


| Basic Information | |
|---|---|
| Family ID | F022932 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 42 residues |
| Representative Sequence | NERDGEEAISKISLAAWRMFDRLSRATEYGRVVSPGNGSR |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 93.40 % |
| % of genes from short scaffolds (< 2000 bps) | 85.85 % |
| Associated GOLD sequencing projects | 173 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.528 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.226 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF00563 | EAL | 11.32 |
| PF01578 | Cytochrom_C_asm | 7.08 |
| PF12796 | Ank_2 | 4.25 |
| PF00583 | Acetyltransf_1 | 2.36 |
| PF08447 | PAS_3 | 2.36 |
| PF05201 | GlutR_N | 1.89 |
| PF13354 | Beta-lactamase2 | 1.89 |
| PF00990 | GGDEF | 1.89 |
| PF02416 | TatA_B_E | 1.89 |
| PF00282 | Pyridoxal_deC | 1.42 |
| PF05163 | DinB | 1.42 |
| PF07676 | PD40 | 1.42 |
| PF07690 | MFS_1 | 1.42 |
| PF00015 | MCPsignal | 1.42 |
| PF00072 | Response_reg | 0.94 |
| PF13432 | TPR_16 | 0.94 |
| PF00535 | Glycos_transf_2 | 0.94 |
| PF06271 | RDD | 0.94 |
| PF10067 | DUF2306 | 0.94 |
| PF13673 | Acetyltransf_10 | 0.94 |
| PF09286 | Pro-kuma_activ | 0.94 |
| PF08240 | ADH_N | 0.94 |
| PF15902 | Sortilin-Vps10 | 0.94 |
| PF02616 | SMC_ScpA | 0.47 |
| PF01979 | Amidohydro_1 | 0.47 |
| PF04055 | Radical_SAM | 0.47 |
| PF00571 | CBS | 0.47 |
| PF12732 | YtxH | 0.47 |
| PF00578 | AhpC-TSA | 0.47 |
| PF05721 | PhyH | 0.47 |
| PF07681 | DoxX | 0.47 |
| PF07992 | Pyr_redox_2 | 0.47 |
| PF01229 | Glyco_hydro_39 | 0.47 |
| PF00830 | Ribosomal_L28 | 0.47 |
| PF08308 | PEGA | 0.47 |
| PF06537 | DHOR | 0.47 |
| PF06925 | MGDG_synth | 0.47 |
| PF00589 | Phage_integrase | 0.47 |
| PF06347 | SH3_4 | 0.47 |
| PF04794 | YdjC | 0.47 |
| PF00877 | NLPC_P60 | 0.47 |
| PF01554 | MatE | 0.47 |
| PF06146 | PsiE | 0.47 |
| PF00593 | TonB_dep_Rec | 0.47 |
| PF14499 | DUF4437 | 0.47 |
| PF02310 | B12-binding | 0.47 |
| PF02896 | PEP-utilizers_C | 0.47 |
| PF00999 | Na_H_Exchanger | 0.47 |
| PF02746 | MR_MLE_N | 0.47 |
| PF08241 | Methyltransf_11 | 0.47 |
| PF07927 | HicA_toxin | 0.47 |
| PF13946 | DUF4214 | 0.47 |
| PF01464 | SLT | 0.47 |
| PF13419 | HAD_2 | 0.47 |
| PF11954 | DUF3471 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 11.32 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 11.32 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 11.32 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 11.32 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 2.83 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 1.89 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 1.89 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 1.42 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.42 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.94 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0227 | Ribosomal protein L28 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.47 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.47 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.47 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.47 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.47 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.47 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.47 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.47 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.47 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.47 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.23 % |
| Unclassified | root | N/A | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y02IMN5O | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300001593|JGI12635J15846_10897541 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005171|Ga0066677_10593347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 629 | Open in IMG/M |
| 3300005187|Ga0066675_10396383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1018 | Open in IMG/M |
| 3300005290|Ga0065712_10346002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300005340|Ga0070689_100821332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 818 | Open in IMG/M |
| 3300005434|Ga0070709_10003869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8065 | Open in IMG/M |
| 3300005434|Ga0070709_10755473 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005459|Ga0068867_101244980 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005533|Ga0070734_10149450 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005533|Ga0070734_10452954 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005541|Ga0070733_10017723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4446 | Open in IMG/M |
| 3300005554|Ga0066661_10130055 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300005563|Ga0068855_101035963 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005576|Ga0066708_10131337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1521 | Open in IMG/M |
| 3300005587|Ga0066654_10358215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 793 | Open in IMG/M |
| 3300005587|Ga0066654_10492478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 672 | Open in IMG/M |
| 3300005614|Ga0068856_101970068 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005764|Ga0066903_106005940 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005834|Ga0068851_10033834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2548 | Open in IMG/M |
| 3300005994|Ga0066789_10388289 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006028|Ga0070717_10280307 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300006028|Ga0070717_11345915 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006052|Ga0075029_101204575 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006059|Ga0075017_100073780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2334 | Open in IMG/M |
| 3300006162|Ga0075030_100536182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 930 | Open in IMG/M |
| 3300006162|Ga0075030_100902082 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006162|Ga0075030_101059794 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006174|Ga0075014_100652481 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006796|Ga0066665_10595364 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300006806|Ga0079220_10517344 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300006854|Ga0075425_102028874 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300006954|Ga0079219_10708239 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300007788|Ga0099795_10216165 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009088|Ga0099830_11364076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300009088|Ga0099830_11468138 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009090|Ga0099827_10083694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2498 | Open in IMG/M |
| 3300009137|Ga0066709_100719906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1437 | Open in IMG/M |
| 3300009174|Ga0105241_10862644 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009523|Ga0116221_1054280 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300009553|Ga0105249_11297482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300009700|Ga0116217_10495986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300009792|Ga0126374_11276860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300009826|Ga0123355_11308425 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010043|Ga0126380_11686522 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010046|Ga0126384_11331863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300010159|Ga0099796_10293077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300010304|Ga0134088_10441460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300010326|Ga0134065_10300177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300010358|Ga0126370_10051716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2615 | Open in IMG/M |
| 3300010358|Ga0126370_10270926 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300010359|Ga0126376_11988290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300010360|Ga0126372_10143678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1893 | Open in IMG/M |
| 3300010361|Ga0126378_10974885 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300010361|Ga0126378_13090462 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010366|Ga0126379_10269713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1689 | Open in IMG/M |
| 3300010371|Ga0134125_10408889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1505 | Open in IMG/M |
| 3300010376|Ga0126381_103263931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 640 | Open in IMG/M |
| 3300010379|Ga0136449_102108591 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010379|Ga0136449_104562725 | Not Available | 508 | Open in IMG/M |
| 3300010391|Ga0136847_12452713 | Not Available | 1009 | Open in IMG/M |
| 3300010396|Ga0134126_11184505 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300010398|Ga0126383_13622018 | Not Available | 505 | Open in IMG/M |
| 3300011271|Ga0137393_10038997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3652 | Open in IMG/M |
| 3300012096|Ga0137389_10579431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300012096|Ga0137389_10612220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300012189|Ga0137388_10067431 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
| 3300012198|Ga0137364_10198391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1470 | Open in IMG/M |
| 3300012203|Ga0137399_10213754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1570 | Open in IMG/M |
| 3300012203|Ga0137399_10911399 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012209|Ga0137379_10318107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1467 | Open in IMG/M |
| 3300012210|Ga0137378_10143865 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300012210|Ga0137378_10443754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300012211|Ga0137377_10403841 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300012363|Ga0137390_10251046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1755 | Open in IMG/M |
| 3300012363|Ga0137390_11272800 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012582|Ga0137358_10251801 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300012917|Ga0137395_10477856 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012918|Ga0137396_10812975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300012924|Ga0137413_10363844 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300012929|Ga0137404_10812978 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012929|Ga0137404_11118362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli | 723 | Open in IMG/M |
| 3300012944|Ga0137410_11377368 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012955|Ga0164298_10732868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012984|Ga0164309_11348085 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012986|Ga0164304_10453625 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300012987|Ga0164307_10216860 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300012987|Ga0164307_11162673 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300013100|Ga0157373_10446423 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300013296|Ga0157374_10519810 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300013308|Ga0157375_12494611 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300014168|Ga0181534_10659918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300014325|Ga0163163_11366777 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300014325|Ga0163163_13112626 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300014489|Ga0182018_10338444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300014498|Ga0182019_10565920 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300014654|Ga0181525_10129970 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300015371|Ga0132258_10015158 | All Organisms → cellular organisms → Bacteria | 16463 | Open in IMG/M |
| 3300015371|Ga0132258_11763355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300015374|Ga0132255_100013384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9755 | Open in IMG/M |
| 3300016371|Ga0182034_11046415 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300017657|Ga0134074_1051086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300017822|Ga0187802_10104290 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300017924|Ga0187820_1174854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300017933|Ga0187801_10488415 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300017943|Ga0187819_10223664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300017948|Ga0187847_10071855 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300017955|Ga0187817_11124356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300017959|Ga0187779_10064340 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300017970|Ga0187783_10753376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300017973|Ga0187780_10769878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300017994|Ga0187822_10318405 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018001|Ga0187815_10056865 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300018047|Ga0187859_10080391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1716 | Open in IMG/M |
| 3300018058|Ga0187766_11421386 | Not Available | 510 | Open in IMG/M |
| 3300018062|Ga0187784_10041810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3705 | Open in IMG/M |
| 3300018085|Ga0187772_11061664 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300018433|Ga0066667_10004153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6094 | Open in IMG/M |
| 3300018433|Ga0066667_10658184 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018468|Ga0066662_10170945 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300018468|Ga0066662_11670454 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300018468|Ga0066662_12752521 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018482|Ga0066669_10954868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300019877|Ga0193722_1028356 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300019877|Ga0193722_1152112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300019879|Ga0193723_1192511 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021402|Ga0210385_10210653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300021405|Ga0210387_10547506 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300021406|Ga0210386_10846619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300021407|Ga0210383_10517291 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300021420|Ga0210394_10464208 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300021420|Ga0210394_10524881 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300021478|Ga0210402_10035144 | All Organisms → cellular organisms → Bacteria | 4345 | Open in IMG/M |
| 3300021478|Ga0210402_11722918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 553 | Open in IMG/M |
| 3300021560|Ga0126371_10380087 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300021560|Ga0126371_11287750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300022724|Ga0242665_10082216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300025464|Ga0208076_1080273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300025473|Ga0208190_1001490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8099 | Open in IMG/M |
| 3300025903|Ga0207680_10641993 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300025904|Ga0207647_10034400 | All Organisms → cellular organisms → Bacteria | 3235 | Open in IMG/M |
| 3300025906|Ga0207699_11006894 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300025913|Ga0207695_11500200 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025922|Ga0207646_11181318 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300025929|Ga0207664_11108599 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300026035|Ga0207703_10027282 | All Organisms → cellular organisms → Bacteria | 4497 | Open in IMG/M |
| 3300026291|Ga0209890_10235593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300026313|Ga0209761_1334482 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300026335|Ga0209804_1031564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2681 | Open in IMG/M |
| 3300026351|Ga0257170_1034106 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300026540|Ga0209376_1036181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3014 | Open in IMG/M |
| 3300026540|Ga0209376_1175589 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300026548|Ga0209161_10112620 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300026557|Ga0179587_11172744 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027106|Ga0208607_102398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300027512|Ga0209179_1067694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300027545|Ga0209008_1069025 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300027660|Ga0209736_1009781 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300027674|Ga0209118_1016950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2372 | Open in IMG/M |
| 3300027698|Ga0209446_1184643 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027842|Ga0209580_10348141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300027842|Ga0209580_10554983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300027842|Ga0209580_10570296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300027853|Ga0209274_10589682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300027882|Ga0209590_10040990 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300027894|Ga0209068_10055964 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300027895|Ga0209624_10639294 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300027903|Ga0209488_10344813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300027910|Ga0209583_10109625 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300027911|Ga0209698_11215253 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028792|Ga0307504_10235543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300029883|Ga0311327_10647667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-R15 | 630 | Open in IMG/M |
| 3300029945|Ga0311330_10320206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300029952|Ga0311346_10020682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10519 | Open in IMG/M |
| 3300029990|Ga0311336_11396990 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300029999|Ga0311339_10630815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300030043|Ga0302306_10362339 | Not Available | 555 | Open in IMG/M |
| 3300030518|Ga0302275_10225289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300030707|Ga0310038_10093486 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300031057|Ga0170834_104809287 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300031057|Ga0170834_110347950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031247|Ga0265340_10178378 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031261|Ga0302140_10908754 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031521|Ga0311364_11068556 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031708|Ga0310686_113337534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300031715|Ga0307476_10556950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300031716|Ga0310813_10042028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3316 | Open in IMG/M |
| 3300031722|Ga0311351_10239832 | Not Available | 1372 | Open in IMG/M |
| 3300031740|Ga0307468_100825809 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031754|Ga0307475_10225966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300031754|Ga0307475_11085449 | Not Available | 627 | Open in IMG/M |
| 3300031754|Ga0307475_11245504 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031890|Ga0306925_10585811 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031912|Ga0306921_11281752 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031918|Ga0311367_11898669 | Not Available | 577 | Open in IMG/M |
| 3300031941|Ga0310912_10658343 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031942|Ga0310916_10662897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300031996|Ga0308176_12411481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300032018|Ga0315272_10508596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300032174|Ga0307470_11265915 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300032180|Ga0307471_102518236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300032275|Ga0315270_10859236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 598 | Open in IMG/M |
| 3300032783|Ga0335079_10024424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6923 | Open in IMG/M |
| 3300032805|Ga0335078_10419260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
| 3300032828|Ga0335080_10347363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
| 3300032828|Ga0335080_11987460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 563 | Open in IMG/M |
| 3300032829|Ga0335070_10006068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14221 | Open in IMG/M |
| 3300033158|Ga0335077_10209652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2184 | Open in IMG/M |
| 3300033412|Ga0310810_11074187 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300033433|Ga0326726_10114274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2430 | Open in IMG/M |
| 3300033808|Ga0314867_033698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300033977|Ga0314861_0287082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.30% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.30% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.36% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.36% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.47% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.47% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.47% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027106 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF031 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_02865440 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | RDGEEAIASRSATAYRMFDRLARASEYGRVFRPDNGK |
| JGI12635J15846_108975412 | 3300001593 | Forest Soil | TYLANERRGEEAVASISVAAYQMFDRLARASEYGRVISPSNSGPH* |
| Ga0066677_105933472 | 3300005171 | Soil | MTTYLHNEHDGAEAIARISVAAYGMFVRLGKGSEYGRVVSTSNGSNAH* |
| Ga0066675_103963831 | 3300005187 | Soil | HNEHDGADAIARISVAAYSMFERLGKGSEYGRVVSTSNGSNVH* |
| Ga0065712_103460021 | 3300005290 | Miscanthus Rhizosphere | MQNQRDGEEAIARISGVTYRLFDRLARASEYGRVISPNN* |
| Ga0070689_1008213321 | 3300005340 | Switchgrass Rhizosphere | HRERDGEDAISKISAEAYRMFDRLARASEYGRVISPGNSSH* |
| Ga0070709_100038695 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAFLRNERDGEKAIREVALDTWRMFDRLSRATEYGRVVSPGNGTR* |
| Ga0070709_107554732 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FLRNERDGEEAISKVSLEAWRMFDRLSRASEYGRVVSPGNGTR* |
| Ga0068867_1012449801 | 3300005459 | Miscanthus Rhizosphere | NERDGEEAIARISAAAYRMFDRLGRASEYGRVVSPNNSTTH* |
| Ga0070734_101494501 | 3300005533 | Surface Soil | FLRNEREGEVAISKVSLEAWRLFDRLSRATEYGRVVSPGNGTR* |
| Ga0070734_104529541 | 3300005533 | Surface Soil | EEAISKVSLAAWQMFDRLSRATEYGRVVSPGNGSR* |
| Ga0070733_100177237 | 3300005541 | Surface Soil | VMTAFLQNERDGEQAISKVSFAAWRMFDRLARASEYGRVVSPGNGSR* |
| Ga0066661_101300554 | 3300005554 | Soil | ERDGEEAISKIAAAAYRMVDRLARASEYGRVVSPANSSR* |
| Ga0068855_1010359632 | 3300005563 | Corn Rhizosphere | TYLRNERDAEEAIAQISRAAYRMFDRIGRASEYGRVISPANSGK* |
| Ga0066708_101313371 | 3300005576 | Soil | VMTTYLRRERDGEEAISEISLDAYRMFDRLARASEYGRVISPSNSGK* |
| Ga0066654_103582152 | 3300005587 | Soil | VMTSYLHNEPDGAEAIARISVAAYRLFDRLGRASEYGRVVSTSNGSNAH* |
| Ga0066654_104924783 | 3300005587 | Soil | DGEEAISRISLAAYRTFDRLARASEYGRVISPSNSAH* |
| Ga0068856_1019700682 | 3300005614 | Corn Rhizosphere | DGEEAIGNISAAAYRMFDRLARASEYGRVVSPANGK* |
| Ga0066903_1060059401 | 3300005764 | Tropical Forest Soil | KAISDIAALAYAHFDRLGRASPYGRVISPGTSSPEASK* |
| Ga0068851_100338344 | 3300005834 | Corn Rhizosphere | SDGEEAIARVSQAAYRMFDRLARASEYGRVISPGNSTKP* |
| Ga0066789_103882891 | 3300005994 | Soil | AISAISSLAYGIFDRLDRASEYGRVISPSNGAVR* |
| Ga0070717_102803074 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EDAISRISGAAYRMFDRLGRASEYGRVVSPANSSKP* |
| Ga0070717_113459151 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAFLGNERDGEKAISKISFATWRMFDRLSRASEYGRVVSPGNGAR* |
| Ga0075029_1012045752 | 3300006052 | Watersheds | EEAISKVSLEAWRMFDRLSRASEYGRVVSPGNGAR* |
| Ga0075017_1000737804 | 3300006059 | Watersheds | CIMTTYLRNERDGEEAIAQISRAAYRMFDRLGRASEYGRVISPSNSSKP* |
| Ga0075030_1005361823 | 3300006162 | Watersheds | DGEEAISNISLAAWRMFDRIARASEYGRVISPGNSASR* |
| Ga0075030_1009020822 | 3300006162 | Watersheds | PYILCVMATYLRRERDGEEAISRISLEAWRMFDRLARASEYGRVISPGNSSR* |
| Ga0075030_1010597942 | 3300006162 | Watersheds | EAISKVSLAAWRMFDRMSRATEYGRVVSAGNGSR* |
| Ga0075014_1006524812 | 3300006174 | Watersheds | TAFLRNERDGEEAISKVSLEAWRMFDRLSRASEYGRVVSPGNGAR* |
| Ga0066665_105953641 | 3300006796 | Soil | KRPYVICTMTTYLRRERDGEEAIRRISLETYRMFDRLARASEYGRVISPGNSSR* |
| Ga0079220_105173441 | 3300006806 | Agricultural Soil | HERDGEEAISRISAAAYRMFERLARASEYGRVVSPANSH* |
| Ga0075425_1020288741 | 3300006854 | Populus Rhizosphere | RDGEEAISKISLDTYRMFDRLSRASDYGRVISPANSGK* |
| Ga0079219_107082392 | 3300006954 | Agricultural Soil | MTTYLHHEADGEEAIARVSQSAYWMFDRLARASEYGRVISLGNSSK* |
| Ga0099795_102161651 | 3300007788 | Vadose Zone Soil | MTAFLRNEREGAKAISKISLSAFRMFDRLSRASEYGRVISPGNGSR* |
| Ga0099830_113640762 | 3300009088 | Vadose Zone Soil | EQAISKVSFAAWRMFDRLSRASEYGRVVSAGNGSR* |
| Ga0099830_114681382 | 3300009088 | Vadose Zone Soil | MTTYLHRERDGEEAISNISLAAWRMFDRIARASEYGRVISPGNSSR* |
| Ga0099827_100836941 | 3300009090 | Vadose Zone Soil | RPYVICMMTSFLRNERDGEDAISQVSLETWRMFDRLSRATEYGRVVSLGNGAR* |
| Ga0066709_1007199063 | 3300009137 | Grasslands Soil | EREGEEAISKIALAAYRMFDRLGRASEYGRVISPANSSKP* |
| Ga0105241_108626441 | 3300009174 | Corn Rhizosphere | LQNERDGEEAIARISAAAYRMFDRLGRASEYGRVVSPNNSTTH* |
| Ga0116221_10542804 | 3300009523 | Peatlands Soil | LHRERDGEEAISNISLAAWRMFDRIARASEYGRVVSPGNSSR* |
| Ga0105249_112974821 | 3300009553 | Switchgrass Rhizosphere | NEREGEEAIAQISRAAYRMFDRFGRASEYGRVISPANSGK* |
| Ga0116217_104959862 | 3300009700 | Peatlands Soil | AFLGNERDGEQAISKVSLAAWRMFDRLSRASEYGRVVSPGNGVR* |
| Ga0126374_112768601 | 3300009792 | Tropical Forest Soil | CVMTAYLRNERDGEQAISQVSLETWRMFDRLSRATEYGRVVSPGNGTR* |
| Ga0123355_113084252 | 3300009826 | Termite Gut | SERDGEEAITRVSAEAFRMFDRLGRASEYGRVVSVNNSGNPR* |
| Ga0126380_116865221 | 3300010043 | Tropical Forest Soil | YLRRERDGEEAISKISLDAYRVFDRMARASEYGRVISPSNGGK* |
| Ga0126384_113318632 | 3300010046 | Tropical Forest Soil | RRERDGEEAITKISLSAWRMFDRLARASEYGRVISSGNSSK* |
| Ga0099796_102930771 | 3300010159 | Vadose Zone Soil | ERDGEEAISKISLAAWRMFDRLSRATEYGRVVSPGNGSR* |
| Ga0134088_104414601 | 3300010304 | Grasslands Soil | LRRERDGEEAIGKISVAAYRMFDRLARATEYGRVISPGNSSR* |
| Ga0134065_103001772 | 3300010326 | Grasslands Soil | EAISKISVDTFHMFDRLARASEYGRVISPSNSSK* |
| Ga0126370_100517165 | 3300010358 | Tropical Forest Soil | LRRERDGEEAISAVSLSAWRMFDRIARASEYGRVISPANSTR* |
| Ga0126370_102709261 | 3300010358 | Tropical Forest Soil | EAISNISLDAYRMFDRLGRASEYGRIVSASNGSN* |
| Ga0126376_119882901 | 3300010359 | Tropical Forest Soil | YLHNEREGVDAIAKISAAAYSMFDRLGRASEYGRVVSKSNGPNAH* |
| Ga0126372_101436783 | 3300010360 | Tropical Forest Soil | GEQAISQVSLETWRMFDRLSRATEYGRVVSPGNGTR* |
| Ga0126378_109748851 | 3300010361 | Tropical Forest Soil | MTSYLRRERDGEDAISNISLDAYRMFDRLGRASEYGRVVSASNGSN* |
| Ga0126378_130904622 | 3300010361 | Tropical Forest Soil | TYVQRERDAEAAIATIARAAWEMFERLGRSSDYGRVISPGNSSK* |
| Ga0126379_102697134 | 3300010366 | Tropical Forest Soil | EREGEQAISEVSVATYRMFDRLALASEYGRVVSPGNNSKP* |
| Ga0134125_104088893 | 3300010371 | Terrestrial Soil | PDGAEAIARISLAAYRLFDRLGRASEYGRVVSTSNGSNAH* |
| Ga0126381_1032639312 | 3300010376 | Tropical Forest Soil | TTYLRREREGEEAISNVSLAAWRMFDRLARGGEYGRVVSSGTSSH* |
| Ga0136449_1021085911 | 3300010379 | Peatlands Soil | TSFLSNERDGEEAISQISLAAWRMFDRLSRATEYGRVVSPGDGAR* |
| Ga0136449_1045627251 | 3300010379 | Peatlands Soil | EHDGEEAITKVSLEAWRMFDRLSRATEYGRVVSRGNGSR* |
| Ga0136847_124527131 | 3300010391 | Freshwater Sediment | AISRIAGAAYRTFDRLGRASPYGRIISPRSSGSPK* |
| Ga0134126_111845051 | 3300010396 | Terrestrial Soil | EEAIAKISAAAYRMFDRLARASEYGRVVSPGNGK* |
| Ga0126383_136220181 | 3300010398 | Tropical Forest Soil | NEREGEQAISQVSLETWRMFDRLSRATEDGRVVSPGNGTR* |
| Ga0137393_100389971 | 3300011271 | Vadose Zone Soil | LHRERDGEEAISNISLAAWRMFDRLARASEYGRVISPGNSSR* |
| Ga0137389_105794311 | 3300012096 | Vadose Zone Soil | RERDGEEAISNVALAAWRMFDRLARASEYGRVISPGNSSR* |
| Ga0137389_106122201 | 3300012096 | Vadose Zone Soil | MTTYLRRERDGEEAIGKISLETYRMFDRLARASEYGRVISPGNSSR* |
| Ga0137388_100674313 | 3300012189 | Vadose Zone Soil | ERDGEEAIRRISLETHRMFDRLARASEYGRVISPGNSSR* |
| Ga0137364_101983913 | 3300012198 | Vadose Zone Soil | DGAEAIARISVAAYGMFVRLGKGSEYGRVVSTSNGSNAH* |
| Ga0137399_102137541 | 3300012203 | Vadose Zone Soil | LRSERDGEEAIRKVSLATYRMFDRLARASEYGRVVSPGNNSKP* |
| Ga0137399_109113991 | 3300012203 | Vadose Zone Soil | TSERDGEQAISKISVAAWRMFDRLSRASEYGRVVSPGNGSR* |
| Ga0137379_103181071 | 3300012209 | Vadose Zone Soil | YLRRERDGEEAISKISLDAYRMFDRLARASEYGRVISPSNSSK* |
| Ga0137378_101438655 | 3300012210 | Vadose Zone Soil | DGEEAISKISLAAFRMFDRLSRASEYGRVISPGNGSR* |
| Ga0137378_104437542 | 3300012210 | Vadose Zone Soil | VMTSFLRNEREGEEAISKVSLAAWRMFDRLSRASEYGRVVSRGNGTR* |
| Ga0137377_104038411 | 3300012211 | Vadose Zone Soil | EAISKIGLAAYRIFDRIARASEYGRVISPANSAKP* |
| Ga0137390_102510464 | 3300012363 | Vadose Zone Soil | LRNERDGEEAISKISLSAFRMFDRLSRASEYGRVISPGNGSR* |
| Ga0137390_112728001 | 3300012363 | Vadose Zone Soil | LRRERHGEEAISKISLDSYRMFDRLARSSEYGRVVSPSNSSK* |
| Ga0137358_102518011 | 3300012582 | Vadose Zone Soil | YLHRERDGEEAISNISLAAWRMFDRMARASEYGRVSSPGNSSR* |
| Ga0137395_104778563 | 3300012917 | Vadose Zone Soil | VEKRPYVICTMTTYLRRERDGEEAIRRISLETHRMFDRLARASEYGRVISPGNSSR* |
| Ga0137396_108129752 | 3300012918 | Vadose Zone Soil | CVMTAFLRNERDGEEAISKISLDAWRMFDRLSRASEYGRVVSPGNGSR* |
| Ga0137413_103638441 | 3300012924 | Vadose Zone Soil | TNEREGEQAISKVSFTAWRMFDRLSRASEYGRVVSPGNGSR* |
| Ga0137404_108129782 | 3300012929 | Vadose Zone Soil | EDAISKVSLVAWRMFDRIARASEYGREISPGNSSK* |
| Ga0137404_111183621 | 3300012929 | Vadose Zone Soil | LRNERDGEEAIAQISRAAYRMFDRLGRASEYGRVISPANTSK* |
| Ga0137410_113773681 | 3300012944 | Vadose Zone Soil | LRNERSGEEAISKIGLAAYRIFDRIARASEYGRVISPANSAKP* |
| Ga0164298_107328682 | 3300012955 | Soil | MTGYLRNERDGEDAISKVSLATWRMFDRLSRATEYGRVVSPGNGTR* |
| Ga0164309_113480852 | 3300012984 | Soil | YLHRERDGEEAIAKISAAAYRMFDRLARASEYGRVVSPGNGK* |
| Ga0164304_104536253 | 3300012986 | Soil | GEEAIAKISAAAYRMFDRLARASEYGRVVSPGNGK* |
| Ga0164307_102168601 | 3300012987 | Soil | GEEAIGNISAAAYRMFDRLARASEYGRVVSPANGK* |
| Ga0164307_111626732 | 3300012987 | Soil | LRRERDGEEAISKISAAAYSMFDRLARASEYGRVVSPGNSGR* |
| Ga0157373_104464231 | 3300013100 | Corn Rhizosphere | QAGEEAIARISMAAYSMFDRMGRASEYGRVVSKSNGGKAR* |
| Ga0157374_105198101 | 3300013296 | Miscanthus Rhizosphere | LRRESDGEDAISRISLAAYQMFDRIARASEYGRVISPSNSSR* |
| Ga0157375_124946112 | 3300013308 | Miscanthus Rhizosphere | LHRERDGEDAISKISAEAYRMFDRLARASEYGRVISPGNSSH* |
| Ga0181534_106599182 | 3300014168 | Bog | LVNERDGEEAISKVSLATWRMFDRLSRATEYGRVVSRGNGTR* |
| Ga0163163_113667772 | 3300014325 | Switchgrass Rhizosphere | RDGEEAIGNISAAAYRMFDRLARASEYGRVVSPANGK* |
| Ga0163163_131126261 | 3300014325 | Switchgrass Rhizosphere | DGEEAIAKISAAAYRMFDRLARASEYGRVVSPGNGK* |
| Ga0182018_103384441 | 3300014489 | Palsa | TSFLRNEREGEEAISKISLDAWRMFDRFSRASEYGRVISPGNGSR* |
| Ga0182019_105659202 | 3300014498 | Fen | SERAGEEAISAISAASFATFDRLARASEYGRVVSPGNGSRR* |
| Ga0181525_101299701 | 3300014654 | Bog | TAFLRNERDGEQAISKISLDAWRMFDRLSRATEYGRVVSPGNGVR* |
| Ga0132258_100151581 | 3300015371 | Arabidopsis Rhizosphere | RDGEKAISEVSLETWRMFDRLSRATEYGRVVSPGNGTR* |
| Ga0132258_117633551 | 3300015371 | Arabidopsis Rhizosphere | AIARVSQAAYRMFDRLARASEYGRVISPGNSTKP* |
| Ga0132255_1000133841 | 3300015374 | Arabidopsis Rhizosphere | GEEAISKISLAAYRMFDRIARASEYGRVISPANSSKP* |
| Ga0182034_110464151 | 3300016371 | Soil | DRAISDIAAATYRHFDRLGRASEYGRVISTFNSAEEAK |
| Ga0134074_10510863 | 3300017657 | Grasslands Soil | YIICAMTTYLRRERDGEEATRKISLETYRMFDRLARASEYGRVISPGNSSR |
| Ga0187802_101042901 | 3300017822 | Freshwater Sediment | MTAFLNNERDGEEAISKVSLETWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0187820_11748541 | 3300017924 | Freshwater Sediment | ERDGEEAISNISLETWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0187801_104884151 | 3300017933 | Freshwater Sediment | RERDGEEAISSVSLAAWRMFDRLAGASEYGRVISPGNSSR |
| Ga0187819_102236642 | 3300017943 | Freshwater Sediment | MTSFLGYERDGEEAVSRVPLAARRMFDGVSCATEYGRVVAAGNGSR |
| Ga0187847_100718552 | 3300017948 | Peatland | EEAISKVSLAAWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0187817_111243561 | 3300017955 | Freshwater Sediment | EEAITKVSLAAWRLFGRLSRATEYGRVVTPGNGTR |
| Ga0187779_100643403 | 3300017959 | Tropical Peatland | MTAFLHNERDGEEAISKVSFAAWKMFDRLSRASEYGRVVSPGNGTR |
| Ga0187783_107533761 | 3300017970 | Tropical Peatland | EEAISKISLDAWRMFDRLSRASEYGRVISPGNGSR |
| Ga0187780_107698781 | 3300017973 | Tropical Peatland | MCVMTAYLRNERDGEEAISKISLTAWRMFDRLSRATEYGRVVSRGNGTR |
| Ga0187822_103184051 | 3300017994 | Freshwater Sediment | MTTYLQHERDGEQAITNISAEAYRMFDRLARASEYGRTVSPANSH |
| Ga0187815_100568651 | 3300018001 | Freshwater Sediment | GEEAISNVSLAAWRMFDRMARASEYGRVISPGNSSK |
| Ga0187859_100803913 | 3300018047 | Peatland | MTAFLANERDGEQAISKISLAAWRMFDRLSRASEYGRVVSPGNGAR |
| Ga0187766_114213861 | 3300018058 | Tropical Peatland | GEEAITKVSLETWRMFDRLSRATEYGRVVSLGNGTR |
| Ga0187784_100418101 | 3300018062 | Tropical Peatland | RNEREGEEAISKVSLETWRMFDRLSRATEYGRVVSAGNGTR |
| Ga0187772_110616641 | 3300018085 | Tropical Peatland | YLRNEREGEEAISKVSLETWRMFDRLSRATEYGRVVSAGNGTR |
| Ga0066667_100041533 | 3300018433 | Grasslands Soil | MTTYLRRERDGEEAISKISVDAYRMFDRLARASEYGRVISPSNSSK |
| Ga0066667_106581843 | 3300018433 | Grasslands Soil | EAAITKISAEAFSMFDRLGRASEYGRVVSPGNSSKP |
| Ga0066662_101709454 | 3300018468 | Grasslands Soil | RNERGGEQAITKISALAYRMFDRLGRASEYGRVVSPANRSKP |
| Ga0066662_116704541 | 3300018468 | Grasslands Soil | NERAGEEAISKISGAAYRMFDRLARASEYGRVVSPSNSSKP |
| Ga0066662_127525212 | 3300018468 | Grasslands Soil | YLRRERDGEEAIRRISLETYRMFDRLARASEYGRVISPGNSSR |
| Ga0066669_109548681 | 3300018482 | Grasslands Soil | TTYFINYKDGAEEIARISVDAYGMFVRLGKGSEYGRVVSTSNGSNAH |
| Ga0193722_10283564 | 3300019877 | Soil | ERAGEEAISNISLQAWRMFDRMARASEYGRVISPANSSK |
| Ga0193722_11521121 | 3300019877 | Soil | VMTSFLRNERDGEEAISKVSLAAWRMFDRLSRATEYGRVVSPGNGSR |
| Ga0193723_11925111 | 3300019879 | Soil | EEAISRISLAAYRIFDRLARASEYGRVVSPANSTH |
| Ga0210385_102106531 | 3300021402 | Soil | VMTSFLRNEREGEEAISKVSLDAWRMFDRLSRATEFGRVVSAGNGSR |
| Ga0210387_105475062 | 3300021405 | Soil | EQAISKISLAAWRMFDRLSRASEYGRVVSPGNGAR |
| Ga0210386_108466192 | 3300021406 | Soil | LANERDGEQAISKISLAAWRMFDRLSRASEYGRVVSAGNGTR |
| Ga0210383_105172913 | 3300021407 | Soil | CVMTSFLRNEREGEEAISKVSLDAWRMFDRLSRATEFGRVVSAGNGTR |
| Ga0210394_104642083 | 3300021420 | Soil | RNERDGEESISQISLAAYRMFDRLGRASEYGRVISPANSSR |
| Ga0210394_105248811 | 3300021420 | Soil | ERDGEQAISKISLAAWRMFDRLSRASEYGRVVSPGNGAR |
| Ga0210402_100351443 | 3300021478 | Soil | FLRNERDGEEAISKVSLEAWRMFDRLSRATEYGRVVSLGNGAR |
| Ga0210402_117229181 | 3300021478 | Soil | LENERDGEAAISKISLAAWQMFDRLSRATEYGRVVSPGNGAR |
| Ga0126371_103800871 | 3300021560 | Tropical Forest Soil | SYLRRERDGEEAISNISLDAYRMFDRLGRASEYGRVISASNGSN |
| Ga0126371_112877501 | 3300021560 | Tropical Forest Soil | MTTYLHNERDGVDAIAKISLAAYSTFDRLGRASEYGRVVSSSNGPNRH |
| Ga0242665_100822161 | 3300022724 | Soil | KERDGEDTIARISAAAYRMFDRMGRASEYGRVVSPNDTSH |
| Ga0208076_10802731 | 3300025464 | Arctic Peat Soil | MTSFLRNERDGEEAISKVSLESWRMFDRLSRATEYGRVVSPGNGAR |
| Ga0208190_10014908 | 3300025473 | Peatland | RDGEQAISKISLDAWRMFDRLSRASEYGRVVSPGNGSR |
| Ga0207680_106419933 | 3300025903 | Switchgrass Rhizosphere | LHRERDGEEAIAKISSAAYRMFDRLARASEYGRVVSPGNGK |
| Ga0207647_100344002 | 3300025904 | Corn Rhizosphere | MQNQRDGEEAIARISGVTYRLFDRLARASEYGRVISPNN |
| Ga0207699_110068942 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FLRNERDGEEAISKVSLEAWRMFDRLSRASEYGRVVSPGNGTR |
| Ga0207695_115002002 | 3300025913 | Corn Rhizosphere | DGEEAIAQISRAAYRMFDRFGRASEYGRVISPANSGK |
| Ga0207646_111813182 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TYLRRERDGEEAITRISAAAWRMFDRIARASEYGRVISPGNSSR |
| Ga0207664_111085991 | 3300025929 | Agricultural Soil | MTAFLRNERDGEKAIREVALDTWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0207703_100272823 | 3300026035 | Switchgrass Rhizosphere | LQNERDGEEAIARISAAAYRMFDRLGRASEYGRVVSPNNSTTH |
| Ga0209890_102355931 | 3300026291 | Soil | RAGEEAISKVSLEAWRMFDRLSRATEYGRVVSPGNGAR |
| Ga0209761_13344822 | 3300026313 | Grasslands Soil | RDGEEAISKISLTAYRIFDRLARASEFGRVISPGNSSR |
| Ga0209804_10315643 | 3300026335 | Soil | MTTYLRRERDGEEAIRRISLETYRMFDRLARASEYGRVISPGNSSR |
| Ga0257170_10341061 | 3300026351 | Soil | HERDGEQAISRISAAAFSMFDRLARASEYGRVISPGNSSK |
| Ga0209376_10361815 | 3300026540 | Soil | LRRERDGEEAIGKISAAAYRMFDRLARASEYGRVISPGNSSR |
| Ga0209376_11755893 | 3300026540 | Soil | NEREGEEAISKIALAAYRMFDRLGRASEYGRVISPANSSKP |
| Ga0209161_101126201 | 3300026548 | Soil | RERDGEEAIRKISLETYRMFDRLARASEYGRVISPGNSSR |
| Ga0179587_111727442 | 3300026557 | Vadose Zone Soil | TSFLRNERDGEEAISKVSLAAWRMFDRLSRATEYGRVVSSGNGSR |
| Ga0208607_1023981 | 3300027106 | Forest Soil | ANERDGEQAISKISLAAWRMFDRLSRASEYGRVVSPGNGAR |
| Ga0209179_10676941 | 3300027512 | Vadose Zone Soil | NERDGEEAISKISLAAWRMFDRLSRATEYGRVVSPGNGSR |
| Ga0209008_10690251 | 3300027545 | Forest Soil | RDGEQAISKISLAAWRMFDRLSRASEYGRVVSPGNGAR |
| Ga0209736_10097815 | 3300027660 | Forest Soil | YLHRERDGEEAISNISLAAWRMFDRLARASEYGRVISPGNSSR |
| Ga0209118_10169501 | 3300027674 | Forest Soil | NERDGEDAISKISLAAFRMFDRLSRASEYGRVISPGNGSR |
| Ga0209446_11846431 | 3300027698 | Bog Forest Soil | TAFLTNERDGEQAISKISLAAWRMFDRLSRATEYGRVVSPGNGAR |
| Ga0209580_103481413 | 3300027842 | Surface Soil | RSERDGEDAISKVSLATWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0209580_105549832 | 3300027842 | Surface Soil | LRNERDGEEAISKISLEAWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0209580_105702961 | 3300027842 | Surface Soil | CVMTAFLRNERDGEEAITKISLDAWRMFDRLSRASEYGRVVSPGNGVR |
| Ga0209274_105896821 | 3300027853 | Soil | LANERDGEQAISKISLAAWRMFDRLSRASEYGRVVSPGNGAR |
| Ga0209590_100409901 | 3300027882 | Vadose Zone Soil | RPYVICMMTSFLRNERDGEDAISQVSLETWRMFDRLSRATEYGRVVSLGNGAR |
| Ga0209068_100559644 | 3300027894 | Watersheds | TYLRHEPDGEEVIARISAAAYRLFDRLGRASEYGRVISPGNSGR |
| Ga0209624_106392941 | 3300027895 | Forest Soil | SYLRRERDGEDAISRISLDAYQMFDRFGRASEYGRVVSTANGK |
| Ga0209488_103448131 | 3300027903 | Vadose Zone Soil | TTYLRRERDGEDAISKVSLAAWRMFDRIARASEYGRVISPGNSSK |
| Ga0209583_101096253 | 3300027910 | Watersheds | DGEDAISKISLVAYRMFDRLARASEYGRVVSPGNSSR |
| Ga0209698_112152532 | 3300027911 | Watersheds | PYILCVMATYLRRERDGEEAISRISLEAWRMFDRLARASEYGRVISPGNSSR |
| Ga0307504_102355431 | 3300028792 | Soil | REGEEAITKISLETWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0311327_106476671 | 3300029883 | Bog | VMTAFLANERDGEQAISKISLDAWRMFDRLSRASEYGRVVSPGNGSR |
| Ga0311330_103202061 | 3300029945 | Bog | NERRGEQAIASISAAAYQMFDRISRASEYGRILTR |
| Ga0311346_100206821 | 3300029952 | Bog | DGEDAISKISLEAWRMFDRIARASEYGRVISPGNSSR |
| Ga0311336_113969901 | 3300029990 | Fen | RDGEEAISNISLAAWRMFDRMARASEYGRVISPGNSSR |
| Ga0311339_106308151 | 3300029999 | Palsa | TYLRRERDGEEAISDISLAAWRMFDRIARASEYGRVISPGNSSR |
| Ga0302306_103623391 | 3300030043 | Palsa | TYLADERRGEEAIASISLTAYRMFDRLARGSEYGRALSPSITH |
| Ga0302275_102252891 | 3300030518 | Bog | GEQAISKISLDAWRMFDRLSRASEYGRVVSPGNGSR |
| Ga0310038_100934861 | 3300030707 | Peatlands Soil | GEEAISKVSLEAWRMFDRLSRATEYGRVVSRGNGAR |
| Ga0170834_1048092872 | 3300031057 | Forest Soil | TAFLTNEREGEQAISKVSFAAWRMFDRLSRASEYGRVVSPGNGSR |
| Ga0170834_1103479502 | 3300031057 | Forest Soil | GEEAISKVSLSAWRMFDRLGRASEYGRVVSPGNGTR |
| Ga0265340_101783782 | 3300031247 | Rhizosphere | ASERAGEEAISAISAAAFGTFDRLGRASEYGRVVSPGNGSRR |
| Ga0302140_109087542 | 3300031261 | Bog | RERDGEDAISKISLEAWRMFDRIARASEYGRVISPGNSSR |
| Ga0311364_110685561 | 3300031521 | Fen | LLRERAGEEAISKVSLAAWQLFDRVARASEYGRVISPANSSH |
| Ga0310686_1133375342 | 3300031708 | Soil | VFLGNARDGEDAIGKISLAAWRMFDRLSRASEYGRVLSPGNGSR |
| Ga0307476_105569501 | 3300031715 | Hardwood Forest Soil | FLRNERDGEEAISKISLEAWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0310813_100420285 | 3300031716 | Soil | ERDGEDAISKVSLATWRMFDRLSRATEYGRVVSPGNGTR |
| Ga0311351_102398322 | 3300031722 | Fen | TYLRNERAGEEAISAISSAAYAMFDRLASASEYGRIISPSNGSVR |
| Ga0307468_1008258091 | 3300031740 | Hardwood Forest Soil | RDGEEAISRISLAAYRMFDRLARASEYGRVISPANSAR |
| Ga0307475_102259661 | 3300031754 | Hardwood Forest Soil | EEAITKVSLAAFNMFDRLAHASEYGRVVSPGNGAKR |
| Ga0307475_110854491 | 3300031754 | Hardwood Forest Soil | TSSLRNERDGEEAITKVSLETWRMFDRLSRATEYGRVVSPGNGAR |
| Ga0307475_112455041 | 3300031754 | Hardwood Forest Soil | HPERDGEEAISNIALAAWRMFDRLARASEYGRVISPGNSSK |
| Ga0306925_105858111 | 3300031890 | Soil | EEAISKVSLVAYRMFSRLGRASEYGRVVSPANSTTP |
| Ga0306921_112817521 | 3300031912 | Soil | EEAISRVSLEAWRMFDRLSRASEYGRVVSPGNGTR |
| Ga0311367_118986692 | 3300031918 | Fen | LKSERAGEEAISAISAAAFEMFDRLDRASEYGRVISPSNGSAR |
| Ga0310912_106583431 | 3300031941 | Soil | PFILCIMTTYLRDEKAGERAISDIAGAAYRQFDRIGRASEYGRVISTFNSAEEAK |
| Ga0310916_106628971 | 3300031942 | Soil | AYLRNEREGEEAISKVSLDVWRMFDRLSRATEYGRVVSPGNGSR |
| Ga0308176_124114811 | 3300031996 | Soil | EDAISKVSLATWRLFDRLSRATEYGRVVSPGNGTR |
| Ga0315272_105085961 | 3300032018 | Sediment | MTTYLRNERTGEEAISAISSVAYNMFDRLASASEYGRIISPSNGSVR |
| Ga0307470_112659152 | 3300032174 | Hardwood Forest Soil | LTNEREGEQAISRISFAAWTMFDRLSRASEYGRVVSPGNGSR |
| Ga0307471_1025182361 | 3300032180 | Hardwood Forest Soil | ICVMTGFLCNEREGEEAITQVSLETWQMFDRLSRATEYGRVVSPGNGTR |
| Ga0315270_108592361 | 3300032275 | Sediment | NERAGEEAISAISSAAYDMFDRLASASEYGRIISPSNGSVR |
| Ga0335079_100244248 | 3300032783 | Soil | DAISRVSTVAYDMFDRLGRASEYGRVVSAGNGGKP |
| Ga0335078_104192604 | 3300032805 | Soil | RHERDGEDAISSVSLATWRMFDRLGHASDLGRVVSTANSSK |
| Ga0335080_103473632 | 3300032828 | Soil | LRNEREGEEAISKVSLAAWQMFDRLSRATEYGRVVSLGNGAR |
| Ga0335080_119874602 | 3300032828 | Soil | RNERDAEEAIARISLATYRMLDRLGRASAYGRVVSPANSSK |
| Ga0335070_100060681 | 3300032829 | Soil | REGEEAITKVSLETWRMFDRLSRATEYGRVVSPGSGTR |
| Ga0335077_102096521 | 3300033158 | Soil | YLRHERDGERAITQISAAAYRMFDRLGRASEYGRVVSPNDSGAGR |
| Ga0310810_110741871 | 3300033412 | Soil | EEAISRVSGAAYRMFDRLGRASEYGRVVSPANSSKP |
| Ga0326726_101142741 | 3300033433 | Peat Soil | LRHERDGEEAISKISLAAYRMFDRWARASEYGRVISPGNSSK |
| Ga0314867_033698_1_111 | 3300033808 | Peatland | GEEAISKVSFAAWKMFDRLSRASEYGRVVSPGNGTR |
| Ga0314861_0287082_619_744 | 3300033977 | Peatland | RNERDGEEAISKVSLEAWRMFDRLSRATEYGRVVSIGNGTR |
| ⦗Top⦘ |