


| Basic Information | |
|---|---|
| Family ID | F022892 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FANNIGVVSTILPPNIVAIQLKILIPVGTAIIIVAAVK |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.97 % |
| % of genes near scaffold ends (potentially truncated) | 64.62 % |
| % of genes from short scaffolds (< 2000 bps) | 81.60 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.906 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (19.811 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.377 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (46.698 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF00115 | COX1 | 46.23 |
| PF03161 | LAGLIDADG_2 | 3.30 |
| PF00961 | LAGLIDADG_1 | 2.83 |
| PF01348 | Intron_maturas2 | 1.89 |
| PF00116 | COX2 | 1.89 |
| PF00033 | Cytochrome_B | 0.94 |
| PF00499 | Oxidored_q3 | 0.94 |
| PF00507 | Oxidored_q4 | 0.94 |
| PF00361 | Proton_antipo_M | 0.94 |
| PF02326 | YMF19 | 0.47 |
| PF00078 | RVT_1 | 0.47 |
| PF00137 | ATP-synt_C | 0.47 |
| PF07460 | NUMOD3 | 0.47 |
| PF07453 | NUMOD1 | 0.47 |
| PF04442 | CtaG_Cox11 | 0.47 |
| PF08338 | DUF1731 | 0.47 |
| PF00510 | COX3 | 0.47 |
| PF02790 | COX2_TM | 0.47 |
| PF00884 | Sulfatase | 0.47 |
| PF01844 | HNH | 0.47 |
| PF06776 | IalB | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 2.36 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 1.89 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.94 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.94 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.94 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.47 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.47 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.47 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.47 |
| COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG5342 | Invasion protein IalB, involved in pathogenesis | General function prediction only [R] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.91 % |
| All Organisms | root | All Organisms | 40.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000451|MB_CA_OM1_O3DRAFT_10006 | All Organisms → cellular organisms → Eukaryota | 4614 | Open in IMG/M |
| 3300000904|JGI12053J12875_100036 | All Organisms → cellular organisms → Eukaryota | 5700 | Open in IMG/M |
| 3300001867|JGI12627J18819_10002683 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 6514 | Open in IMG/M |
| 3300004799|Ga0058863_10142892 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005327|Ga0070658_11879843 | All Organisms → cellular organisms → Eukaryota | 517 | Open in IMG/M |
| 3300005988|Ga0075160_10494880 | All Organisms → cellular organisms → Eukaryota | 659 | Open in IMG/M |
| 3300006397|Ga0075488_1022045 | All Organisms → cellular organisms → Eukaryota | 3345 | Open in IMG/M |
| 3300006417|Ga0069787_10118867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 2645 | Open in IMG/M |
| 3300006645|Ga0099769_1081488 | Not Available | 1029 | Open in IMG/M |
| 3300007217|Ga0079268_1284610 | All Organisms → cellular organisms → Eukaryota | 510 | Open in IMG/M |
| 3300007228|Ga0075175_1432324 | Not Available | 608 | Open in IMG/M |
| 3300007230|Ga0075179_1585263 | Not Available | 643 | Open in IMG/M |
| 3300007232|Ga0075183_10020259 | All Organisms → cellular organisms → Eukaryota | 510 | Open in IMG/M |
| 3300007232|Ga0075183_11493553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2266 | Open in IMG/M |
| 3300007235|Ga0075184_10114039 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 957 | Open in IMG/M |
| 3300007239|Ga0075171_1038316 | Not Available | 678 | Open in IMG/M |
| 3300007240|Ga0075176_1687917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300007244|Ga0075167_10075275 | Not Available | 3127 | Open in IMG/M |
| 3300007329|Ga0079240_1329456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300007333|Ga0079270_1386793 | Not Available | 531 | Open in IMG/M |
| 3300007336|Ga0079245_1291684 | Not Available | 1018 | Open in IMG/M |
| 3300007337|Ga0079244_1237396 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Lampyrinae → Lamprigera → Lamprigera yunnana | 668 | Open in IMG/M |
| 3300007341|Ga0079228_1324844 | Not Available | 1402 | Open in IMG/M |
| 3300007342|Ga0079227_1303746 | Not Available | 609 | Open in IMG/M |
| 3300007628|Ga0102937_1283446 | Not Available | 653 | Open in IMG/M |
| 3300007863|Ga0105744_1158099 | Not Available | 566 | Open in IMG/M |
| 3300008013|Ga0099809_11083201 | Not Available | 566 | Open in IMG/M |
| 3300008114|Ga0114347_1096774 | All Organisms → cellular organisms → Eukaryota | 1150 | Open in IMG/M |
| 3300008509|Ga0110930_1131147 | Not Available | 544 | Open in IMG/M |
| 3300008724|Ga0103785_104880 | Not Available | 617 | Open in IMG/M |
| 3300008790|Ga0103695_100624 | Not Available | 655 | Open in IMG/M |
| 3300008915|Ga0103480_102533 | Not Available | 654 | Open in IMG/M |
| 3300008921|Ga0103486_1009127 | All Organisms → cellular organisms → Eukaryota | 645 | Open in IMG/M |
| 3300008929|Ga0103732_1003020 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1846 | Open in IMG/M |
| 3300009073|Ga0114957_1013721 | Not Available | 5385 | Open in IMG/M |
| 3300009077|Ga0115552_1172342 | Not Available | 898 | Open in IMG/M |
| 3300009112|Ga0115923_10241355 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Adephaga → Caraboidea → Carabidae → Trechinae → Trechini → Paraphaenops | 1022 | Open in IMG/M |
| 3300009136|Ga0118735_10186602 | Not Available | 675 | Open in IMG/M |
| 3300009142|Ga0102885_1012980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1923 | Open in IMG/M |
| 3300009214|Ga0103830_1014154 | Not Available | 688 | Open in IMG/M |
| 3300009221|Ga0103849_1070731 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → PX clade → Xanthophyceae → Tribonematales → Tribonemataceae → Tribonema → Tribonema minus | 509 | Open in IMG/M |
| 3300009243|Ga0103860_10029860 | Not Available | 1021 | Open in IMG/M |
| 3300009247|Ga0103861_10003928 | Not Available | 1677 | Open in IMG/M |
| 3300009390|Ga0103831_1007957 | All Organisms → cellular organisms → Eukaryota | 798 | Open in IMG/M |
| 3300009415|Ga0115029_1000763 | Not Available | 28284 | Open in IMG/M |
| 3300009423|Ga0115548_1166196 | Not Available | 691 | Open in IMG/M |
| 3300009432|Ga0115005_10835697 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Adephaga → Caraboidea → Carabidae → Trechinae → Trechini → Paraphaenops | 742 | Open in IMG/M |
| 3300009435|Ga0115546_1287626 | Not Available | 561 | Open in IMG/M |
| 3300009469|Ga0127401_1003999 | All Organisms → cellular organisms → Eukaryota | 4209 | Open in IMG/M |
| 3300009511|Ga0129277_1004248 | All Organisms → cellular organisms → Eukaryota | 1081 | Open in IMG/M |
| 3300009543|Ga0115099_10108897 | Not Available | 1867 | Open in IMG/M |
| 3300009543|Ga0115099_10119752 | All Organisms → cellular organisms → Eukaryota | 1123 | Open in IMG/M |
| 3300009543|Ga0115099_10152557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 518 | Open in IMG/M |
| 3300009543|Ga0115099_10175183 | Not Available | 631 | Open in IMG/M |
| 3300009543|Ga0115099_10186775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1614 | Open in IMG/M |
| 3300009543|Ga0115099_10224311 | All Organisms → cellular organisms → Eukaryota | 2444 | Open in IMG/M |
| 3300009543|Ga0115099_10273249 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1225 | Open in IMG/M |
| 3300009543|Ga0115099_10337285 | Not Available | 2606 | Open in IMG/M |
| 3300009543|Ga0115099_10562218 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Adephaga → Caraboidea → Carabidae → Trechinae → Trechini → Paraphaenops | 2415 | Open in IMG/M |
| 3300009543|Ga0115099_10570194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 1687 | Open in IMG/M |
| 3300009543|Ga0115099_10608395 | All Organisms → cellular organisms → Eukaryota | 1047 | Open in IMG/M |
| 3300009550|Ga0115013_10001420 | Not Available | 13899 | Open in IMG/M |
| 3300009553|Ga0105249_10580068 | Not Available | 1174 | Open in IMG/M |
| 3300009586|Ga0115591_1176459 | Not Available | 651 | Open in IMG/M |
| 3300009592|Ga0115101_1109167 | Not Available | 514 | Open in IMG/M |
| 3300009592|Ga0115101_1274724 | Not Available | 664 | Open in IMG/M |
| 3300009592|Ga0115101_1357472 | Not Available | 1878 | Open in IMG/M |
| 3300009592|Ga0115101_1438993 | All Organisms → cellular organisms → Eukaryota | 758 | Open in IMG/M |
| 3300009593|Ga0115011_10977928 | All Organisms → cellular organisms → Eukaryota | 715 | Open in IMG/M |
| 3300009606|Ga0115102_10676651 | Not Available | 1078 | Open in IMG/M |
| 3300009608|Ga0115100_10256669 | Not Available | 1202 | Open in IMG/M |
| 3300009608|Ga0115100_10271939 | All Organisms → cellular organisms → Eukaryota | 4378 | Open in IMG/M |
| 3300009608|Ga0115100_10456852 | All Organisms → cellular organisms → Eukaryota | 1788 | Open in IMG/M |
| 3300009608|Ga0115100_11204881 | All Organisms → cellular organisms → Eukaryota | 734 | Open in IMG/M |
| 3300009677|Ga0115104_10060860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Occidentia → Occidentia massiliensis | 1170 | Open in IMG/M |
| 3300009677|Ga0115104_10101109 | Not Available | 3549 | Open in IMG/M |
| 3300009677|Ga0115104_10280056 | Not Available | 544 | Open in IMG/M |
| 3300009677|Ga0115104_10342418 | Not Available | 1659 | Open in IMG/M |
| 3300009677|Ga0115104_10412349 | Not Available | 511 | Open in IMG/M |
| 3300009677|Ga0115104_10594895 | Not Available | 1501 | Open in IMG/M |
| 3300009677|Ga0115104_10735766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Occidentia → Occidentia massiliensis | 839 | Open in IMG/M |
| 3300009677|Ga0115104_10858878 | Not Available | 552 | Open in IMG/M |
| 3300009677|Ga0115104_10905376 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1953 | Open in IMG/M |
| 3300009677|Ga0115104_11004722 | Not Available | 1710 | Open in IMG/M |
| 3300009677|Ga0115104_11017315 | All Organisms → cellular organisms → Eukaryota | 1126 | Open in IMG/M |
| 3300009677|Ga0115104_11029370 | Not Available | 538 | Open in IMG/M |
| 3300009677|Ga0115104_11112799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300009679|Ga0115105_10118762 | Not Available | 739 | Open in IMG/M |
| 3300009679|Ga0115105_10208082 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1300 | Open in IMG/M |
| 3300009679|Ga0115105_10695894 | Not Available | 1738 | Open in IMG/M |
| 3300009679|Ga0115105_11402540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 1300 | Open in IMG/M |
| 3300009679|Ga0115105_11407625 | Not Available | 1113 | Open in IMG/M |
| 3300009709|Ga0116227_10053481 | Not Available | 3652 | Open in IMG/M |
| 3300009709|Ga0116227_10464070 | All Organisms → cellular organisms → Eukaryota | 963 | Open in IMG/M |
| 3300009730|Ga0123359_121126 | Not Available | 563 | Open in IMG/M |
| 3300009735|Ga0123377_1051865 | Not Available | 534 | Open in IMG/M |
| 3300009735|Ga0123377_1077495 | Not Available | 873 | Open in IMG/M |
| 3300009750|Ga0123368_1005534 | All Organisms → cellular organisms → Eukaryota | 1178 | Open in IMG/M |
| 3300009785|Ga0115001_10632460 | Not Available | 652 | Open in IMG/M |
| 3300009845|Ga0132158_107086 | Not Available | 699 | Open in IMG/M |
| 3300009931|Ga0131746_149130 | Not Available | 594 | Open in IMG/M |
| 3300010152|Ga0126318_10540447 | Not Available | 638 | Open in IMG/M |
| 3300010334|Ga0136644_10568882 | All Organisms → cellular organisms → Eukaryota | 626 | Open in IMG/M |
| 3300010371|Ga0134125_10001267 | All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Cercozoa → Cercomonadida → Cercomonadidae → Paracercomonas → Paracercomonas marina | 31189 | Open in IMG/M |
| 3300010373|Ga0134128_12966699 | Not Available | 522 | Open in IMG/M |
| 3300010384|Ga0136217_1049981 | Not Available | 574 | Open in IMG/M |
| 3300010395|Ga0058701_10359672 | Not Available | 868 | Open in IMG/M |
| 3300010401|Ga0134121_10366278 | Not Available | 1293 | Open in IMG/M |
| 3300010869|Ga0126359_1731723 | All Organisms → cellular organisms → Eukaryota | 1151 | Open in IMG/M |
| 3300010870|Ga0102750_10537622 | All Organisms → cellular organisms → Eukaryota | 513 | Open in IMG/M |
| 3300011058|Ga0138541_1031801 | Not Available | 617 | Open in IMG/M |
| 3300011120|Ga0150983_13547669 | All Organisms → cellular organisms → Eukaryota | 507 | Open in IMG/M |
| 3300011120|Ga0150983_14934560 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1486 | Open in IMG/M |
| 3300011254|Ga0151675_1041492 | Not Available | 840 | Open in IMG/M |
| 3300011306|Ga0138371_1113493 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 831 | Open in IMG/M |
| 3300011325|Ga0138365_1135397 | Not Available | 528 | Open in IMG/M |
| 3300011326|Ga0138403_1062130 | Not Available | 611 | Open in IMG/M |
| 3300011330|Ga0138383_1233027 | Not Available | 508 | Open in IMG/M |
| 3300011330|Ga0138383_1242960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Occidentia → Occidentia massiliensis | 693 | Open in IMG/M |
| 3300011330|Ga0138383_1272252 | Not Available | 519 | Open in IMG/M |
| 3300011331|Ga0138384_1065187 | All Organisms → cellular organisms → Eukaryota | 565 | Open in IMG/M |
| 3300011331|Ga0138384_1116981 | All Organisms → cellular organisms → Eukaryota | 886 | Open in IMG/M |
| 3300011381|Ga0102688_1073045 | Not Available | 4965 | Open in IMG/M |
| 3300011994|Ga0120157_1003031 | Not Available | 5515 | Open in IMG/M |
| 3300012212|Ga0150985_104161957 | Not Available | 1918 | Open in IMG/M |
| 3300012212|Ga0150985_106885756 | Not Available | 2251 | Open in IMG/M |
| 3300012212|Ga0150985_110459243 | Not Available | 644 | Open in IMG/M |
| 3300012212|Ga0150985_120219626 | Not Available | 739 | Open in IMG/M |
| 3300012212|Ga0150985_121131743 | Not Available | 509 | Open in IMG/M |
| 3300012385|Ga0134023_1159288 | Not Available | 654 | Open in IMG/M |
| 3300012404|Ga0134024_1234672 | Not Available | 517 | Open in IMG/M |
| 3300012415|Ga0138263_1273010 | Not Available | 1077 | Open in IMG/M |
| 3300012469|Ga0150984_105959328 | Not Available | 512 | Open in IMG/M |
| 3300012469|Ga0150984_110830223 | Not Available | 900 | Open in IMG/M |
| 3300012518|Ga0129349_1351900 | Not Available | 2259 | Open in IMG/M |
| 3300012694|Ga0157559_1040771 | Not Available | 752 | Open in IMG/M |
| 3300012710|Ga0157550_1068378 | Not Available | 1078 | Open in IMG/M |
| 3300012714|Ga0157601_1067264 | Not Available | 596 | Open in IMG/M |
| 3300012718|Ga0157557_1176484 | Not Available | 1154 | Open in IMG/M |
| 3300012768|Ga0138276_1077813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2664 | Open in IMG/M |
| 3300012771|Ga0138270_1026762 | Not Available | 973 | Open in IMG/M |
| 3300012772|Ga0138287_1212675 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300012776|Ga0138275_1169249 | All Organisms → cellular organisms → Eukaryota | 835 | Open in IMG/M |
| 3300012776|Ga0138275_1321495 | Not Available | 759 | Open in IMG/M |
| 3300012920|Ga0160423_10675826 | All Organisms → cellular organisms → Eukaryota | 697 | Open in IMG/M |
| 3300012936|Ga0163109_11406116 | Not Available | 508 | Open in IMG/M |
| 3300012954|Ga0163111_11905481 | All Organisms → cellular organisms → Eukaryota | 597 | Open in IMG/M |
| 3300012959|Ga0157620_1085389 | All Organisms → cellular organisms → Eukaryota | 1974 | Open in IMG/M |
| 3300012965|Ga0129346_1095636 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300012966|Ga0129341_1029770 | Not Available | 599 | Open in IMG/M |
| 3300012966|Ga0129341_1195969 | Not Available | 919 | Open in IMG/M |
| 3300012969|Ga0129332_1145573 | Not Available | 525 | Open in IMG/M |
| 3300013074|Ga0157618_1052440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Paracaedibacter → Candidatus Paracaedibacter symbiosus | 751 | Open in IMG/M |
| 3300013295|Ga0170791_12150378 | Not Available | 544 | Open in IMG/M |
| 3300013295|Ga0170791_12501482 | Not Available | 1114 | Open in IMG/M |
| 3300013295|Ga0170791_13291128 | Not Available | 687 | Open in IMG/M |
| 3300013295|Ga0170791_13351062 | Not Available | 1701 | Open in IMG/M |
| 3300013295|Ga0170791_15156958 | Not Available | 1312 | Open in IMG/M |
| 3300013295|Ga0170791_15971298 | Not Available | 608 | Open in IMG/M |
| 3300013372|Ga0177922_10462743 | Not Available | 518 | Open in IMG/M |
| 3300014325|Ga0163163_13117323 | Not Available | 517 | Open in IMG/M |
| 3300015360|Ga0163144_10868005 | Not Available | 893 | Open in IMG/M |
| 3300015374|Ga0132255_103590500 | Not Available | 660 | Open in IMG/M |
| 3300016357|Ga0182032_10452018 | Not Available | 1048 | Open in IMG/M |
| 3300018758|Ga0193058_1068376 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 563 | Open in IMG/M |
| 3300019263|Ga0184647_1228096 | Not Available | 718 | Open in IMG/M |
| 3300019280|Ga0182068_1466031 | Not Available | 660 | Open in IMG/M |
| 3300020070|Ga0206356_11160419 | All Organisms → cellular organisms → Eukaryota | 987 | Open in IMG/M |
| 3300020075|Ga0206349_1656966 | Not Available | 1871 | Open in IMG/M |
| 3300020077|Ga0206351_10084236 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 555 | Open in IMG/M |
| 3300020077|Ga0206351_10451959 | All Organisms → cellular organisms → Eukaryota | 647 | Open in IMG/M |
| 3300020078|Ga0206352_10598389 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1599 | Open in IMG/M |
| 3300020317|Ga0211688_1047058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300022466|Ga0213504_100121 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Ustilaginomycotina → Ustilaginomycetes → Ustilaginales → Ustilaginaceae → Ustilago → Ustilago bromivora | 2449 | Open in IMG/M |
| 3300022530|Ga0242658_1057813 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 839 | Open in IMG/M |
| 3300024573|Ga0256337_1077143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300026434|Ga0247591_1032953 | Not Available | 983 | Open in IMG/M |
| 3300026434|Ga0247591_1106949 | Not Available | 514 | Open in IMG/M |
| 3300026468|Ga0247603_1117318 | All Organisms → cellular organisms → Eukaryota | 549 | Open in IMG/M |
| 3300026495|Ga0247571_1116991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300027005|Ga0256887_1060351 | Not Available | 742 | Open in IMG/M |
| 3300027008|Ga0256891_1023972 | Not Available | 1151 | Open in IMG/M |
| 3300027176|Ga0208992_1000002 | Not Available | 59008 | Open in IMG/M |
| 3300027496|Ga0208987_1050034 | Not Available | 750 | Open in IMG/M |
| 3300027687|Ga0209710_1255559 | Not Available | 564 | Open in IMG/M |
| 3300027711|Ga0209075_1040217 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2500 | Open in IMG/M |
| 3300028394|Ga0304730_1141343 | Not Available | 980 | Open in IMG/M |
| 3300028765|Ga0302198_10453529 | Not Available | 579 | Open in IMG/M |
| 3300028873|Ga0302197_10226063 | Not Available | 864 | Open in IMG/M |
| 3300030904|Ga0308198_1009523 | All Organisms → cellular organisms → Eukaryota | 1147 | Open in IMG/M |
| 3300031058|Ga0308189_10021810 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1517 | Open in IMG/M |
| 3300031094|Ga0308199_1103430 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Botryosphaeriales → Aplosporellaceae → Aplosporella → Aplosporella prunicola → Aplosporella prunicola CBS 121167 | 630 | Open in IMG/M |
| 3300031421|Ga0308194_10339907 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 531 | Open in IMG/M |
| 3300031424|Ga0308179_1000049 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 4073 | Open in IMG/M |
| 3300031688|Ga0308011_10192038 | Not Available | 616 | Open in IMG/M |
| 3300033533|Ga0314770_1139316 | Not Available | 761 | Open in IMG/M |
| 3300034022|Ga0335005_0023025 | Not Available | 4352 | Open in IMG/M |
| 3300034167|Ga0335017_0557162 | All Organisms → cellular organisms → Eukaryota | 599 | Open in IMG/M |
| 3300034668|Ga0314793_010156 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Omphalotaceae → Lentinula → Lentinula edodes | 1310 | Open in IMG/M |
| 3300034677|Ga0314802_007410 | Not Available | 948 | Open in IMG/M |
| 3300034680|Ga0370541_002822 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1428 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 19.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.32% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 4.25% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.30% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.89% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.42% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Marine | Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine | 0.94% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.94% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.94% |
| Bay Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water | 0.94% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.47% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.47% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.47% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.47% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.47% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.47% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.47% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.47% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.47% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.47% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.47% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.47% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.47% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.47% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.47% |
| Marine | Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.47% |
| Coral | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral | 0.47% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.47% |
| Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.47% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.47% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.47% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.47% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.47% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Microbial Mats | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000451 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 | Environmental | Open in IMG/M |
| 3300000904 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
| 3300006645 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_3 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007217 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S10 NT17 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007228 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007230 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007232 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007235 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 D RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007239 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007240 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007244 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007329 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007333 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007336 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007337 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007341 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007342 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007628 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D1_MG | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300008013 | Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R C metatranscriptome (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008509 | Freshwater microbial communities from catchments in Singapore - Site BB | Environmental | Open in IMG/M |
| 3300008724 | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_mRNA | Environmental | Open in IMG/M |
| 3300008790 | Microbial communities from seawater in eastern North Pacific Ocean - P8 free-living | Environmental | Open in IMG/M |
| 3300008915 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KA1 | Environmental | Open in IMG/M |
| 3300008921 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB1 | Environmental | Open in IMG/M |
| 3300008929 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A | Environmental | Open in IMG/M |
| 3300009073 | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG | Host-Associated | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009112 | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 | Engineered | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
| 3300009214 | Microbial communities of water from the North Atlantic ocean - ACM51 | Environmental | Open in IMG/M |
| 3300009221 | Microbial communities of water from Amazon river, Brazil - RCM2 | Environmental | Open in IMG/M |
| 3300009228 | Microbial communities of water from Amazon river, Brazil - RCM7 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009390 | Microbial communities of water from the North Atlantic ocean - ACM34 | Environmental | Open in IMG/M |
| 3300009415 | Marine algal microbial communities from Sidmouth, United Kingdom - Sidmouth_Asex1 metaG | Host-Associated | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009511 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009730 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009735 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009750 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009845 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, 3m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009931 | Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7 | Host-Associated | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010384 | Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 2 | Engineered | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010870 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011306 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011325 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011326 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011330 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011331 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012470 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012694 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES054 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012718 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012771 | Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300012959 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012965 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018758 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019280 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300022466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026434 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026468 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027005 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0495-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027008 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0514-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027176 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027711 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MB_CA_OM1_O3DRAFT_100061 | 3300000451 | Forest Soil | MKPKVNNIGVLILTDPPQAVANQEKILIAVGTAMIIVALVK* |
| JGI12053J12875_1000361 | 3300000904 | Forest Soil | MKPKVNNIGVLILTEPPQAVANQEKILIAVGTAMIIVALVK* |
| JGI12627J18819_100026835 | 3300001867 | Forest Soil | MXPKVNNIGVLILTDPPQAVANQEKILIAVGTAMIIVALVK* |
| Ga0058863_101428923 | 3300004799 | Host-Associated | SIGVVNRRLPPKRVANQEKILIPVGTAIIIVAAVKYALVSTK* |
| Ga0070658_118798432 | 3300005327 | Corn Rhizosphere | NNKGVVNRMLPPKRVANQEKILIPVGTAIIIVAAVKYARV* |
| Ga0075160_104948801 | 3300005988 | Wastewater Effluent | NKNTKPIAKSIGVFKTIEPPHKVANQEKILIPVGTAIIIVAAVK* |
| Ga0075488_10220451 | 3300006397 | Aqueous | VFVTVVPPHIVASQEKILIAVGTAIIIVAAVKYIFV* |
| Ga0069787_101188675 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MKPTAHSIGVLNSMEPPHMVAIHEKILMPVGTAIIIVAAVK* |
| Ga0099769_10814881 | 3300006645 | Activated Sludge | ANNIGVLYRILPPYIVANQLNIFIPVGTAIIIVAAVK* |
| Ga0079268_12846103 | 3300007217 | Marine | MNPIVNNIGVLKVILPPHKVAIQLKILIPVGTAIIIVAAVK* |
| Ga0075175_14323243 | 3300007228 | Wastewater Effluent | IKKPKTKNNGVLKCKKPPHNVASQLKILIPVGTAIIIVAAVK* |
| Ga0075179_15852634 | 3300007230 | Wastewater Effluent | MAKYIGTVKSTIPPAIVANQLNTFIPVGTAIIIVAAVK* |
| Ga0075183_100202593 | 3300007232 | Wastewater Effluent | KNPTTQYIGVRILIVPPHIVANQLNIFIPVGTAIIIVAAVK* |
| Ga0075183_114935532 | 3300007232 | Wastewater Effluent | VNKNKNPIANNIGIDKFIIPPAIVVNHEKILIPVGTAIIIVAAVK* |
| Ga0075184_101140394 | 3300007235 | Wastewater Effluent | KNPTTQYIGVRILIVPPHIVANQLKIFIPVGTAMIIVAAVK* |
| Ga0075171_10383162 | 3300007239 | Wastewater Effluent | ANNIGVFKTIEPPHKVANQENIFIPVGTAIIIVAAVK* |
| Ga0075176_16879171 | 3300007240 | Wastewater Effluent | VNKNKKPIAQYIGDFKFKLPPYNVANQLKILIPVGTAIIIVAAVK* |
| Ga0075167_100752757 | 3300007244 | Wastewater Effluent | MVNNTKKPKTNNIGVRNFKEPPNKVANHEKIFIPVGTAIIIVAAVK* |
| Ga0079240_13294562 | 3300007329 | Marine | MNPFAKSIGVFRTILPPNMVAIQENILIPVGTAITIVAAEK* |
| Ga0079270_13867932 | 3300007333 | Marine | IGVFKTIEPPNIVAIQLKILIPVGTAITIVALVK* |
| Ga0079245_12916842 | 3300007336 | Marine | MANNIGVFKLIEPPHIVAIQLKILIPVGTAIIMVAAVK* |
| Ga0079244_12373961 | 3300007337 | Marine | MNPKVNNIGASKRIEPCHNVAIHEKILIPVGTAIIIVAAVK* |
| Ga0079228_13248442 | 3300007341 | Marine | MNPIANNIGVSKLNEPPHIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0079227_13037461 | 3300007342 | Marine | MKPLANSIGVVNTMLPPNIVAIQLNILIPVGTAMIIVAA |
| Ga0102937_12834463 | 3300007628 | Pond Soil | FANNIGVVIIIFPPNIVAIQLKIFTPVGIAITIVAAAK* |
| Ga0105744_11580991 | 3300007863 | Estuary Water | MGVLNEIDPPHIVAIHENIFIPVGTAIIIVAAKKYA |
| Ga0099809_110832011 | 3300008013 | Coral | VAKKKGVLQTIIPPYIVAIQLKIFTPVGTAIIMVLAVK* |
| Ga0114347_10967741 | 3300008114 | Freshwater, Plankton | IANNIGVVISIKPPAIVVNQLKILIPVGTAIIIVLK* |
| Ga0110930_11311471 | 3300008509 | Freshwater | KVNKIINPIANNIGVFIVINPPYNVAIQLKILIPVGTAIIIVAAVK* |
| Ga0103785_1048802 | 3300008724 | Microbial Mats | VNKKIKPKANNIGVLNVKEPSHIVAIQLNILIPVGTAIIIVAAVK* |
| Ga0103695_1006241 | 3300008790 | Ocean Water | PLAKSIGVFKTILPPNIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0103480_1025331 | 3300008915 | Bay Water | MNPLAKSIGVFKTIDPPNIVAIQLKILIPVGTAITIV |
| Ga0103486_10091271 | 3300008921 | Bay Water | KINPLANNIGVFITIEPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0103732_10030202 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | MKPIAHNIGVANLIEPPYIVPNQLKILIPVGTAIIIVAAVK* |
| Ga0114957_10137219 | 3300009073 | Marine | VNNIGVLIFIKPPHIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0115552_11723421 | 3300009077 | Pelagic Marine | MNPKAHNIGVSNLIEPPYIVPNQLKILIPVGTAIIIV |
| Ga0115923_102413553 | 3300009112 | Swimming Pool Sandfilter Backwash | MVNKIIKPIVNNVAVSIKIFPPKKVANQLKILIPVGTAIIIVAEVK* |
| Ga0118735_101866021 | 3300009136 | Marine Sediment | MNKNKKPIANNIGVRNSILPPHIVAIQLKILIPVGTAIIIVAAVKYA |
| Ga0102885_10129802 | 3300009142 | Estuarine | MGVLNEIDPPHIVAIHENILIPVGTAIIIVAAKKYA* |
| Ga0103830_10141541 | 3300009214 | River Water | MKPFAHSIGVVITILPPNIVAIQLKILIPVGTAMII |
| Ga0103849_10707313 | 3300009221 | River Water | MKPMAHNIGVVYSKLPPYIDASQLNILIPVGTAIIIVAAVKYALVS |
| Ga0103854_10186931 | 3300009228 | River Water | VNKKINPIAHNIGVLYRKLPPYIVPNQLKILIPVGTPI |
| Ga0103860_100298601 | 3300009243 | River Water | MNPKAHNIGVSNLIDPPYIVPNQLKIFIPVGTAIIIVAAVK* |
| Ga0103861_100039283 | 3300009247 | River Water | VNKNINPTAHNIGVSNLIDPPYIVPNQLKIFIPVGTA |
| Ga0103831_10079571 | 3300009390 | River Water | PLAKSIGVFITILPPNIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0115029_100076316 | 3300009415 | Marine | MEGVINIEPPYEVANQLNILIPVGTAIIKVAAVK* |
| Ga0115548_11661962 | 3300009423 | Pelagic Marine | MKPFANNIGTVNTISPPNIVAIQLNILIPVGTAIIIV |
| Ga0115005_108356971 | 3300009432 | Marine | NIDVVYLIEPPHKVANQLKILIPVGTAITIVAAVK* |
| Ga0115546_12876261 | 3300009435 | Pelagic Marine | MIKPMENNIGVLKVIDPPHIVAIQLKILIPVGTAIII |
| Ga0127401_10039993 | 3300009469 | Meromictic Pond | VNRKINPTTQIIGVVSLITPPYIVPNHEKILIPVGTAIIIVAAVK* |
| Ga0129277_10042482 | 3300009511 | Meromictic Pond | MKPIAHNIGVVNLIEPPYIVPNQLNIFIPVGTAIIIVAAVK* |
| Ga0115099_101088975 | 3300009543 | Marine | LANNIGVFITIRPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115099_101197521 | 3300009543 | Marine | HIGVSSLIVPPHIVAIQEKIFIAVGIAIIIVAAVKYIFV* |
| Ga0115099_101525571 | 3300009543 | Marine | VNKNINPIAQSIGVFNLIEPPYIVPNQLNIFIPVGTAMII |
| Ga0115099_101751832 | 3300009543 | Marine | LANNIGVFKTILPPNIVAIQLKTFIPVGTAIIIVA |
| Ga0115099_101867754 | 3300009543 | Marine | MYKVGVANQIDPPYKVAIQLKSLIEVGTAITIVAALK* |
| Ga0115099_102243114 | 3300009543 | Marine | VNNNGVLKFNQPPQIVANQLKIFIPVGTAITIVEAVK* |
| Ga0115099_102732491 | 3300009543 | Marine | NRKMNPMAHSIGVLSTIDPLYIVAIQEKHLIPVGTAIIIVAAVK* |
| Ga0115099_103372854 | 3300009543 | Marine | MMKPKVNNNGVSKFNQPPQIVANQLKILIEVGTAITIVAAVK* |
| Ga0115099_105622185 | 3300009543 | Marine | MVNNIEVVIMIEPPHIVATHLKILIPVGTAIIIVAAVK* |
| Ga0115099_105701943 | 3300009543 | Marine | VNKIIKPIAQSMGVANTILPPNIVAIQLKTLIPVGTAITIVAALK* |
| Ga0115099_106083951 | 3300009543 | Marine | KVNKKIKPLANNIGVFITIRPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115099_107782122 | 3300009543 | Marine | MKPIAKIVDMLKLITPPHKVANQLKIFTPVGTAIIIVVAVK* |
| Ga0115013_1000142030 | 3300009550 | Marine | MKPIAHNIGVVKRIEPPHIVPNQLKILIPVGTAIIIVAAVK* |
| Ga0105249_105800684 | 3300009553 | Switchgrass Rhizosphere | VNNIGVFSLTDPPHKVANQLKILIPVGTAIIIVAAVK* |
| Ga0115591_11764591 | 3300009586 | Wetland | NNIGVDIVIIPPAIVVNQPKILIPVGTAIIIVAAVK* |
| Ga0115101_11091671 | 3300009592 | Marine | FAKSIGVFITMFPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115101_12747241 | 3300009592 | Marine | KPLANNIGTFITIRPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115101_13574723 | 3300009592 | Marine | MKQIANNKGVLKFNQPPHRVANQLKILIPVGTAITIVDAVK* |
| Ga0115101_14389931 | 3300009592 | Marine | KPIANSIGVFNWIEPPHIVAIQEKILIPVGTAIIIVAAVK* |
| Ga0115011_109779281 | 3300009593 | Marine | KIKPFANNIGVFNTILPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115103_14794543 | 3300009599 | Marine | MVNKAMNPIVNHIGVFNCKVPPHIVANQEKILIAVGTAIIMVAAVK* |
| Ga0115102_106766511 | 3300009606 | Marine | PFANSIGTFKTILPPNIVAIQLNILIPVGTAIIIVAAVK* |
| Ga0115100_102566691 | 3300009608 | Marine | VNKKIKPLANNIGVFITIRPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115100_1027193910 | 3300009608 | Marine | MKPKTNNNGVLKFNQPPQIVANQLNIFTPVGTAIIIV |
| Ga0115100_104568521 | 3300009608 | Marine | KPKTNNNGVLKFNQPPQIVANQLNIFTPVGTAIIIVAAVKYICA* |
| Ga0115100_112048811 | 3300009608 | Marine | RKFNQPPQMVASQLNILTPVGTAIIIVAAVKYIIA* |
| Ga0115104_100608601 | 3300009677 | Marine | VNKKINPNAQTIGVANRIRPPKIVPNQEKILIPVGTAIIIVAPVK* |
| Ga0115104_101011095 | 3300009677 | Marine | MKPLAKSIGVFNTIDPPNIVATQLKILIPVGTAIIIVALVK* |
| Ga0115104_102800562 | 3300009677 | Marine | NIKPLAKSIGVVNMMFPPNIVAIQLNILIPVGTAIIIVAAVK* |
| Ga0115104_103424182 | 3300009677 | Marine | ANNIGVFKTILPPNIVATQLKILIPVGTAIIIVALVK* |
| Ga0115104_104123491 | 3300009677 | Marine | NNIGVFKTILPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115104_105948951 | 3300009677 | Marine | NPLAKSIGVFKTILPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0115104_107357661 | 3300009677 | Marine | NKKIKPFANNIGVFKTIVPPNIVATQLKILIPVGTAIIIVALVK* |
| Ga0115104_108588782 | 3300009677 | Marine | VNKNINPTAQSIGVFNLIEPPYIVPNQLKIFIPVGTAIIIVAAVK* |
| Ga0115104_109053765 | 3300009677 | Marine | MNPLANSIGVLSTMLPPNIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0115104_110047224 | 3300009677 | Marine | MGVLKLIEPPHIVATQLKILIPVGTAIIIVAAVK* |
| Ga0115104_110173151 | 3300009677 | Marine | NPIAQSIGVVNLIEPPYIVPNQLKILIPVGTAIIIVAAVK* |
| Ga0115104_110293702 | 3300009677 | Marine | VSPPKVKRNKKPIVNNIEVVSITLPDHIVAIHLKILIPVGTAIIIVAAVK* |
| Ga0115104_111127991 | 3300009677 | Marine | KVKRKIKPLANSIGVLRTILPPNMVAIQLKILMPVGTAIIIVAAVK* |
| Ga0115105_101187622 | 3300009679 | Marine | MNPTAQSIGVLSTIDPLYIVAIQEKHLIPVGTAIIIVAAVK* |
| Ga0115105_102080821 | 3300009679 | Marine | MKPIAQSIGVANTILPPNIVAIQLKTLIPVGTAITIVAALK* |
| Ga0115105_106958941 | 3300009679 | Marine | MKPIAQYIGARHNILPLYKVISQENILIPVGTAIIIVAVVK* |
| Ga0115105_114025401 | 3300009679 | Marine | VNKIIKPIAQSIGVANTILPPNIVAIQLKTLIPVGTAITIVAALK* |
| Ga0115105_114076251 | 3300009679 | Marine | MNPFANNIGVLSTIFPPNIVAIQLKIFIPVGTAMIIVAAVK* |
| Ga0116227_100534819 | 3300009709 | Host-Associated | MNPRAKSRGVLKSKDPPHRVASQLKILIPVGTAIIIVAAVK* |
| Ga0116227_104640701 | 3300009709 | Host-Associated | KKINPIVNSIGVSNFIEPPHKVAIQLKILIPVGTAIIIVAAVK* |
| Ga0123359_1211261 | 3300009730 | Marine | PFAKSIGVFKTIEPPNIVAIQLKILIPVGTAITIVALVK* |
| Ga0123377_10518651 | 3300009735 | Marine | NPFANNIGVFITIRPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0123377_10774951 | 3300009735 | Marine | PFANNIGVFKTIRPPNIVAIQLKIFIPVGTAIIIVALVK* |
| Ga0123368_10055341 | 3300009750 | Marine | TIGVVNLIFPPYMVAIQLNIFIPVGTAIIIVAEVK* |
| Ga0115001_106324601 | 3300009785 | Marine | NANNIGVLKLIDPPHIVAIQLNILIPVDTAMIIVAAVK* |
| Ga0132158_1070862 | 3300009845 | Meromictic Pond | IAHNIGVVNLIEPPYIVPNQLNIFIPVGTAIIIVAAVK* |
| Ga0131746_1491301 | 3300009931 | Marine | MKPTAHIIGVVNFNLPPYMVAIQLKIFIPVGTAII |
| Ga0126318_105404471 | 3300010152 | Soil | MNPTAKYTGVLLAIIPSHIVANQLNTLTPVGTAITIVAAVK* |
| Ga0136644_105688822 | 3300010334 | Freshwater Lake | VNNIGVFISIIPPQSVANQLKTFIPVGTAIIIVDAVKYALV |
| Ga0134125_100012671 | 3300010371 | Terrestrial Soil | NNIGVRKIILPPHIVAIQLKTLIPVGTAITIVAAVK* |
| Ga0134128_129666991 | 3300010373 | Terrestrial Soil | MKPMAHNIGVGNVSEPLNIVAIQENTLIPVGTAITMVATMK |
| Ga0136217_10499811 | 3300010384 | Soil | MVNKKIKPRAKSRGVLKSREPPHRVANQLKILIPVGTAIIIVAAVK* |
| Ga0058701_103596722 | 3300010395 | Agave | MVNKKINPTANNMGVFYCIEPPYMVAIQLKILIPMGTAMTMVAAVK* |
| Ga0134121_103662783 | 3300010401 | Terrestrial Soil | NIKPVANNIGTVISKRPPPIVDNQLKILIPVGTAIIIVTAVK* |
| Ga0126359_17317231 | 3300010869 | Boreal Forest Soil | ANSIGVVNRIDPPYSVANQEKILIPVGTAMIIVLAVK* |
| Ga0102750_105376221 | 3300010870 | Soil | MNPIANNIGVLNLILPPYIVANHENIFIPVGTAIIIV |
| Ga0138541_10318011 | 3300011058 | Peatlands Soil | PKTNNNGVLFKIKPPHNVAIQLKIFIPVGTAIMIVAAVK* |
| Ga0150983_135476691 | 3300011120 | Forest Soil | IGVTSLINPPQSVANQLKILIPVGIAIIIVAAVK* |
| Ga0150983_149345601 | 3300011120 | Forest Soil | PRANNIGVANRIVPPKRVANQEKILIPVGTAIIIVK* |
| Ga0151675_10414922 | 3300011254 | Marine | MNPIAHNIGVVNLIEPPYIVPNQLKILIPVGTAIIIVAAVK* |
| Ga0138371_11134932 | 3300011306 | Marine | LVLFKSIRPPHKVAIQLNILIPVGTAIIMVAAVK* |
| Ga0138365_11353971 | 3300011325 | Marine | ANNIGVVKIILPPNIVAIHEKTLIPVGIAITIVAALK* |
| Ga0138403_10621302 | 3300011326 | Marine | MNIKPSAHIIGVLNEIEPPHIVAIHENIFIPVGTAMIIVAA |
| Ga0138383_12330271 | 3300011330 | Marine | MVNKKKNPIVNNIEVVNIIDPPHIVAIHLKILIPVGTAIII |
| Ga0138383_12429601 | 3300011330 | Marine | VKPPKVNKNIKPLANNIGTFITIRPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0138383_12722522 | 3300011330 | Marine | MKPNTNNIAVFNTICPPQRVANHEKILIPVGTAIIIVAAVKYALVST |
| Ga0138384_10651872 | 3300011331 | Marine | NIGVFKTILPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0138384_11169813 | 3300011331 | Marine | LANNIGVLRTMLPPNIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0102688_10730454 | 3300011381 | Freshwater Lake | MANNIGVFIVIKPPYNVAIQLKIFIPVGTAITIVAAVK* |
| Ga0120157_10030311 | 3300011994 | Permafrost | GIGVRKSREPPHMVANQLKILIPVGTAIIIVAAVK* |
| Ga0150985_1041619572 | 3300012212 | Avena Fatua Rhizosphere | MKPRANNIGVRRSREPPQIVASQLKILIPVGTAMIIVAAVK* |
| Ga0150985_1068857563 | 3300012212 | Avena Fatua Rhizosphere | MINPRAKYTGVVNLIEEFHRVANQLKIFIPVGTAITIVAAVK* |
| Ga0150985_1104592431 | 3300012212 | Avena Fatua Rhizosphere | MANNIGVSNFIAPPHMVAIQLKILIPVGTAIIIVAAVK* |
| Ga0150985_1202196262 | 3300012212 | Avena Fatua Rhizosphere | IKAIAYNNGIFNINLPPNIVANQLNIFIPVGTAIINVAAVK* |
| Ga0150985_1211317431 | 3300012212 | Avena Fatua Rhizosphere | MNPIVHNIGVSNLKEPPYIVPNQLKILIPVGTAIIIVAAVK* |
| Ga0134023_11592881 | 3300012385 | Grasslands Soil | PLKVKRKTNPTAKSIGVVNSINPPPIVVNQLNTFIPVGTAIIIVAAVK* |
| Ga0134024_12346722 | 3300012404 | Grasslands Soil | KRNPIANNIEIDIEIIPPAIVVNQEKILIPVGTAIIIVAEVK* |
| Ga0138263_12730102 | 3300012415 | Polar Marine | VNNKGVLKFNQPPQIVANQLKILIPVGTAIIIVAAVK* |
| Ga0150984_1059593281 | 3300012469 | Avena Fatua Rhizosphere | INPTANNIAGFPRSIDPPHIVAIQLKILIPVGTAIIMVAAVK* |
| Ga0150984_1070951643 | 3300012469 | Avena Fatua Rhizosphere | VNKNKNPKANNIGVSK*IDPPNKVANQENIFIPVGTAIIIVK* |
| Ga0150984_1108302231 | 3300012469 | Avena Fatua Rhizosphere | VFNIKEPPHKVAIHENILIPVGTAMIIVAAVKYALVIEM* |
| Ga0129329_10361292 | 3300012470 | Aqueous | MKPIAKIVDMLKLITPPHKVANQLKIFTPVGTAIIMVVAVK* |
| Ga0129349_13519004 | 3300012518 | Aqueous | MKPFAHSIGVVITILPPNIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0129349_14495863 | 3300012518 | Aqueous | TANNIGVLKCKLPSHKVAIQLKILTPVGTAMIAVAEVK* |
| Ga0129350_14568721 | 3300012523 | Aqueous | INPIANNIGVSKLKEPPHIVATQEKILIPVGTAIIMVAAVK* |
| Ga0157559_10407711 | 3300012694 | Freshwater | KANSIGVSKVILPPHMVAIQLKTLIPVGTAIIIVAAVK* |
| Ga0157550_10683781 | 3300012710 | Freshwater | PPRVNRKIKPRANSIPGSSKSNEPPHKVANQLKILIPVGTAIIIVAAVK* |
| Ga0157601_10672643 | 3300012714 | Freshwater | VNKNINPIAHNIGVSNFIDPPYIVPNQLNIFIPVGTAI |
| Ga0157557_11764842 | 3300012718 | Freshwater | PRVNRKIKPRANSIPGSSKSNEPPHKVANQLKILIPVGTAIIIVAAVK* |
| Ga0138276_10778135 | 3300012768 | Freshwater Lake | VKSIAGVFILIAPPHKVASQLKTLIPVGTAIIIVAAVK* |
| Ga0138270_10267621 | 3300012771 | Freshwater Lake | PMENKNINAITNKYGTPIIILPPHIVANQLKTLIPVGIAIIIVAAVK* |
| Ga0138287_12126754 | 3300012772 | Freshwater Lake | MGVFKIILPPQRVANQLKIFIPVGTAITIVAAVK* |
| Ga0138275_11692492 | 3300012776 | Freshwater Lake | VNSSGVFKTNQPPQIVANHEKILIPVGTAITMVAAVK* |
| Ga0138275_13214951 | 3300012776 | Freshwater Lake | KVNKKRNPTAKSIAGCFMSIKPPHIVAIQLKILIPVGTAIIIVAAVK* |
| Ga0160423_106758261 | 3300012920 | Surface Seawater | VVNLILPPYIVAIQLNIFIPVGTAIIIVAAVKYAL |
| Ga0163109_114061162 | 3300012936 | Surface Seawater | MKIKPRAHIIGVLNEIDPPHIVAIHEKIFIPVGTAIIIVAA |
| Ga0163111_119054811 | 3300012954 | Surface Seawater | PLAKSIGVFRTIEPPNIVAIQLKILIPVGTAIIIVALVK* |
| Ga0157620_10853891 | 3300012959 | Freshwater | VKPPKVKRKINPLANNIGVFITIRPPNIVAIQLKILIPVGTAIIMVALVK* |
| Ga0129346_10385081 | 3300012965 | Aqueous | ANHIGVSK*ILPPHIVATQEKILIAVGTAILGIVIVK* |
| Ga0129346_10956361 | 3300012965 | Aqueous | ANNIGVRKSIEPPHMVANQLKILIPVGTAIIIVAAVK* |
| Ga0129341_10297701 | 3300012966 | Aqueous | AKSIGVFITIRPPNIVAIQLKILIPVGTAMIIVALVK* |
| Ga0129341_11959691 | 3300012966 | Aqueous | NNIGVFNTIRPPNMVATQLKILIPVGTAIIIVALVK* |
| Ga0129332_11455731 | 3300012969 | Aqueous | TVNKNINPNAQTIGVLNEIDPPHIVAIHENILIPVGTAMIIVAAKK* |
| Ga0157618_10524402 | 3300013074 | Freshwater | MKPTAKSIGTFKVIEPPHIVANQEKILIPVGTAMI |
| Ga0170791_121503781 | 3300013295 | Freshwater | AQPTAKSIGTFNVICPPHIVASHENILIPVGTAIIIVAAVK* |
| Ga0170791_125014821 | 3300013295 | Freshwater | ANNIGVFKTIEPPHKVASQENIFIPVGTAIIIVAAVK* |
| Ga0170791_132911281 | 3300013295 | Freshwater | VNKNINPIAQIIGTLNLIDPPNIVPNQLNILIPVGIAIIIVAA |
| Ga0170791_133510622 | 3300013295 | Freshwater | MANNIGVLYTIVPPQIVKIQLKIFIPVGTAIIIVAAVK* |
| Ga0170791_151569582 | 3300013295 | Freshwater | VNKNINPIAHNIGVSNFIDPPYIVPNQLNIFIPVGTAIIIVAAVK* |
| Ga0170791_159712981 | 3300013295 | Freshwater | ANNIGVLKSTLPPYIVPNQLKILIPVGTAIIIVAAVK* |
| Ga0177922_104627433 | 3300013372 | Freshwater | INPIVHNIGVSYLILPPNIVANQENIFIPVGTAIIIVAAVK* |
| Ga0163163_131173231 | 3300014325 | Switchgrass Rhizosphere | PIANNIGIVKLIIPPAIVVNHENIFIPVGTAIIIVRQ* |
| Ga0137405_131348913 | 3300015053 | Vadose Zone Soil | MKPIAHSIGVLNSIEPPTSWRSQEKIFTPVGTAITIVAATK* |
| Ga0163144_108680053 | 3300015360 | Freshwater Microbial Mat | PKTKYIGVTKIILPPHKVAIQLKIFIPVGTAIIIVAVLK* |
| Ga0132255_1035905001 | 3300015374 | Arabidopsis Rhizosphere | IAKYIDVVISTIPPIIVDTQLNIFTPVGTAIIIVAAVK* |
| Ga0182032_104520182 | 3300016357 | Soil | MKPIAHSIGVLNSIEPPHIVAIQEKILIPVGTAITIEAAAK |
| Ga0182039_117840742 | 3300016422 | Soil | KTKMKPIAHIIGGLNEIDPPHMVATQEKIFTPVGTAITMVANTK |
| Ga0193058_10683762 | 3300018758 | Marine | AHKLEGLKFNLAPWYVLTQLKILIPVGTAIIIVAVVK |
| Ga0184647_12280962 | 3300019263 | Groundwater Sediment | ENNKGVVNRMLPPKRVANQEKILIPVGTAIIIVAAVKYARV |
| Ga0182068_14660311 | 3300019280 | Salt Marsh | NKNKKPTINNKEVLKIIIPPHKVANHEKIFKPVGTAITIVAAEK |
| Ga0206356_111604191 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | ANNIGVVNRIVPPKRVANQEKILIPVGTAIIIVAAVK |
| Ga0206349_16569661 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | ANNIGVANRIVPPKRVANQEKILIPVGTAMIIVAAVK |
| Ga0206351_100842363 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | ANNIGVANRIVPPKRVANQEKILIPVGTAIIIVAAVK |
| Ga0206351_104519591 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | NIGVVNRIVPPKRVANQEKILIPVGTAIIIVAAVK |
| Ga0206352_105983893 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | PRANNIGVANRIVPPKRVANQEKILIPVGTAMIIVK |
| Ga0211688_10470581 | 3300020317 | Marine | PPNVNKNIKPLAKSIGVFKTILPPNIVAIQLKILIPVGTAIIIVALVK |
| Ga0213504_1001213 | 3300022466 | Switchgrass Phyllosphere | AHSIGTVILRLPPYAVASQEKILIPVGTAMIIVAAVK |
| Ga0224712_103131342 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | PIVNKTRNPLVNLIGASRLIDPPHIVANHEKILIPVGTAIIMVAAVK |
| Ga0242658_10578133 | 3300022530 | Soil | AKSIGVLKLILPPTIVAIQLKIFTAVGMAISVVLVAKKA |
| Ga0256337_10771431 | 3300024573 | Freshwater | NIGVLYRRLPPYIVPNQLKILIPVGTAIIIVAAVK |
| Ga0247591_10329531 | 3300026434 | Seawater | FANNIGVVSTILPPNIVAIQLKILIPVGTAIIIVAAVK |
| Ga0247591_11069492 | 3300026434 | Seawater | VNKNIKPLANNIGVFSTIEPPNIVAIQLKILIPVGTAIIIVALVK |
| Ga0247603_11173181 | 3300026468 | Seawater | MKPTAQSILVFGAITPPHIVATQENTLIPVGTAIIIVAAVK |
| Ga0247571_11169911 | 3300026495 | Seawater | PKVNRNIKPLAKSIGVVNMIFPPNIVAIQLNILIPVGTAIIIVAAVK |
| Ga0256887_10603511 | 3300027005 | Enriched Soil Aggregate | PSVNNIKKPITKSKGVFLTIWPPHNVAIQLKIFIPVGTAIIIVAAVK |
| Ga0256891_10239721 | 3300027008 | Enriched Soil Aggregate | PITKSKGVFLTIWPPHNVAIQLKIFIPVGTAIIIVAAVK |
| Ga0208992_100000220 | 3300027176 | Forest Soil | VNRQMKPKVNNIGVLILTDPPQAVANQEKILIAVGTAMIIVALVK |
| Ga0208987_10500341 | 3300027496 | Forest Soil | MKPKVNNIGVLILTDPPQAVANQEKILIAVGTAMIIVALVK |
| Ga0209710_12555591 | 3300027687 | Marine | IKPLANNIGVFRTILPPNIVAIQLKILIPVGTAIIIVALVK |
| Ga0209075_10402174 | 3300027711 | Agricultural Soil | PPTVNITIKPRVNSIGAFKIKLPPQIVASQLKTLIPVGTAITP |
| Ga0304730_11413432 | 3300028394 | Freshwater Lake | PTVNKNIKPNAQSVGTFNWIRPPHIVAIHENILIPVGTAIIIVAAVK |
| Ga0302198_104535291 | 3300028765 | Bog | VNNIAGVMVIEPPHMVASQLKILIPVGTAIIIVAAVK |
| Ga0302197_102260631 | 3300028873 | Bog | MNPTVNNIAGVMVIEPPHMVASQLKILIPVGTAIIIVAAVK |
| Ga0308198_10095231 | 3300030904 | Soil | ANNIGVVNLILPPKRVANQEKILIPVGTAMIIVAAVK |
| Ga0308189_100218101 | 3300031058 | Soil | RKMKPRANNIGVANRIVPPKRVANQEKILIPVGTAMIIVK |
| Ga0308199_11034301 | 3300031094 | Soil | KPRANNIGVVNLILPPKRVANQEKILIPVGTAIIIVK |
| Ga0308194_103399071 | 3300031421 | Soil | RANNIGVVNLILTPKRVANQEKILIPVGTAMIIVAAVK |
| Ga0308179_10000491 | 3300031424 | Soil | NIGVVNLILPPKRVANQEKILIPVGTAMIIVAAVK |
| Ga0308011_101920381 | 3300031688 | Marine | MGVVSLIEPPYIVPNQLNILIPVGTAIIIVAAVKYA |
| Ga0314770_11393161 | 3300033533 | Switchgrass Phyllosphere | MNPTANNMGVLYCMEPPHMVAIQLKILIPVGTAMIMV |
| Ga0335005_0023025_2312_2437 | 3300034022 | Freshwater | MKPTVNNNGVLKFIHPPQMVASQLKILIPVGTAITIVAAVK |
| Ga0335017_0557162_2_115 | 3300034167 | Freshwater | VNNNGVLKFIHPPQMVASQLKILIPVGTAITIVAAVK |
| Ga0314793_010156_3_122 | 3300034668 | Soil | KMKPRANNIGVANRIAPPNSVANQENILIPVGTAMIIVK |
| Ga0314802_007410_804_941 | 3300034677 | Soil | VNKNKNPIANNIAVSKIIDPPNIVANQLKILIPVGIPIIIVAAEK |
| Ga0370541_002822_14_130 | 3300034680 | Soil | MKPRANNIGVVNLILPPKRVANQEKILIPVGTAMIIVK |
| ⦗Top⦘ |