILAKNSYYVH |
| Ga0187781_111972992 | 3300017972 | Tropical Peatland | TFQALIERIKTRYTLGYYTSANGASGKPHKIDIRLASSFGVKGRNYLVLSKNSYYFR |
| Ga0187782_105977543 | 3300017975 | Tropical Peatland | IARIKTRYTLGYYTSANGALGKPHKLDVRLVSSFGSKGRNYVILAKGAYFIP |
| Ga0187823_103656401 | 3300017993 | Freshwater Sediment | LINRIKTRYTVGYYTNTNGASGKPHKLDVRLASSFGKKGRDYVILAKSGYYVH |
| Ga0187816_105419462 | 3300017995 | Freshwater Sediment | GYYTNASGAEGKPHKLDVVLAPSFGKKGKDYLLLSKTGYYIR |
| Ga0187875_101206611 | 3300018035 | Peatland | GYYTSANGAEGKPHKLEVRLSPSFGKKGRDYVILAKSGYYIP |
| Ga0187859_103647742 | 3300018047 | Peatland | RYALGYYTSATGAMGKPHKLDVRLAPSFGTKGRDYIVLSKTSYYIGP |
| Ga0187858_105922502 | 3300018057 | Peatland | YTQATGATGKPHKLDVHLAGSYGKKGKDYVILSKNGYYVH |
| Ga0187784_116485052 | 3300018062 | Tropical Peatland | SALIARIKTRYTLGYYTSANGALGKPHKLDVRLVSSFGSKGRNYVILAKGAYFIP |
| Ga0187772_108597681 | 3300018085 | Tropical Peatland | ANGADGKPHKLDVRLKPSFGTKGRNYMILAKSGYYFGP |
| Ga0187772_108685773 | 3300018085 | Tropical Peatland | RYTLGFYTNATAAAGKPHKLDLRLSPSFGKKGKDYLVLSKTGYYIH |
| Ga0187770_100547781 | 3300018090 | Tropical Peatland | KTRYTVGYYTNATAASGKPHKLDVRLTSSHGKKGRDYLLLAKSSYYVH |
| Ga0187852_11248791 | 3300019082 | Peatland | TRYTLGYYTSANGASGKPHKLDVRLTRSFGTKGKDYVVLARNSYYFGP |
| Ga0173479_101596201 | 3300019362 | Soil | TKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0179592_103682981 | 3300020199 | Vadose Zone Soil | RYTLGYYTSVNGAEDKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR |
| Ga0210403_101880121 | 3300020580 | Soil | DAEFRALIQRIKTRYTLGYYTNASAALGKPHKLDVRLASSFGKKGKDYVMLSKNGFYVH |
| Ga0210403_102039453 | 3300020580 | Soil | YTKATGAAGKPHKLDVRLAASFGKKGHDYVVLSKSSYYVH |
| Ga0210401_107218951 | 3300020583 | Soil | TNASAALGKPHKLDVRLASSFGKKGHDYVILSKTGFYVH |
| Ga0215015_110464431 | 3300021046 | Soil | ETDTLGYYTKASAALGKPHKLDVRLGSSFGKKGKDYVVSSKNGFYVH |
| Ga0210406_106822092 | 3300021168 | Soil | TNASAALGKPHKLDVRLASSFGKKGRDYVVLSKNGFYVH |
| Ga0210406_109002652 | 3300021168 | Soil | TGAAGKPHKLDVHLASSFGKKGRDYVVLAKSGYYVH |
| Ga0210400_107475982 | 3300021170 | Soil | DTTTATAAAGKPHKLDLRLTASFGKKGRDYMVLAKSGYYVH |
| Ga0210400_115500492 | 3300021170 | Soil | RYTLGYYTNASAALGKPHKLDVRLASSFGKKGKDYVILSKNGFYVH |
| Ga0210405_100793495 | 3300021171 | Soil | LGYYTMANGAEGKPHKLEVRLASSFGKKGRDYSILAKNGYYIH |
| Ga0210405_112657602 | 3300021171 | Soil | GYYTSANGAQGKPHKLEVRLAPSFGKKGRDYSILAKSGYFIP |
| Ga0210408_107527552 | 3300021178 | Soil | SAALGKPHKLDVRLASSLGKKGRDYVVLSKSGFYVH |
| Ga0210396_108981272 | 3300021180 | Soil | LGYYTMANGAGGKPHKLDVRLASSFGKKGRDYNILAKNGYYVH |
| Ga0210388_102324941 | 3300021181 | Soil | FRALIQRIKTRYTLGYYTEASAALGKPHKLDVRLASSFGKKGRDYVILSKTGFYVH |
| Ga0210388_108693682 | 3300021181 | Soil | YTLGYYTSATAALGKPHKLDVRLAPSFGKKGRDYSVLSKSAFYVH |
| Ga0210393_101741571 | 3300021401 | Soil | TNASAALGKPHKLEVRLASSFGKKGKDYVILSKNGFYVH |
| Ga0210397_102622983 | 3300021403 | Soil | ATGAEGKPHKLDLRLASSFGKKGHDYVVLAKSGYYVH |
| Ga0210383_107374691 | 3300021407 | Soil | SANGAEGKPHKLDVRLVRSFGAKGRNYAILAKSGYFIP |
| Ga0210383_116308362 | 3300021407 | Soil | TRYTLGYYTHATAATGKPHKLDVRLAPSYGKKGHDYVVLAKTGYYVH |
| Ga0210391_102360643 | 3300021433 | Soil | FAALIERIKTRYTVGYYTNANGASGKPHKLDVRLSSSFGKKGHDYIVLAKSGYYVH |
| Ga0210391_113902181 | 3300021433 | Soil | YTLGYYTNASAALGKPHKLDVRLASSFGKKGRDYAVLSKNGFYVH |
| Ga0210391_114380472 | 3300021433 | Soil | AALGKPHKLDVRLAPSFGKKGRDYSVLSKSAFYVH |
| Ga0210390_111353901 | 3300021474 | Soil | SQLDAVFSALIQRIKTRYTLGYYTMANGAELKPHKLDVRLAPSFGKKGRDYNILAKNSYYVH |
| Ga0210390_114496001 | 3300021474 | Soil | TAATGKPHKLDVRLAPPYGKKGHDYVVLAKTGYYVH |
| Ga0210392_114782512 | 3300021475 | Soil | ATGAAGKPHKLDVHLASSFGKKGRDYVVLAKSGYYVH |
| Ga0210402_109049992 | 3300021478 | Soil | ALIQRIKTRYTLGYYTNASAALGKPHKLDVRLVSSFGKKGKDYVMLSKNGFYVH |
| Ga0210410_106050191 | 3300021479 | Soil | TATAAAGKPHKLDLRLTASFGKKGRDYMVLAKSGYYVH |
| Ga0210410_111908602 | 3300021479 | Soil | KTRYTLGYYTNASAALGKPHKLDVRLASSFGKKGHDYVILSKTGFYVH |
| Ga0210409_103976913 | 3300021559 | Soil | TSASGAEGKPHKLEVRLGSSFGKKGRDYTILAKTGYFIP |
| Ga0210409_115374191 | 3300021559 | Soil | YYTNASGAEGKPHKLEVRLASSFGKKGRDYTILAKNSYYIR |
| Ga0126371_104491341 | 3300021560 | Tropical Forest Soil | NANGANGKPHKLDVRLASSFGKKGHDYVILAKSGYYVH |
| Ga0213853_109909971 | 3300021861 | Watersheds | NASAALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH |
| Ga0242661_11630921 | 3300022717 | Soil | ANGAEGKPHKLDVRLAASFGKKGRDYAILSKSGYYIP |
| Ga0242654_100725893 | 3300022726 | Soil | SASGAEGKPHKLEVRLGSSFGKKGRDYTILSKTGYFIP |
| Ga0224520_10705421 | 3300023075 | Soil | TKATGAEGKPHKLDVRLTSSFGKKGHDYVVLAKSGYYVH |
| Ga0247665_10260023 | 3300024219 | Soil | YTKASAAQGKPHKLDVRLAGSFGKKGKDYVVLAKNGFYVH |
| Ga0207663_110605762 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IDRIKTRYTLGYYTNATAALGKPHKLDVRLSSSFGKKNRDYVVLSKTGFYVH |
| Ga0207687_109982782 | 3300025927 | Miscanthus Rhizosphere | TGGEGRPHKLDVRLASSFGKKGRDYTILSKNGYYIH |
| Ga0207664_102223401 | 3300025929 | Agricultural Soil | DRIKTRYTLGYYTSATGAAGKPHKLDVRLASSFGKKGHDYIVLAKNGYYVH |
| Ga0207669_117512821 | 3300025937 | Miscanthus Rhizosphere | ASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0209131_10938332 | 3300026320 | Grasslands Soil | VFRALMERIKTRYTLGYYTSVNGAEGKPHKLDVRLAPSFGTKGRNYVILSKSGFYFR |
| Ga0209648_104238583 | 3300026551 | Grasslands Soil | RYTLGYYTSANGAQGKPHKLEVRLASSFGKKGRDYSILAKNGYFIP |
| Ga0207778_1109761 | 3300026783 | Tropical Forest Soil | AALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH |
| Ga0207781_10292002 | 3300026890 | Tropical Forest Soil | DEVFRALIQRIKTRYTLGYYTNATAALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH |
| Ga0209004_10705582 | 3300027376 | Forest Soil | KTRYTLGYYTSASGAEGKPHKLEVRLASSFGKKGRDYTILAKTGYFIP |
| Ga0209004_10865621 | 3300027376 | Forest Soil | FRALIHRIKTRYTLGFYTKANGAEDKPHKLDVRLAPSFGKRGREYTVLAKNGYYVH |
| Ga0208995_10206112 | 3300027388 | Forest Soil | VNGAEGKPHKLDVRLAPSFGTKGRNYIVLSKSGFYFR |
| Ga0209332_10211812 | 3300027439 | Forest Soil | NGATGKPHKLEVRLKSSLGKKGHDYVILAKNGYYVH |
| Ga0209219_10166743 | 3300027565 | Forest Soil | KTRYTLGYYTLANGAEGKPHKLDVRLASSFGKKGRDYSILAKNGYYIH |
| Ga0209625_10478901 | 3300027635 | Forest Soil | FGALMERIKTRYTLGYYTSVNGAEGKPHKLDVRLAPAFGTKGRNYVVLSKSAFYFR |
| Ga0209736_10631771 | 3300027660 | Forest Soil | TEANGAEGKPHKLDVRLASSFGTKGRDYVVLAKNSYYFVP |
| Ga0209060_104533692 | 3300027826 | Surface Soil | IKTRYTLGYYTSASGAEGRPHKLEVRLGPSFGKKGRDYTILAKSGYFIP |
| Ga0209060_105869872 | 3300027826 | Surface Soil | YTLGYYTNANGAGGKPHKLDVRLASSFGKKGRDYTILSKNGYYVH |
| Ga0209166_100373402 | 3300027857 | Surface Soil | NATAALGKPHKLDVRLSSSFGKKNRDYVVLTKSGFYVH |
| Ga0209167_101727942 | 3300027867 | Surface Soil | YTLGYYTNATGAAGKPHKLDVHLASSFGKKGRDYVVLAKSGYYVH |
| Ga0209275_101513283 | 3300027884 | Soil | IQRIKTRYTLGYYTNASAALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH |
| Ga0209380_101193323 | 3300027889 | Soil | ITRIKTRYTLGYYTQATAALGKPHKLDLRLVPSFGKKSRDYSILAKNSFYVH |
| Ga0209380_103822572 | 3300027889 | Soil | VGYYTNANGASGKPHKLDVPLSSSFGKKGHDYIVLAKSGYYVH |
| Ga0209068_100814503 | 3300027894 | Watersheds | GYYTSVNGADGKPHKLDVRLAPSFGAKGRNYAVLAKTSFYFR |
| Ga0209698_102968681 | 3300027911 | Watersheds | RYTLGYYTNATGELAKPHKLDVRLKSQFGTKGKNYIVLSKNGFFVQ |
| Ga0209698_113730812 | 3300027911 | Watersheds | TQANGAEGKPHKLEVRLASSFGAKGRDYIILSKNSYYFR |
| Ga0209168_100209194 | 3300027986 | Surface Soil | PVFRSLIQRIKTRYTLGYYTNASAALGKPHKLDVRLASSFGKKGKDYVILSKTGFYVH |
| Ga0268264_117778212 | 3300028381 | Switchgrass Rhizosphere | AAEGKPHKLDVRLVASHGKKGKDYIVLSKSGFYVH |
| Ga0137415_106998231 | 3300028536 | Vadose Zone Soil | TLGYYTSANGAEGKPHKLDIRLAPSFGKKGRDYAILAKNSYYFR |
| Ga0257175_10114592 | 3300028673 | Soil | TLGYYTKASAALGRPHKLDVRLASSFGKKGKDYVVLSKNGFYVH |
| Ga0308309_111527401 | 3300028906 | Soil | IHRIKTRYTMGYYPLSSVPSDKPHKLEVRLAPSFGKKGRDYVVVAKSGFYVH |
| Ga0311338_115089351 | 3300030007 | Palsa | TRYTLGYYTAANGALGKPHKLDVRLVKSFGTKGKDYVILSKSSYYFGP |
| Ga0311356_108188942 | 3300030617 | Palsa | YYTQANGGEGKPHKLDVRLTSSFGKKGKDYVVLAKSGYYVH |
| Ga0075405_106427002 | 3300030847 | Soil | IKTRYTLGYYTQANGATGKPHKLEVRLKSSFGKKGHDYVILAKNGYYVH |
| Ga0265760_100891833 | 3300031090 | Soil | GYYTKATAAEGKPHKLDVRLAPSFGKKGHDYVILAKNGYYVH |
| Ga0170824_1237224851 | 3300031231 | Forest Soil | SAAEGKAHKLDLRLAPSFGKKGHDYLMLAKSGFYVH |
| Ga0170824_1282926581 | 3300031231 | Forest Soil | KTRYTLGYYTKATAAEGKPHKLDVRLAPSFGKKGHDYVILSKSGYYVH |
| Ga0302324_1019435261 | 3300031236 | Palsa | FAALIERIRTRYALGYYTSATGAMGKPHKLDVRLAPSFGTKGRDYVMLSKTSYYIGP |
| Ga0265320_103423633 | 3300031240 | Rhizosphere | ASAALGKPHKLDVRLASSFGKKGKDYVVLSKNGFYVH |
| Ga0170820_123654461 | 3300031446 | Forest Soil | HALIERIKTRYTLGYYTQANGATGKPHKLEVRLKSSFGKKGHDYVILAKNGYYVH |
| Ga0302326_117095881 | 3300031525 | Palsa | TLGYYTSASEVVSKPHKLDVRLAPSFGTKGRDYIVLAKGSYYFRP |
| Ga0318534_105611271 | 3300031544 | Soil | LGYYTKASAAEGKAHKLDVHLAPSFGKKGRDYLVLSKNGFYVH |
| Ga0318538_108073401 | 3300031546 | Soil | LGYYTNATAALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH |
| Ga0310915_106222381 | 3300031573 | Soil | ERIKTRYTLEYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0318542_102150141 | 3300031668 | Soil | YYTNAIAALGKPHKIDVRLGPSFGKKGHDYTVLSRSAFYVH |
| Ga0310686_1070473004 | 3300031708 | Soil | RALIQRIKTRYTLGYYTNASAALGKPHKLDVRLASSFGKKGKDYVILSKNGFYVH |
| Ga0310686_1139466311 | 3300031708 | Soil | AAEGKAHKLDVHLAKSFGKKGKDYVILSKNGYYVH |
| Ga0306917_101918644 | 3300031719 | Soil | IKTRYTLEYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0307469_109631032 | 3300031720 | Hardwood Forest Soil | TLGYYTSANGAKGKPHKLDVRLASSFGSKGRDYVVLSKSSYYFR |
| Ga0307477_110514042 | 3300031753 | Hardwood Forest Soil | TLGYYTSASGAEGKPHKLEVRLGSSFGKKGRDYTILAKTGYFIP |
| Ga0307475_103231902 | 3300031754 | Hardwood Forest Soil | DRIKTRYTLGYYTDATGAAGKPHKLDVHLASSFGKKGRDYVVLAKSGYYVH |
| Ga0307475_107857761 | 3300031754 | Hardwood Forest Soil | VANLDSVFRALIQRIKTRYTLGYYTQANGATGKPHKLDVRLKPSFGKKGHDYVMLAKSGYYVH |
| Ga0307475_114419111 | 3300031754 | Hardwood Forest Soil | LGYYTSVNGAEGKQHKLDVRLAPAFGTKGRNYVVLSKTAFYFR |
| Ga0318521_109723621 | 3300031770 | Soil | PDVAHLDEVFRALIQRIKTRYTLGYYTNATAALGKPHKIDVRLGPSFGKKSHDYTVLSRSAFYVH |
| Ga0310916_100976935 | 3300031942 | Soil | TLGYYTKASAAEGKPHKLDVRLAASFGKKGRDYVVLSKNGFYVH |
| Ga0310913_105170932 | 3300031945 | Soil | IKTRYTLGYYTNATAALGKPHKIDVRLGPSFGKKGHDYTALSRSAFYVH |
| Ga0310910_114453341 | 3300031946 | Soil | TVGYYTNATGASGKPHKLDVRLAPSFGKKGHDYMILAKSGYYVH |
| Ga0306926_124113071 | 3300031954 | Soil | NTTGASGKPHKLDVRLAPSFGKKGHDYVILAKSGYYVH |
| Ga0306922_104516541 | 3300032001 | Soil | GYYTNATAALGKPHKIDVRLGPSFGKKGHDYTAFSRSAFYVH |
| Ga0318569_103441402 | 3300032010 | Soil | VFRALIQRIKTRYTLGYYTNATAALGKPHKIDVRLGPSFGKKSHDYTVLSRSAFYVH |
| Ga0311301_121264192 | 3300032160 | Peatlands Soil | TLGYYTMANGAEGKPHKLDVRLASSFGKKGRDYSILSKNGYYIH |
| Ga0307470_107652761 | 3300032174 | Hardwood Forest Soil | LGYYTSVNGADGKQHKLDVRLAPSFGAKGHTYNVLAKTAFYFR |
| Ga0307470_116948861 | 3300032174 | Hardwood Forest Soil | YTLGYYTKATAAEGKPHKLDVRLAPSFGKKGHDYVILAKSGYYVH |
| Ga0307471_1001986383 | 3300032180 | Hardwood Forest Soil | TLGYYTQATGAEGKPHKLDVRLASSFGKKGHDYVVMAKSGYYVH |
| Ga0307471_1043445942 | 3300032180 | Hardwood Forest Soil | RYTLGYYTSASGAEGKPHKLEVRLASSFGKKGRDYSILAKSGYFIP |
| Ga0335085_108887862 | 3300032770 | Soil | YTLGYYTSANGAQGKPHKLDVRLAPSFGAKGKNYIILSKNSYYFR |
| Ga0335079_113935301 | 3300032783 | Soil | GYYTNATGAEGKPHKLDVRLTASYGKKGHDYVVLAKNGYYVH |
| Ga0335078_117066404 | 3300032805 | Soil | LIQRIKTRYTLGYYTHATAALGKPHKLDLRLSPSFGKKGKDYVVLSKTAYYIH |
| Ga0335080_111725471 | 3300032828 | Soil | GYYTKATAAEGKPHKLDVRLTPSFGKKGHDYVILAKTGYYVH |
| Ga0335084_114599041 | 3300033004 | Soil | YTSANGALGKPHKLDVRLADSFGVKGKNYLILAKNGYYFVP |
| Ga0370515_0073346_2_142 | 3300034163 | Untreated Peat Soil | RYTLGYYTKATAAEGKPHKLDVRLASSFGKKGRDYVILSKNSYYVH |
| Ga0370492_0257121_3_125 | 3300034282 | Untreated Peat Soil | YTNATGGEGKPHKLEVRLSPSFGKKGKDYSLLAKGSYYIH |
| ⦗Top⦘ |