


| Basic Information | |
|---|---|
| Family ID | F022826 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 37 residues |
| Representative Sequence | DLFAAVRSVIGTAARRGIDAYQAIRNTLCGQSVLAPG |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 96.70 % |
| % of genes from short scaffolds (< 2000 bps) | 72.64 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.415 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock (39.623 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.566 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (58.019 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF13586 | DDE_Tnp_1_2 | 1.89 |
| PF13561 | adh_short_C2 | 1.42 |
| PF13610 | DDE_Tnp_IS240 | 1.42 |
| PF13358 | DDE_3 | 1.42 |
| PF04972 | BON | 1.42 |
| PF07690 | MFS_1 | 1.42 |
| PF01575 | MaoC_dehydratas | 1.42 |
| PF13565 | HTH_32 | 0.94 |
| PF02371 | Transposase_20 | 0.94 |
| PF12762 | DDE_Tnp_IS1595 | 0.94 |
| PF00857 | Isochorismatase | 0.94 |
| PF00078 | RVT_1 | 0.94 |
| PF03050 | DDE_Tnp_IS66 | 0.94 |
| PF13808 | DDE_Tnp_1_assoc | 0.94 |
| PF13700 | DUF4158 | 0.94 |
| PF03400 | DDE_Tnp_IS1 | 0.94 |
| PF08378 | NERD | 0.94 |
| PF13340 | DUF4096 | 0.94 |
| PF00496 | SBP_bac_5 | 0.94 |
| PF16816 | DotD | 0.47 |
| PF00006 | ATP-synt_ab | 0.47 |
| PF13378 | MR_MLE_C | 0.47 |
| PF17200 | sCache_2 | 0.47 |
| PF03144 | GTP_EFTU_D2 | 0.47 |
| PF00989 | PAS | 0.47 |
| PF13470 | PIN_3 | 0.47 |
| PF00497 | SBP_bac_3 | 0.47 |
| PF04851 | ResIII | 0.47 |
| PF13426 | PAS_9 | 0.47 |
| PF13310 | Virulence_RhuM | 0.47 |
| PF01927 | Mut7-C | 0.47 |
| PF04940 | BLUF | 0.47 |
| PF00535 | Glycos_transf_2 | 0.47 |
| PF07015 | VirC1 | 0.47 |
| PF00271 | Helicase_C | 0.47 |
| PF00012 | HSP70 | 0.47 |
| PF04335 | VirB8 | 0.47 |
| PF01526 | DDE_Tnp_Tn3 | 0.47 |
| PF13936 | HTH_38 | 0.47 |
| PF13683 | rve_3 | 0.47 |
| PF16841 | CBM60 | 0.47 |
| PF10592 | AIPR | 0.47 |
| PF02781 | G6PD_C | 0.47 |
| PF02899 | Phage_int_SAM_1 | 0.47 |
| PF08530 | PepX_C | 0.47 |
| PF13382 | Adenine_deam_C | 0.47 |
| PF02653 | BPD_transp_2 | 0.47 |
| PF02805 | Ada_Zn_binding | 0.47 |
| PF00730 | HhH-GPD | 0.47 |
| PF06968 | BATS | 0.47 |
| PF00583 | Acetyltransf_1 | 0.47 |
| PF13462 | Thioredoxin_4 | 0.47 |
| PF00282 | Pyridoxal_deC | 0.47 |
| PF02742 | Fe_dep_repr_C | 0.47 |
| PF13155 | Toprim_2 | 0.47 |
| PF07378 | FlbT | 0.47 |
| PF05199 | GMC_oxred_C | 0.47 |
| PF09335 | SNARE_assoc | 0.47 |
| PF00563 | EAL | 0.47 |
| PF09361 | Phasin_2 | 0.47 |
| PF17092 | PCB_OB | 0.47 |
| PF13692 | Glyco_trans_1_4 | 0.47 |
| PF00672 | HAMP | 0.47 |
| PF13614 | AAA_31 | 0.47 |
| PF00239 | Resolvase | 0.47 |
| PF02811 | PHP | 0.47 |
| PF07309 | FlaF | 0.47 |
| PF13442 | Cytochrome_CBB3 | 0.47 |
| PF12833 | HTH_18 | 0.47 |
| PF07685 | GATase_3 | 0.47 |
| PF03061 | 4HBT | 0.47 |
| PF00478 | IMPDH | 0.47 |
| PF04392 | ABC_sub_bind | 0.47 |
| PF07362 | CcdA | 0.47 |
| PF08892 | YqcI_YcgG | 0.47 |
| PF13701 | DDE_Tnp_1_4 | 0.47 |
| PF07978 | NIPSNAP | 0.47 |
| PF00665 | rve | 0.47 |
| PF02826 | 2-Hacid_dh_C | 0.47 |
| PF00589 | Phage_integrase | 0.47 |
| PF03235 | DUF262 | 0.47 |
| PF05175 | MTS | 0.47 |
| PF00296 | Bac_luciferase | 0.47 |
| PF13560 | HTH_31 | 0.47 |
| PF14280 | DUF4365 | 0.47 |
| PF02785 | Biotin_carb_C | 0.47 |
| PF00016 | RuBisCO_large | 0.47 |
| PF05973 | Gp49 | 0.47 |
| PF07366 | SnoaL | 0.47 |
| PF03466 | LysR_substrate | 0.47 |
| PF14690 | zf-ISL3 | 0.47 |
| PF05368 | NmrA | 0.47 |
| PF03795 | YCII | 0.47 |
| PF01292 | Ni_hydr_CYTB | 0.47 |
| PF01569 | PAP2 | 0.47 |
| PF00578 | AhpC-TSA | 0.47 |
| PF13602 | ADH_zinc_N_2 | 0.47 |
| PF00156 | Pribosyltran | 0.47 |
| PF13545 | HTH_Crp_2 | 0.47 |
| PF13604 | AAA_30 | 0.47 |
| PF02668 | TauD | 0.47 |
| PF00005 | ABC_tran | 0.47 |
| PF01135 | PCMT | 0.47 |
| PF13673 | Acetyltransf_10 | 0.47 |
| PF00480 | ROK | 0.47 |
| PF03704 | BTAD | 0.47 |
| PF12161 | HsdM_N | 0.47 |
| PF12760 | Zn_Tnp_IS1595 | 0.47 |
| PF01872 | RibD_C | 0.47 |
| PF01625 | PMSR | 0.47 |
| PF02518 | HATPase_c | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.94 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.94 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 0.94 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.47 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.47 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.47 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.47 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.47 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.47 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.47 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.47 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.47 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.47 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.47 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.47 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.47 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.47 |
| COG3403 | Uncharacterized conserved protein YcgG, contains conserved FPC and CPF motifs | Function unknown [S] | 0.47 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.47 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.47 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.47 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.47 |
| COG3736 | Type IV secretory pathway, component VirB8 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.47 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.47 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.47 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.47 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.47 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.47 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.47 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.47 |
| COG5302 | Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid | Mobilome: prophages, transposons [X] | 0.47 |
| COG5442 | Flagellar biosynthesis regulator FlaF | Cell motility [N] | 0.47 |
| COG5443 | Flagellar biosynthesis regulator FlbT | Cell motility [N] | 0.47 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.47 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.47 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.47 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.47 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.47 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.47 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.47 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.47 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.47 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.47 |
| COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.47 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.47 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.47 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.42 % |
| Unclassified | root | N/A | 23.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_101466281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300005506|Ga0068912_11112821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300005573|Ga0078972_1345968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium | 527 | Open in IMG/M |
| 3300005591|Ga0070761_10946007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 545 | Open in IMG/M |
| 3300006893|Ga0073928_10137363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1989 | Open in IMG/M |
| 3300006893|Ga0073928_10679377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 720 | Open in IMG/M |
| 3300006893|Ga0073928_10806583 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006904|Ga0075424_101826213 | Not Available | 643 | Open in IMG/M |
| 3300006954|Ga0079219_10814381 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300009503|Ga0123519_10007616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 16708 | Open in IMG/M |
| 3300010044|Ga0126310_11113275 | Not Available | 629 | Open in IMG/M |
| 3300010045|Ga0126311_11413980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300010114|Ga0127460_1039873 | Not Available | 596 | Open in IMG/M |
| 3300010339|Ga0074046_10235217 | Not Available | 1141 | Open in IMG/M |
| 3300010339|Ga0074046_10319907 | Not Available | 950 | Open in IMG/M |
| 3300010339|Ga0074046_10351312 | Not Available | 898 | Open in IMG/M |
| 3300010339|Ga0074046_10642039 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010339|Ga0074046_10700712 | Not Available | 595 | Open in IMG/M |
| 3300010341|Ga0074045_10053817 | Not Available | 2901 | Open in IMG/M |
| 3300010341|Ga0074045_10358174 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300010341|Ga0074045_10488402 | Not Available | 792 | Open in IMG/M |
| 3300010343|Ga0074044_10462608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
| 3300010373|Ga0134128_10372000 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300010373|Ga0134128_12383889 | Not Available | 583 | Open in IMG/M |
| 3300010396|Ga0134126_11569232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 725 | Open in IMG/M |
| 3300010403|Ga0134123_12316768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 601 | Open in IMG/M |
| 3300012212|Ga0150985_111053965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1146 | Open in IMG/M |
| 3300012212|Ga0150985_120480334 | Not Available | 519 | Open in IMG/M |
| 3300012469|Ga0150984_111632828 | Not Available | 553 | Open in IMG/M |
| 3300012984|Ga0164309_11144682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300012985|Ga0164308_10210965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1487 | Open in IMG/M |
| 3300012986|Ga0164304_10306927 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012989|Ga0164305_12188975 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300014487|Ga0182000_10082416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1041 | Open in IMG/M |
| 3300014492|Ga0182013_10098056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300014493|Ga0182016_10013428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 7746 | Open in IMG/M |
| 3300014495|Ga0182015_10666274 | Not Available | 657 | Open in IMG/M |
| 3300014499|Ga0182012_10640478 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300014499|Ga0182012_10843470 | Not Available | 579 | Open in IMG/M |
| 3300014838|Ga0182030_11640546 | Not Available | 524 | Open in IMG/M |
| 3300015083|Ga0167624_1026500 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300015196|Ga0167627_1136269 | Not Available | 505 | Open in IMG/M |
| 3300015358|Ga0134089_10548301 | Not Available | 512 | Open in IMG/M |
| 3300017999|Ga0187767_10279504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300018432|Ga0190275_11872456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 678 | Open in IMG/M |
| 3300018482|Ga0066669_11702481 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018894|Ga0193603_1034112 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300018984|Ga0193605_1134100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia rosea | 747 | Open in IMG/M |
| 3300019767|Ga0190267_10006000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3126 | Open in IMG/M |
| 3300020579|Ga0210407_10725335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300021171|Ga0210405_10406681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1072 | Open in IMG/M |
| 3300021180|Ga0210396_10144879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2136 | Open in IMG/M |
| 3300021372|Ga0213877_10051159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
| 3300021407|Ga0210383_11149331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300021433|Ga0210391_10512126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
| 3300021433|Ga0210391_11221967 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021441|Ga0213871_10049901 | Not Available | 1144 | Open in IMG/M |
| 3300021474|Ga0210390_11020978 | Not Available | 675 | Open in IMG/M |
| 3300023247|Ga0224529_1052651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 699 | Open in IMG/M |
| 3300024426|Ga0196960_10032885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas eburnea | 1395 | Open in IMG/M |
| 3300025493|Ga0208610_107053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1381 | Open in IMG/M |
| 3300025511|Ga0207950_101389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 6312 | Open in IMG/M |
| 3300025916|Ga0207663_10216493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus acidophilus | 1391 | Open in IMG/M |
| 3300025921|Ga0207652_11413549 | Not Available | 599 | Open in IMG/M |
| 3300025929|Ga0207664_10829270 | Not Available | 831 | Open in IMG/M |
| 3300025944|Ga0207661_11208377 | Not Available | 696 | Open in IMG/M |
| 3300027812|Ga0209656_10034971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2945 | Open in IMG/M |
| 3300027812|Ga0209656_10121421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1345 | Open in IMG/M |
| 3300027812|Ga0209656_10136115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1247 | Open in IMG/M |
| 3300027815|Ga0209726_10203921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → Pseudoxanthomonas spadix | 1039 | Open in IMG/M |
| 3300027824|Ga0209040_10001012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 21966 | Open in IMG/M |
| 3300027863|Ga0207433_10005402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 22871 | Open in IMG/M |
| 3300027863|Ga0207433_10212963 | Not Available | 1453 | Open in IMG/M |
| 3300028108|Ga0256305_1121911 | Not Available | 625 | Open in IMG/M |
| 3300028565|Ga0302145_10041960 | Not Available | 1623 | Open in IMG/M |
| 3300028566|Ga0302147_10013975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 2993 | Open in IMG/M |
| 3300028566|Ga0302147_10024859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2180 | Open in IMG/M |
| 3300028709|Ga0307279_10111869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300028742|Ga0302220_10347623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300028745|Ga0302267_10000214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 74620 | Open in IMG/M |
| 3300028755|Ga0307316_10347575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300028775|Ga0302231_10257551 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300028789|Ga0302232_10239171 | Not Available | 901 | Open in IMG/M |
| 3300028813|Ga0302157_10459103 | Not Available | 671 | Open in IMG/M |
| 3300029883|Ga0311327_10169999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1522 | Open in IMG/M |
| 3300029911|Ga0311361_10150060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3058 | Open in IMG/M |
| 3300029917|Ga0311326_10160801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300029922|Ga0311363_10110217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3727 | Open in IMG/M |
| 3300029951|Ga0311371_10218521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2799 | Open in IMG/M |
| 3300029951|Ga0311371_11862986 | Not Available | 646 | Open in IMG/M |
| 3300029953|Ga0311343_10019979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 9430 | Open in IMG/M |
| 3300029953|Ga0311343_10021246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9077 | Open in IMG/M |
| 3300029954|Ga0311331_10269804 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300029985|Ga0302280_1003835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 10609 | Open in IMG/M |
| 3300030503|Ga0311370_11705328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium rubrum | 646 | Open in IMG/M |
| 3300030517|Ga0272420_1073792 | Not Available | 1336 | Open in IMG/M |
| 3300030523|Ga0272436_1000573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 80347 | Open in IMG/M |
| 3300030523|Ga0272436_1001129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 47505 | Open in IMG/M |
| 3300030523|Ga0272436_1001555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 37406 | Open in IMG/M |
| 3300030523|Ga0272436_1003284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 20721 | Open in IMG/M |
| 3300030523|Ga0272436_1016961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5696 | Open in IMG/M |
| 3300030523|Ga0272436_1050797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1990 | Open in IMG/M |
| 3300030523|Ga0272436_1054773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1848 | Open in IMG/M |
| 3300030523|Ga0272436_1057690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1757 | Open in IMG/M |
| 3300030523|Ga0272436_1139240 | Not Available | 745 | Open in IMG/M |
| 3300030906|Ga0302314_10066022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium angustum | 5176 | Open in IMG/M |
| 3300031091|Ga0308201_10029318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia rosea | 1236 | Open in IMG/M |
| 3300031092|Ga0308204_10341318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300031099|Ga0308181_1020864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1057 | Open in IMG/M |
| 3300031234|Ga0302325_13069522 | Not Available | 537 | Open in IMG/M |
| 3300031447|Ga0272435_1005771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8921 | Open in IMG/M |
| 3300031447|Ga0272435_1005910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8755 | Open in IMG/M |
| 3300031447|Ga0272435_1006777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7806 | Open in IMG/M |
| 3300031447|Ga0272435_1017054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3842 | Open in IMG/M |
| 3300031447|Ga0272435_1030509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Silicimonas → Silicimonas algicola | 2458 | Open in IMG/M |
| 3300031447|Ga0272435_1031474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2396 | Open in IMG/M |
| 3300031447|Ga0272435_1036194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2145 | Open in IMG/M |
| 3300031447|Ga0272435_1082208 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300031448|Ga0272438_1000058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 148403 | Open in IMG/M |
| 3300031448|Ga0272438_1000644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 52955 | Open in IMG/M |
| 3300031448|Ga0272438_1018685 | All Organisms → cellular organisms → Bacteria | 5715 | Open in IMG/M |
| 3300031448|Ga0272438_1116985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1423 | Open in IMG/M |
| 3300031449|Ga0272429_1302146 | Not Available | 504 | Open in IMG/M |
| 3300031450|Ga0272433_10044477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 3425 | Open in IMG/M |
| 3300031450|Ga0272433_10144159 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300031450|Ga0272433_10172532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300031450|Ga0272433_10181836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1189 | Open in IMG/M |
| 3300031450|Ga0272433_10391843 | Not Available | 618 | Open in IMG/M |
| 3300031450|Ga0272433_10446626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300031451|Ga0272426_1001370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 36470 | Open in IMG/M |
| 3300031451|Ga0272426_1022363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3417 | Open in IMG/M |
| 3300031451|Ga0272426_1208353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300031452|Ga0272422_1082779 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300031452|Ga0272422_1093916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1215 | Open in IMG/M |
| 3300031454|Ga0272427_1044344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2273 | Open in IMG/M |
| 3300031454|Ga0272427_1096897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 1097 | Open in IMG/M |
| 3300031454|Ga0272427_1168857 | Not Available | 654 | Open in IMG/M |
| 3300031470|Ga0272432_1011846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 7499 | Open in IMG/M |
| 3300031471|Ga0272439_1027297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella | 5174 | Open in IMG/M |
| 3300031472|Ga0272437_1000581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 61359 | Open in IMG/M |
| 3300031472|Ga0272437_1006278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 14196 | Open in IMG/M |
| 3300031472|Ga0272437_1006768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13557 | Open in IMG/M |
| 3300031472|Ga0272437_1011243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 9882 | Open in IMG/M |
| 3300031472|Ga0272437_1106987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1855 | Open in IMG/M |
| 3300031472|Ga0272437_1120386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium gossipiicola | 1673 | Open in IMG/M |
| 3300031472|Ga0272437_1138368 | Not Available | 1478 | Open in IMG/M |
| 3300031472|Ga0272437_1152300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1357 | Open in IMG/M |
| 3300031472|Ga0272437_1175934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B510 | 1193 | Open in IMG/M |
| 3300031472|Ga0272437_1230073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300031472|Ga0272437_1319531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300031472|Ga0272437_1411946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 558 | Open in IMG/M |
| 3300031473|Ga0272434_1129013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1615 | Open in IMG/M |
| 3300031473|Ga0272434_1166924 | Not Available | 1269 | Open in IMG/M |
| 3300031473|Ga0272434_1198755 | Not Available | 1066 | Open in IMG/M |
| 3300031520|Ga0272428_1006558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 17450 | Open in IMG/M |
| 3300031520|Ga0272428_1009023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13616 | Open in IMG/M |
| 3300031520|Ga0272428_1012280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10638 | Open in IMG/M |
| 3300031520|Ga0272428_1019703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 7196 | Open in IMG/M |
| 3300031520|Ga0272428_1021697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 6639 | Open in IMG/M |
| 3300031520|Ga0272428_1032743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 4727 | Open in IMG/M |
| 3300031520|Ga0272428_1036616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. P52-10 | 4312 | Open in IMG/M |
| 3300031520|Ga0272428_1058716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2899 | Open in IMG/M |
| 3300031520|Ga0272428_1060001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2845 | Open in IMG/M |
| 3300031520|Ga0272428_1095166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1902 | Open in IMG/M |
| 3300031520|Ga0272428_1096912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1872 | Open in IMG/M |
| 3300031520|Ga0272428_1134954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1400 | Open in IMG/M |
| 3300031520|Ga0272428_1178298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1092 | Open in IMG/M |
| 3300031520|Ga0272428_1202725 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300031520|Ga0272428_1290187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 695 | Open in IMG/M |
| 3300031520|Ga0272428_1402977 | Not Available | 512 | Open in IMG/M |
| 3300031564|Ga0318573_10543220 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031708|Ga0310686_107844467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300031708|Ga0310686_111831248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300031708|Ga0310686_117330362 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300031715|Ga0307476_10920577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300031847|Ga0310907_10052698 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300031901|Ga0307406_11005107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300031909|Ga0272421_1103902 | Not Available | 751 | Open in IMG/M |
| 3300031938|Ga0308175_100455368 | Not Available | 1350 | Open in IMG/M |
| 3300031938|Ga0308175_102061282 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031996|Ga0308176_11618711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 48 | 690 | Open in IMG/M |
| 3300031996|Ga0308176_11991397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 620 | Open in IMG/M |
| 3300032074|Ga0308173_10079694 | Not Available | 2487 | Open in IMG/M |
| 3300032126|Ga0307415_101355590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 676 | Open in IMG/M |
| 3300032162|Ga0272424_1014810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9456 | Open in IMG/M |
| 3300032162|Ga0272424_1030728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 5190 | Open in IMG/M |
| 3300032162|Ga0272424_1045448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3624 | Open in IMG/M |
| 3300032162|Ga0272424_1116380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300032162|Ga0272424_1268460 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032162|Ga0272424_1307178 | Not Available | 500 | Open in IMG/M |
| 3300032892|Ga0335081_12644973 | Not Available | 514 | Open in IMG/M |
| 3300032895|Ga0335074_10892494 | Not Available | 808 | Open in IMG/M |
| 3300033168|Ga0272423_1085140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1891 | Open in IMG/M |
| 3300033168|Ga0272423_1096963 | Not Available | 1694 | Open in IMG/M |
| 3300033168|Ga0272423_1178905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 956 | Open in IMG/M |
| 3300033168|Ga0272423_1297012 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300033168|Ga0272423_1319077 | Not Available | 531 | Open in IMG/M |
| 3300033181|Ga0272431_10109131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1877 | Open in IMG/M |
| 3300033181|Ga0272431_10113586 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300033402|Ga0326728_10028943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9539 | Open in IMG/M |
| 3300033405|Ga0326727_10341605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1429 | Open in IMG/M |
| 3300033755|Ga0371489_0253798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → Acidisphaera rubrifaciens → Acidisphaera rubrifaciens HS-AP3 | 874 | Open in IMG/M |
| 3300034001|Ga0334919_047174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 709 | Open in IMG/M |
| 3300034004|Ga0334926_075120 | Not Available | 554 | Open in IMG/M |
| 3300034130|Ga0370494_144126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300034139|Ga0334956_039735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 757 | Open in IMG/M |
| 3300034160|Ga0370510_0297915 | Not Available | 510 | Open in IMG/M |
| 3300034196|Ga0370503_0037261 | Not Available | 1578 | Open in IMG/M |
| 3300034251|Ga0334947_135073 | Not Available | 524 | Open in IMG/M |
| 3300034268|Ga0372943_0078294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WSM2598 | 1904 | Open in IMG/M |
| 3300034268|Ga0372943_0084932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1834 | Open in IMG/M |
| 3300034268|Ga0372943_0271736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1070 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 39.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.19% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.19% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 4.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.42% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.42% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.94% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.47% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.47% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.47% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.47% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005506 | Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009503 | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015083 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1C, Ice margin) | Environmental | Open in IMG/M |
| 3300015196 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018894 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018984 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300023247 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50 | Environmental | Open in IMG/M |
| 3300024426 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 | Environmental | Open in IMG/M |
| 3300025493 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8A2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025511 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11_8B_AprC (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030517 | Rock endolithic microbial communities from Victoria Land, Antarctica - Battleship Promontory nord | Environmental | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031447 | Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nord | Environmental | Open in IMG/M |
| 3300031448 | Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nord | Environmental | Open in IMG/M |
| 3300031449 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031451 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nord | Environmental | Open in IMG/M |
| 3300031452 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| 3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
| 3300031471 | Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sud | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031909 | Rock endolithic microbial communities from Victoria Land, Antarctica - Buttleship Promontory sud | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032162 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nord | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033168 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud | Environmental | Open in IMG/M |
| 3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034001 | Biocrust microbial communities from Mojave Desert, California, United States - 15HMC | Environmental | Open in IMG/M |
| 3300034004 | Biocrust microbial communities from Mojave Desert, California, United States - 22HNC | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034139 | Biocrust microbial communities from Mojave Desert, California, United States - 52SNC | Environmental | Open in IMG/M |
| 3300034160 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18 | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| 3300034251 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063454_1014662812 | 3300004081 | Soil | WGADLFAAVRSVIGTAARRGINAYRAIRDTLQGHSVLAPG* |
| Ga0068912_111128211 | 3300005506 | Soil | DLYAAVRSVIGTAARRGIDAYRAIRATLQGQSILAPG* |
| Ga0078972_13459682 | 3300005573 | Hot Spring | LFAGFRSVVGTAARRGIDAYQAIKMTLQGKSVLAPG* |
| Ga0070761_109460071 | 3300005591 | Soil | LFADIRSVLGTAARQGINAYQAILAILRGGSVLQAG* |
| Ga0073928_101373633 | 3300006893 | Iron-Sulfur Acid Spring | FAGVRSVVGTAARRGKDAYQAILAVLDGESVVQPG* |
| Ga0073928_106793771 | 3300006893 | Iron-Sulfur Acid Spring | LFAAVRSVIGTAKRCGIDAYRAIRDALQGQSAPAPG* |
| Ga0073928_108065831 | 3300006893 | Iron-Sulfur Acid Spring | LFAGVRSVVGTAARRGKDAYQAILAVLDGESVVQPG* |
| Ga0075424_1018262131 | 3300006904 | Populus Rhizosphere | GADLFAAVRSVVAAAARCGTDAYHAILAVIDGKSVLQAG* |
| Ga0079219_108143811 | 3300006954 | Agricultural Soil | WGANFFAAVRSIIGTAARRGIDAYQAIKTILQGQSVLAPA* |
| Ga0123519_1000761611 | 3300009503 | Hot Spring | DLFAGFRSVVGTAARRGIDAYQAIKMTLQGKSVLAPG* |
| Ga0126310_111132751 | 3300010044 | Serpentine Soil | RSTWGTDLYAALRSVIGTAARRGIDAYQAIRTTLQGQSVIAPG* |
| Ga0126311_114139801 | 3300010045 | Serpentine Soil | GGFRSTWGADLYAAVRSVIDTAARRGMGAYQVIHATLQRQSVVAPG* |
| Ga0127460_10398732 | 3300010114 | Grasslands Soil | ASVRSIIGTAARHGIDAYQAIRQTLRGQSILEPG* |
| Ga0074046_102352171 | 3300010339 | Bog Forest Soil | LFAAVRSVIGTAKRRGIDAYQAIRDTLQGQSALAPG* |
| Ga0074046_103199071 | 3300010339 | Bog Forest Soil | FAAVRSVIGTAKRRGIDAYQAIRDTLQGQSALAPG* |
| Ga0074046_103513121 | 3300010339 | Bog Forest Soil | DLFAALRSVVGTAARRGIDAYQAIRMTLQGNSVLAPG* |
| Ga0074046_106420391 | 3300010339 | Bog Forest Soil | AAVRSVIGTAKRRGIDAYQAIRDTLQGQSALAPG* |
| Ga0074046_107007121 | 3300010339 | Bog Forest Soil | MRQHRAALFAAVRSVFGTAKRRGIDAYQAIRDTLQGQS |
| Ga0074045_100538175 | 3300010341 | Bog Forest Soil | GADLFAAIRSVVGTAARRGIDAYQAIRMTLQGKSVLAPG* |
| Ga0074045_103581741 | 3300010341 | Bog Forest Soil | DLFAALRSVVGTAARRGIDAYQAIRMTLQGKSVLAPG* |
| Ga0074045_104884022 | 3300010341 | Bog Forest Soil | MRQHRAALFAAVRSVFGTAKRRGIDAYQAIRDTLQGQSVLAPGLSS* |
| Ga0074044_104626082 | 3300010343 | Bog Forest Soil | WGADLFAAVRPVIGTAKRRGIDAYQAIRETLQGQSALAPD* |
| Ga0134128_103720002 | 3300010373 | Terrestrial Soil | FAAVRSVIGTAARRGIDAYQAIRNTLCGQSVLAPG* |
| Ga0134128_123838892 | 3300010373 | Terrestrial Soil | DLFAAVRSVIGTAARRGIDAYQAIRETLRGQSTLAPG* |
| Ga0134126_115692321 | 3300010396 | Terrestrial Soil | AALESVVGTAARRGIDAYHAILAVLSGRTVLAPG* |
| Ga0134123_123167681 | 3300010403 | Terrestrial Soil | EWAANLFAAVRSVIGTAARRNIDAYQAIQGTLRGQSALAPG* |
| Ga0150985_1110539652 | 3300012212 | Avena Fatua Rhizosphere | MTHRADLYTAVRFAVGIATKRGARAYQAIRATLQGQSVFAKG* |
| Ga0150985_1204803342 | 3300012212 | Avena Fatua Rhizosphere | GADLFAAVRSVIGTAARRGINAYRAIRDTLQGHSVLAPG* |
| Ga0150984_1116328282 | 3300012469 | Avena Fatua Rhizosphere | LCAALESVVGTAARRGIDAYHAIHAVLSGRTVLAPG* |
| Ga0164309_111446822 | 3300012984 | Soil | PDLCAAVASVVGTAARHGIDAYHAILAVLSGRTVLAPG* |
| Ga0164308_102109654 | 3300012985 | Soil | FAAVRSVVGTAARRGLDAYQAIRAVLDGETIVQPG* |
| Ga0164304_103069271 | 3300012986 | Soil | WGPDLCAAVASVVGTAARRGIDAYHAILAVLSGRTVLAPS* |
| Ga0164305_121889751 | 3300012989 | Soil | GADLFAAVRSVVGTAARRGLDAYQAIRAVLDGQSVVQPG* |
| Ga0182000_100824162 | 3300014487 | Soil | STWGADLYAAVRSVIGTAARRGIGAYQAIRTTLQGQSVLAPS* |
| Ga0182013_100980563 | 3300014492 | Bog | FAAIKSVIGTAARNGINAYAAILTTLRGASVLQAG* |
| Ga0182016_100134289 | 3300014493 | Bog | DLFAAVKSVIGTAARTGIDAYAAILNTLRGQSVLQVG* |
| Ga0182015_106662744 | 3300014495 | Palsa | FAGVRSVVGTAARRGKDAYQAILAVLDGESVIQPG* |
| Ga0182012_106404782 | 3300014499 | Bog | DLFAAVRSVVGTAARRGIDAYHAIRAVLDGESVIQPG* |
| Ga0182012_108434701 | 3300014499 | Bog | LFAAVRSVVGTAARRGIDAYHAIRAVLDGESVIQPG* |
| Ga0182030_116405461 | 3300014838 | Bog | DLFAAVRSVIGTAARREIDAYQALRAVLRGESVILPG* |
| Ga0167624_10265003 | 3300015083 | Glacier Forefield Soil | ADLFAAVRSIIGTAKRRGIDAYQAILNTLQGQSTLAPG* |
| Ga0167627_11362693 | 3300015196 | Glacier Forefield Soil | ADFYAGIRSVIGTAKRHGMDAYQAIKATLCGQTILPVG* |
| Ga0134089_105483012 | 3300015358 | Grasslands Soil | DLCAAVASVVGTAARRGVDAYHAIHAVLSGRTVLAPS* |
| Ga0187767_102795042 | 3300017999 | Tropical Peatland | ADLFAAVRSVVGTAARHGADAYQAIHAILGGSSVLKGG |
| Ga0190275_118724562 | 3300018432 | Soil | ADLYAAVRAVIGTAARRGIDAYQAIRTTLQGQSVIAPG |
| Ga0066669_117024811 | 3300018482 | Grasslands Soil | ADLFAAVRSIIGTAARRGIDAYQAIRQTLRGQSILEPG |
| Ga0193603_10341121 | 3300018894 | Soil | GADLYAAVRSVIGTAARRGIDAYQAIRATLQGQSVLAPG |
| Ga0193605_11341003 | 3300018984 | Soil | GADLYAAVRSVIGTAARRGIDAYRAIRATLQGQSVLAPG |
| Ga0190267_100060001 | 3300019767 | Soil | WGADLFAAVRSVIGTAARRGINAYQAIRDTLQGHSVLAPRLSRYHPA |
| Ga0210407_107253352 | 3300020579 | Soil | AELFANVRSVVGTAARHGTDAFHAIRGVLRGASVLQPG |
| Ga0210405_104066811 | 3300021171 | Soil | RWGADLFADIRSVLGTTTQRGLDAYQAILAILRGGSVLQAG |
| Ga0210396_101448793 | 3300021180 | Soil | DLFANVRSVIGTAARRGIDAFHAVRYVLRGATVLMPG |
| Ga0213877_100511591 | 3300021372 | Bulk Soil | ADLFAAIRSVIGTAARRGIDAYQAIRMTLQGQSVLAPG |
| Ga0210383_111493311 | 3300021407 | Soil | WGADLFAGVRSVIGTAARQGKDAYQAILAVLDGELAIQPG |
| Ga0210391_105121262 | 3300021433 | Soil | NLFADIRSVLGTAARQGINAYQAILAILRGGSVLQAG |
| Ga0210391_112219672 | 3300021433 | Soil | DLFAGVRSVIGTAARQGKDAYQAILAVLDGESAIQPG |
| Ga0213871_100499012 | 3300021441 | Rhizosphere | VRENPKWGANCFATVRSIIGTAARRGIDAYQAIKMVLQGKPVLAST |
| Ga0210390_110209781 | 3300021474 | Soil | GADLFANVRSVIGTAARRGIDAFHAVRYVLRGATVLMPG |
| Ga0224529_10526511 | 3300023247 | Soil | FHPLAAVRSVIGTAARRGIDAYQAISMTLRGQSVLAPG |
| Ga0196960_100328853 | 3300024426 | Soil | GADLYAAVRSVIGTATRRSTDAYQAIRATLQGQSILAPG |
| Ga0208610_1070533 | 3300025493 | Serpentinite Rock And Fluid | ADLYAAARSVIGTAARRGIDAFQAIRAILQGNSILAPG |
| Ga0207950_1013891 | 3300025511 | Serpentinite Rock And Fluid | LYAAARSVIGTAARRGIDAFQAIRAILQGNSILAPG |
| Ga0207663_102164932 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLFAAVRSVVGTAARHGADDYQAIHAILGGSSVLKGG |
| Ga0207652_114135492 | 3300025921 | Corn Rhizosphere | ADLFAAVRSVIGTAARRGIDAYQAIRNTLCGQPVLAPG |
| Ga0207664_108292702 | 3300025929 | Agricultural Soil | ADLFAAVRSIIGTAARRGIDAYQAIHQTLRRQSILEPG |
| Ga0207661_112083773 | 3300025944 | Corn Rhizosphere | PDLCAAVSSVVGTAARRGTDAYHAIHAVLSGRTVLAPG |
| Ga0209656_100349711 | 3300027812 | Bog Forest Soil | ADLFAAVRSVIGTAKRRGIDAYQAIRDTLQGQSALAPG |
| Ga0209656_101214211 | 3300027812 | Bog Forest Soil | LFAAVRSVIGTAKRRGIDAYQAIRDTLQGQSALAPG |
| Ga0209656_101361151 | 3300027812 | Bog Forest Soil | ADLFAAVRSVVGTAKRRGIDAYQAIRDTLQGQSGLAPG |
| Ga0209726_102039212 | 3300027815 | Groundwater | ADLFAGVRSVIGTAARRGVDAFQAIRATLRGEPLLAPG |
| Ga0209040_1000101226 | 3300027824 | Bog Forest Soil | WGADLFAALRSIVGTAARRGIDAYQAIRMTLQGKSVLAPG |
| Ga0207433_100054021 | 3300027863 | Hot Spring | ADLFAGFRSVVGTAARRGIDAYQAIKMTLQGKSVLAPG |
| Ga0207433_102129632 | 3300027863 | Hot Spring | PDLFAGFRSVVGTAARRGIDAYQAIKMTLQGKSVLAPG |
| Ga0256305_11219111 | 3300028108 | Freshwater | DRFAAARSVIGTAARRGVDAYRAIRATLQGTSVLDPG |
| Ga0302145_100419602 | 3300028565 | Bog | FAAIRSVIGTAARRGIDAYEAIRMTLQGQSVLAPA |
| Ga0302147_100139751 | 3300028566 | Bog | ADLFAAVKSVIGTAARTGIDAYAAILNTLRGQSVLQVG |
| Ga0302147_100248593 | 3300028566 | Bog | ADLFAAIKSVIGTAARNGINAYAAILTTLRGASVLQAG |
| Ga0307279_101118691 | 3300028709 | Soil | FAAVRSIIGTATRRGIDAYQAVKMVLQGQSVLAPP |
| Ga0302220_103476231 | 3300028742 | Palsa | AELFAAVRSVIGTATRHGSDAYQAIRDTLRGQSTLEPG |
| Ga0302267_1000021464 | 3300028745 | Bog | ADLFAAVKSVIGTAARTGIDAYAAIINTLRGSSVLQPG |
| Ga0307316_103475751 | 3300028755 | Soil | FFAAVRSIIGTATRRGIDAYQAVKMVLQGQSVLAPP |
| Ga0302231_102575511 | 3300028775 | Palsa | ELFAAVRSVIGTATRHGSDAYQAIRDTLRGQSALEPG |
| Ga0302232_102391711 | 3300028789 | Palsa | AELFAAVRSVIGTATRHGSDAYQAIRDTLRGQSALEPG |
| Ga0302157_104591031 | 3300028813 | Bog | ADLFAAVRSVIGTAKRRGIDAYQAIHDTLRGQSALAPG |
| Ga0311327_101699991 | 3300029883 | Bog | DLFAAVKSVIGTAARTGIDAYAAILNTLRGQSVPQVG |
| Ga0311361_101500605 | 3300029911 | Bog | LFAAIKSVIGTAARNGINAYAAILTTLRGASVLQAG |
| Ga0311326_101608011 | 3300029917 | Bog | LFAAVKSVIGTAARTGIDAYAAILNTLRGQSVLQVG |
| Ga0311363_101102171 | 3300029922 | Fen | CFRSVWGANLFAAIRSVIGTAARRGIDAYEAIRMTLQGQSVLAPA |
| Ga0311371_102185213 | 3300029951 | Palsa | LFAAVHSVIGTAARRGIDAYQPIRDTLRRQSTLAPG |
| Ga0311371_118629862 | 3300029951 | Palsa | ELFAAVRSVIGTATRHGSDAYQAIRDTLRGQSTLEPG |
| Ga0311343_1001997912 | 3300029953 | Bog | FAAVKSVIGTAARTGIDAYAAILNTLRGQSVLQVG |
| Ga0311343_1002124615 | 3300029953 | Bog | LFAAVKSVIGTAARTGIDAYAAILNTLRGQSVPQVG |
| Ga0311331_102698041 | 3300029954 | Bog | SDLFAAFRSVVGTAGRRGIGAYQAIRMTLQGKSVLAPG |
| Ga0302280_10038351 | 3300029985 | Fen | FAAVKSVIGTAARTGIDAYAAIINTLRGSSVLQPG |
| Ga0311370_117053282 | 3300030503 | Palsa | FAAVRSVIGTATRHGSDAYQAIRDTLRGQSALEPG |
| Ga0272420_10737921 | 3300030517 | Rock | LYAAVRSVIGTAARRGVDAYTAIQQTLRGQTEPYPG |
| Ga0272436_100057359 | 3300030523 | Rock | DLFAAVRSVIGTAKRRGIDAYQAILATLQGQAATAPG |
| Ga0272436_100112944 | 3300030523 | Rock | KDLFAAFRSVVGTAGRRGINAYQAVRMTLSDQSVLQQG |
| Ga0272436_100155544 | 3300030523 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLRGQATSPPG |
| Ga0272436_10032841 | 3300030523 | Rock | FAGVRSVIGTAARRGVGAYQAIQQTLRGQDALYPG |
| Ga0272436_10169611 | 3300030523 | Rock | ADLFAGVRSVIGTAARRGVGAYQAIQQTLRGQDALYPG |
| Ga0272436_10507971 | 3300030523 | Rock | DLFAGVRSVIGTAARRGVSAYQAIQQTLRGQATSPPG |
| Ga0272436_10547731 | 3300030523 | Rock | ADLFAGVRSVIGTAARRGAGAYQAIQQTLRGQAITYPG |
| Ga0272436_10576901 | 3300030523 | Rock | LFAAFRSVVGTAGRRGINAYQAVRMTLSDQSVLQQG |
| Ga0272436_11392401 | 3300030523 | Rock | ADLYAAVRSVIGTAARRGVDAYTAIQQTLRGQTAPYPG |
| Ga0302314_100660221 | 3300030906 | Palsa | EQLPELFAAVRSVIGTATRHGSDAYQAIRDTLRGQSALEPG |
| Ga0308201_100293182 | 3300031091 | Soil | MTYRADLCAAVRSIVGTATRHGANAYQAIRATLQGQSVLAKS |
| Ga0308204_103413182 | 3300031092 | Soil | RSVWGANFFAAVRSIIGTATRRGIDAYQAVKMVLQGQSVLAPP |
| Ga0308181_10208642 | 3300031099 | Soil | MTFRADLRAAVRSVVGTATRRGANAYQAIRAALQGQSVLAKS |
| Ga0302325_130695222 | 3300031234 | Palsa | LFAAVRSVIGTATRHGSDAYQAIRDTLRGQSTLEPG |
| Ga0272435_10057711 | 3300031447 | Rock | YAAVRSVIGTAARRGADAYQAIRATLQGQAVLAPG |
| Ga0272435_10059101 | 3300031447 | Rock | DLYAAVRSVIGTAARRGVDAYTAIQQTLRGQTEPYPG |
| Ga0272435_100677713 | 3300031447 | Rock | CAGVRSVIGTAARRGVSAYQAIQQTLRGPAAPYPG |
| Ga0272435_10170541 | 3300031447 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLRGPAAPYPG |
| Ga0272435_10305091 | 3300031447 | Rock | DLFAGVRSVIGTAARRGVSAYQAIQQTLRGPAAPYPG |
| Ga0272435_10314741 | 3300031447 | Rock | DLFAGVRSVIGTAARRGVGAYQAIQQTLRGQDALYPG |
| Ga0272435_10361943 | 3300031447 | Rock | FAGVRSVIGTAARRGVSAYQAIQQTLRGPAAPYPG |
| Ga0272435_10822081 | 3300031447 | Rock | ADLYAAVRSVIGTAARRGVDAYTAIQQTLRGQTEPYPG |
| Ga0272438_1000058136 | 3300031448 | Rock | ADFYAGFRSVIGTAKRHDIDAYQAITTTLRGQTVLQTG |
| Ga0272438_100064458 | 3300031448 | Rock | RWGADFYAGFRSVIGTAKRHDIDAYQAITTTLRGQTVLQTG |
| Ga0272438_10186851 | 3300031448 | Rock | ANLYAAIRSVIGTAKRRGIDAYQAIKATLSRQTVCAPG |
| Ga0272438_11169851 | 3300031448 | Rock | LFAGVRSVIGTAARRGVGAYQAIQQTLRGQDALYPG |
| Ga0272429_13021461 | 3300031449 | Rock | KDLFAAFRSVVGTAGRRGINAYQAVRMTLSGQSVLLPG |
| Ga0272433_100444771 | 3300031450 | Rock | ADLFSGVRSVIGTAARRGVGAYQAIQQTLRGQAATYPG |
| Ga0272433_101441591 | 3300031450 | Rock | FAAVRSVIGTAKRRGIDAYQAILATLQGQAATAPG |
| Ga0272433_101725324 | 3300031450 | Rock | SVWGADLFAAVRSVIGTAKRRGIDAYQAILATLQGQAATAPG |
| Ga0272433_101818362 | 3300031450 | Rock | LFASVRSVIGTAARRGVGAYQAIQQTLRGQASFYPG |
| Ga0272433_103918431 | 3300031450 | Rock | ADLFAGVRSVIGTAARRGMGAYQAIQQTLRGQAVSQPG |
| Ga0272433_104466261 | 3300031450 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLRGQATPYPG |
| Ga0272426_100137051 | 3300031451 | Rock | ADLFASVRSVIGTAARRGVGAYQAIQQTLRGQASFYPG |
| Ga0272426_10223631 | 3300031451 | Rock | DLFAGVRSVIGTAARRGVGAYQAIQQTLRGQAAPYPG |
| Ga0272426_12083531 | 3300031451 | Rock | DLFAGVRSVIGTAARRGVSAYQAIQQTLRGQATPYPG |
| Ga0272422_10827793 | 3300031452 | Rock | FAGVRSVIGTAARRGAGAYQAIQQTLRGQAITYPG |
| Ga0272422_10939161 | 3300031452 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLRGQAAIYPG |
| Ga0272427_10443443 | 3300031454 | Rock | FAGVRSVIGTAARRGIGAYQAIQQTLRGQAAIYPG |
| Ga0272427_10968972 | 3300031454 | Rock | VWGANLFAAVRSVIGTASRQGINAYQAIRDTLAGQQHAAPG |
| Ga0272427_11688572 | 3300031454 | Rock | LFAGVRSVIGTAARRGIGAYQAIQQTLRGQAAIYPG |
| Ga0272432_101184610 | 3300031470 | Rock | ADFYAGIRSVIGTAKRRGIDAYQAITATLRGHSVLWVG |
| Ga0272439_10272976 | 3300031471 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLREQAATNPG |
| Ga0272437_100058174 | 3300031472 | Rock | NLYAAIRSVIGTAKRRGIDAYQAIKATLSGQTVCTPG |
| Ga0272437_10062781 | 3300031472 | Rock | YAGICSVIGTAARQGVSAYQAIQQTLRGQTAPYPG |
| Ga0272437_100676813 | 3300031472 | Rock | ANLYAAIRSVIGTAKRRGIDAYQAIKATLSGQTVCTPG |
| Ga0272437_10112431 | 3300031472 | Rock | LFAGVRSVIGTAARRGVGAYQAIQQTLRGQAAPYPG |
| Ga0272437_11069873 | 3300031472 | Rock | WGADLFVGVRSVIGTAARRGESAYQAIQQTLRGQAVSHPG |
| Ga0272437_11203863 | 3300031472 | Rock | DLFAGLRSVIATAARRGESAYQAIQQTLRGQVVSQPG |
| Ga0272437_11383683 | 3300031472 | Rock | ADLFAGVRSVIGTAARRGVGAYQAIQQTLRGQAAINPG |
| Ga0272437_11523003 | 3300031472 | Rock | DLFVGVRSVIGTAARRGESAYQAIQQTLRGQAVSHPG |
| Ga0272437_11759341 | 3300031472 | Rock | FAGVRSVIGTAARRGVGAYQAIQQTLRGQAAINPG |
| Ga0272437_12300731 | 3300031472 | Rock | ADLFAGVRSVIGTAARRGVGAYQVIQQTLRRQAVPYPG |
| Ga0272437_13195313 | 3300031472 | Rock | DLFAGVRSVIGTAARRGVGAYQAIQQTLRGQAAINPG |
| Ga0272437_14119461 | 3300031472 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLRGQATSSPG |
| Ga0272434_11290131 | 3300031473 | Rock | LYAAVRSVIGTAARRGADAYQAIRATLQGQAVLAPG |
| Ga0272434_11669241 | 3300031473 | Rock | ADLFAGVRSVIGTAARRGVGAYQAIQQTLRGQAGTYPG |
| Ga0272434_11987551 | 3300031473 | Rock | STWGADLYAAVRSVIGTAARRGADAYPAIRATLQGQAVLAPG |
| Ga0272428_10065581 | 3300031520 | Rock | ADLFAGVRSVIGTAARRGVGAYQAIQQTLRGQAATYPG |
| Ga0272428_100902312 | 3300031520 | Rock | DRGADLFAGVRSVIGTAARRGVGAHQAIQQTLRGQDATYPG |
| Ga0272428_101228014 | 3300031520 | Rock | DWGADLYAGICSVIGTAARQGVSAYQAIQQTLRGQTAPYPG |
| Ga0272428_10197035 | 3300031520 | Rock | DLYAGICSVIGTAARQGVSAYQAIQQTLRGQTAPYPG |
| Ga0272428_10216977 | 3300031520 | Rock | DLFAGVRSVIGTAARRGVGAYQAIQQTLRGQAATYPG |
| Ga0272428_10327438 | 3300031520 | Rock | ADLYAGICSVIGTAARQGVSAYQAIQQTLRGQTAPYPG |
| Ga0272428_10366166 | 3300031520 | Rock | ADLFAGVRSVIGTAARCGVGAYQAIQQTLRGQAATYPG |
| Ga0272428_10587161 | 3300031520 | Rock | FAAFRSIVGTAARRGIDAYQAVQMTLSGQSVLAPG |
| Ga0272428_10600014 | 3300031520 | Rock | YAAVRSVIGTAARRGVDAYTAIQQTLRGQTEPYPG |
| Ga0272428_10951665 | 3300031520 | Rock | LFAAVRSVIGTAARRGVDAYTALLATLRGHTEFEPG |
| Ga0272428_10969122 | 3300031520 | Rock | DLFAAIRSVIGTAARHGIDAYQAIRMTLQGQSVLARG |
| Ga0272428_11349541 | 3300031520 | Rock | KDLFAAFRSIVGTAARRGIDAYQAVQMTLSGQSVLAPG |
| Ga0272428_11782981 | 3300031520 | Rock | ADLFAAIRSVIGTAARHGIDAYQAIRMTLQGQSVLARG |
| Ga0272428_12027251 | 3300031520 | Rock | FAGVRSVIGTAARRGVSAYQAIQQTLRGQATSSPG |
| Ga0272428_12901871 | 3300031520 | Rock | ADLFAAVRSVIGTAARRGVDAYTALLATLRGHTEFEPG |
| Ga0272428_14029772 | 3300031520 | Rock | LFAAIRSVIGTAARHGIDAYQAIRMTLQGQSVLARG |
| Ga0318573_105432201 | 3300031564 | Soil | ADLFAAVRSVVGTAARHGSDAYQAIHTILGGASVLQGG |
| Ga0310686_1078444673 | 3300031708 | Soil | FADIRSVLGTATRRGIDAYQAILAILRGGSVLQAG |
| Ga0310686_1118312483 | 3300031708 | Soil | ADLFAGVRSVVGTAARRGKDAYRAILAVLDGESVIQPG |
| Ga0310686_1173303621 | 3300031708 | Soil | DLFADIRSVLGTATRRGIDAYQAILAILRGGSVLQAG |
| Ga0307476_109205771 | 3300031715 | Hardwood Forest Soil | WGADLFAAVRSVIGTAKRCGIDAYRAIRDALQGQSAPAPG |
| Ga0310907_100526981 | 3300031847 | Soil | PDLCAAVQSVVGTAARRGIDAYHAIHAVLSGRTVLAPG |
| Ga0307406_110051071 | 3300031901 | Rhizosphere | DLCAAVQSVVGTAARRGIDAYHAIHAVLSGRTVLAPS |
| Ga0272421_11039021 | 3300031909 | Rock | ADLYAAVRSVIGTAARRGVDAYTAIQQTLRGRTAPYPG |
| Ga0308175_1004553683 | 3300031938 | Soil | GADLFAAVRSVIGTAARRGIDAYQAIRNTLCGQHVLAPG |
| Ga0308175_1020612821 | 3300031938 | Soil | PDLCAAIKSVVGTAARRGIDAYHAILAVLSGRTVLDAG |
| Ga0308176_116187111 | 3300031996 | Soil | DLFAAVRSVIGTAARRGIDAYQAIRNTLCGQHVLAPG |
| Ga0308176_119913972 | 3300031996 | Soil | LCAAVASVVGTAARRGIDAYHAIHAVLSGRTVLAPG |
| Ga0308173_100796941 | 3300032074 | Soil | DLFAAVRSVIGTAARRGIDAYQAIRNTLCGQSVLAPG |
| Ga0307415_1013555902 | 3300032126 | Rhizosphere | DLCAAVQSAVGTAARRGIDAYHAIHAVLSGRTVLAPS |
| Ga0272424_10148101 | 3300032162 | Rock | ADLFAGVRSVIGTAARRGIGAYQAIQQTLRGQAAIYPG |
| Ga0272424_10307285 | 3300032162 | Rock | ADFYAGIRSVIGTAKRRGIDAYQAITATLRGQSVLSAG |
| Ga0272424_10454481 | 3300032162 | Rock | GADFHAGIRSVIGTAKRRGIDAYQAIAATLRGQTVRPVG |
| Ga0272424_11163804 | 3300032162 | Rock | GAEFYAGVRSVIGTAKRRGTDAYQAINAALRGQTGLQAG |
| Ga0272424_12684601 | 3300032162 | Rock | ADLFAGVRSVIGTAARRGMGAYQAIQQTLRGQASSYPG |
| Ga0272424_13071781 | 3300032162 | Rock | ADLFAGVRSVIGTAARRGMGAYHAIQQTLRGQAAPYPG |
| Ga0335081_126449732 | 3300032892 | Soil | LQIAVGCGEVFANVRSVVGTAARCGTDAYHAIRSVSRGASVLQTG |
| Ga0335074_108924941 | 3300032895 | Soil | ADLFADIRSVVGTAARHGIDAYQAIRAVLCGQSVLQGG |
| Ga0272423_10851401 | 3300033168 | Rock | ADLFAGVRSVIGTAARRGVSAYQAIQQTLRGQAATYPG |
| Ga0272423_10969631 | 3300033168 | Rock | LFAGVRSVIGTAARRGVGAYQAIQQTLRGQAATYPG |
| Ga0272423_11789052 | 3300033168 | Rock | FAGVRSVIGTAARRGVGAYQAIQQTLRGQAATYPG |
| Ga0272423_12970121 | 3300033168 | Rock | FAGVRSVIGTAARRGVSAYQAIQQTLRGQAATYPG |
| Ga0272423_13190771 | 3300033168 | Rock | ADLSVGVRSVIGTAARRGVGAYQAIQQTLRGQAATYPG |
| Ga0272431_101091313 | 3300033181 | Rock | FAAFRSVVGTAARRGIDAYQAVRMTLSGQSVLAPG |
| Ga0272431_101135861 | 3300033181 | Rock | LFAGVRSVIGTAARRGVGAYQAIQQTLRGQATPYPG |
| Ga0326728_100289431 | 3300033402 | Peat Soil | ADLFAGVRSVVGTAARRGLDAYQAIYEVLGGDSVVQPG |
| Ga0326727_103416051 | 3300033405 | Peat Soil | ADLFAGVRSVVGTAARRGIDAFQAIRTVLRGGAVPQAG |
| Ga0371489_0253798_1_114 | 3300033755 | Peat Soil | DLFAGVRSVVGTAARRGLDAYQAIYEVLGGDSVVQPG |
| Ga0334919_047174_1_117 | 3300034001 | Hypolithic Biocrust | PDLGAAVASVVGTAARRGIDAYHAIHAVLSGRTVLAPS |
| Ga0334926_075120_2_118 | 3300034004 | Hypolithic Biocrust | ADLYAAVRSVIGTDAPRGIGAYQAIRATLQGQSVLAPG |
| Ga0370494_144126_2_118 | 3300034130 | Untreated Peat Soil | SDLFAGFRSVVGTASRRGIGAYQAIKMTLQGKSVLAPG |
| Ga0334956_039735_1_117 | 3300034139 | Biocrust | ADLFAAVRSVIGTAARRGINAYRAIRDTLQGHSVLAPG |
| Ga0370510_0297915_403_510 | 3300034160 | Untreated Peat Soil | AVRSIIGTASRRGIDAYQAIKMVLQGQSVLAAAAE |
| Ga0370503_0037261_143_265 | 3300034196 | Untreated Peat Soil | LGAILYAAVRSVIGTAAQRGINAYQAIGMILQGQSVLAAG |
| Ga0334947_135073_1_117 | 3300034251 | Sub-Biocrust Soil | ANLYAAVRSVIGTAARRGIDAYQAIRAILQGRSVLAPG |
| Ga0372943_0078294_2_118 | 3300034268 | Soil | PHLCAAVKSVVGTAARQGIDAYHAIHAVLSGATVLSPG |
| Ga0372943_0084932_1_117 | 3300034268 | Soil | ADLFAAVRSVIGTAKRRGLDAYQAIRNTLQVQSALAPG |
| Ga0372943_0271736_439_567 | 3300034268 | Soil | MTHRADLYTAVRFAVGIATKRGARAYQAIRATLQGQSVFAKG |
| ⦗Top⦘ |