


| Basic Information | |
|---|---|
| Family ID | F022690 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 213 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVSHLFFYQLVLIALVWLCLMLQWAWPSDPAACPTTPEPP |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 213 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.06 % |
| % of genes near scaffold ends (potentially truncated) | 84.04 % |
| % of genes from short scaffolds (< 2000 bps) | 88.26 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.404 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.005 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.108 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.070 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 213 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 2.35 |
| PF01656 | CbiA | 1.88 |
| PF02371 | Transposase_20 | 1.88 |
| PF00872 | Transposase_mut | 1.41 |
| PF02738 | MoCoBD_1 | 1.41 |
| PF03400 | DDE_Tnp_IS1 | 1.41 |
| PF14104 | DUF4277 | 0.94 |
| PF12263 | DUF3611 | 0.94 |
| PF01381 | HTH_3 | 0.94 |
| PF00296 | Bac_luciferase | 0.94 |
| PF13751 | DDE_Tnp_1_6 | 0.94 |
| PF13669 | Glyoxalase_4 | 0.94 |
| PF12759 | HTH_Tnp_IS1 | 0.94 |
| PF13408 | Zn_ribbon_recom | 0.47 |
| PF00106 | adh_short | 0.47 |
| PF02627 | CMD | 0.47 |
| PF13561 | adh_short_C2 | 0.47 |
| PF00496 | SBP_bac_5 | 0.47 |
| PF03524 | CagX | 0.47 |
| PF02450 | LCAT | 0.47 |
| PF01844 | HNH | 0.47 |
| PF03050 | DDE_Tnp_IS66 | 0.47 |
| PF01402 | RHH_1 | 0.47 |
| PF13701 | DDE_Tnp_1_4 | 0.47 |
| PF01751 | Toprim | 0.47 |
| PF00665 | rve | 0.47 |
| PF00117 | GATase | 0.47 |
| PF00656 | Peptidase_C14 | 0.47 |
| PF02515 | CoA_transf_3 | 0.47 |
| PF13005 | zf-IS66 | 0.47 |
| PF00248 | Aldo_ket_red | 0.47 |
| PF00239 | Resolvase | 0.47 |
| PF13436 | Gly-zipper_OmpA | 0.47 |
| PF13546 | DDE_5 | 0.47 |
| PF01526 | DDE_Tnp_Tn3 | 0.47 |
| PF09859 | Oxygenase-NA | 0.47 |
| PF12762 | DDE_Tnp_IS1595 | 0.47 |
| PF01610 | DDE_Tnp_ISL3 | 0.47 |
| PF11716 | MDMPI_N | 0.47 |
| PF12840 | HTH_20 | 0.47 |
| PF02687 | FtsX | 0.47 |
| PF10551 | MULE | 0.47 |
| PF02810 | SEC-C | 0.47 |
| PF07690 | MFS_1 | 0.47 |
| PF00857 | Isochorismatase | 0.47 |
| PF13442 | Cytochrome_CBB3 | 0.47 |
| PF02781 | G6PD_C | 0.47 |
| PF10604 | Polyketide_cyc2 | 0.47 |
| PF01051 | Rep_3 | 0.47 |
| PF13411 | MerR_1 | 0.47 |
| PF07885 | Ion_trans_2 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 213 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.35 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.35 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.35 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.35 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.35 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.35 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.88 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.41 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.41 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.94 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.47 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.47 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.47 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.47 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.47 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.47 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.47 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.47 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.47 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG3504 | Type IV secretory pathway, VirB9 components | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.47 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.47 |
| COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.87 % |
| Unclassified | root | N/A | 21.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_11171603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300000890|JGI11643J12802_10151178 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300000890|JGI11643J12802_12075162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300000955|JGI1027J12803_102732052 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300004463|Ga0063356_100316470 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300004633|Ga0066395_10329121 | Not Available | 843 | Open in IMG/M |
| 3300005179|Ga0066684_10080188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1954 | Open in IMG/M |
| 3300005294|Ga0065705_10108115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5336 | Open in IMG/M |
| 3300005294|Ga0065705_11048971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 535 | Open in IMG/M |
| 3300005295|Ga0065707_10171276 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300005332|Ga0066388_103557814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300005332|Ga0066388_104162231 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005332|Ga0066388_106949193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300005436|Ga0070713_101900025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300005447|Ga0066689_10438276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. LC5 | 819 | Open in IMG/M |
| 3300005457|Ga0070662_100605380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 922 | Open in IMG/M |
| 3300005471|Ga0070698_100637403 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005471|Ga0070698_100741718 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005552|Ga0066701_10038575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2548 | Open in IMG/M |
| 3300005553|Ga0066695_10705735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300005554|Ga0066661_10540520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300005555|Ga0066692_10394398 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005555|Ga0066692_10562608 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005555|Ga0066692_10908140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300005719|Ga0068861_100136265 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300005764|Ga0066903_100262431 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 2682 | Open in IMG/M |
| 3300005764|Ga0066903_104907058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300005764|Ga0066903_107485122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300005937|Ga0081455_10009749 | All Organisms → cellular organisms → Bacteria | 9837 | Open in IMG/M |
| 3300005937|Ga0081455_10022229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5933 | Open in IMG/M |
| 3300006049|Ga0075417_10059849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
| 3300006196|Ga0075422_10030974 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300006237|Ga0097621_101516767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300006796|Ga0066665_11451521 | Not Available | 533 | Open in IMG/M |
| 3300006797|Ga0066659_11767889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → Candidatus Oscillochloris fontis | 522 | Open in IMG/M |
| 3300006845|Ga0075421_100014703 | All Organisms → cellular organisms → Bacteria | 9766 | Open in IMG/M |
| 3300006846|Ga0075430_100791295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 782 | Open in IMG/M |
| 3300006847|Ga0075431_102208646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300006852|Ga0075433_10191821 | Not Available | 1817 | Open in IMG/M |
| 3300006904|Ga0075424_102283468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300006904|Ga0075424_102417489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300006969|Ga0075419_10313183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1060 | Open in IMG/M |
| 3300007076|Ga0075435_101583180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300007076|Ga0075435_101730376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300007255|Ga0099791_10377357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300007265|Ga0099794_10154132 | Not Available | 1167 | Open in IMG/M |
| 3300009012|Ga0066710_100756508 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300009012|Ga0066710_101199428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300009012|Ga0066710_102355292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300009012|Ga0066710_103051572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300009012|Ga0066710_103700638 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 575 | Open in IMG/M |
| 3300009038|Ga0099829_10476133 | Not Available | 1036 | Open in IMG/M |
| 3300009090|Ga0099827_10034269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3697 | Open in IMG/M |
| 3300009090|Ga0099827_10070866 | Not Available | 2690 | Open in IMG/M |
| 3300009090|Ga0099827_10145814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1933 | Open in IMG/M |
| 3300009090|Ga0099827_11271310 | Not Available | 640 | Open in IMG/M |
| 3300009090|Ga0099827_11435357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300009094|Ga0111539_11223967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300009094|Ga0111539_12866363 | Not Available | 558 | Open in IMG/M |
| 3300009094|Ga0111539_13402279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300009137|Ga0066709_103630112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300009147|Ga0114129_10741243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1258 | Open in IMG/M |
| 3300009147|Ga0114129_10789429 | Not Available | 1212 | Open in IMG/M |
| 3300009162|Ga0075423_12986599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300009553|Ga0105249_10995934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300009553|Ga0105249_12093435 | Not Available | 639 | Open in IMG/M |
| 3300009836|Ga0105068_1008898 | Not Available | 1608 | Open in IMG/M |
| 3300009837|Ga0105058_1056380 | Not Available | 885 | Open in IMG/M |
| 3300010043|Ga0126380_10732947 | Not Available | 799 | Open in IMG/M |
| 3300010043|Ga0126380_11277403 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010043|Ga0126380_12071741 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 522 | Open in IMG/M |
| 3300010047|Ga0126382_10965277 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 744 | Open in IMG/M |
| 3300010047|Ga0126382_11461737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300010048|Ga0126373_10416849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1371 | Open in IMG/M |
| 3300010336|Ga0134071_10283537 | Not Available | 830 | Open in IMG/M |
| 3300010358|Ga0126370_11157167 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 717 | Open in IMG/M |
| 3300010358|Ga0126370_11214008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300010358|Ga0126370_12380058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300010359|Ga0126376_11028687 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010359|Ga0126376_12101253 | Not Available | 608 | Open in IMG/M |
| 3300010359|Ga0126376_12201446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 596 | Open in IMG/M |
| 3300010360|Ga0126372_10490229 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300010360|Ga0126372_10979794 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300010360|Ga0126372_12544429 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 563 | Open in IMG/M |
| 3300010361|Ga0126378_10957809 | Not Available | 961 | Open in IMG/M |
| 3300010361|Ga0126378_11513117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300010361|Ga0126378_13080002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010362|Ga0126377_10312754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1553 | Open in IMG/M |
| 3300010362|Ga0126377_12319760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300010366|Ga0126379_10487035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1302 | Open in IMG/M |
| 3300010366|Ga0126379_10578676 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300010366|Ga0126379_11923572 | Not Available | 695 | Open in IMG/M |
| 3300010398|Ga0126383_10151153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2166 | Open in IMG/M |
| 3300010398|Ga0126383_10902085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300010398|Ga0126383_11234371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300010398|Ga0126383_12293335 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010863|Ga0124850_1140523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300011271|Ga0137393_10221250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1602 | Open in IMG/M |
| 3300011271|Ga0137393_11026264 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012096|Ga0137389_10931286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 745 | Open in IMG/M |
| 3300012189|Ga0137388_11842243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300012198|Ga0137364_10594372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 834 | Open in IMG/M |
| 3300012199|Ga0137383_10034931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_3_um_filter_54_28 | 3552 | Open in IMG/M |
| 3300012199|Ga0137383_10943952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300012201|Ga0137365_10532071 | Not Available | 863 | Open in IMG/M |
| 3300012206|Ga0137380_11202706 | Not Available | 643 | Open in IMG/M |
| 3300012206|Ga0137380_11555439 | Not Available | 546 | Open in IMG/M |
| 3300012207|Ga0137381_11005344 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012207|Ga0137381_11614489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300012210|Ga0137378_10308891 | Not Available | 1471 | Open in IMG/M |
| 3300012211|Ga0137377_10122148 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300012211|Ga0137377_11469318 | Not Available | 608 | Open in IMG/M |
| 3300012349|Ga0137387_10679494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300012354|Ga0137366_11149601 | Not Available | 531 | Open in IMG/M |
| 3300012357|Ga0137384_10093045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2511 | Open in IMG/M |
| 3300012357|Ga0137384_10187417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1732 | Open in IMG/M |
| 3300012357|Ga0137384_10474448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300012360|Ga0137375_10467346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300012361|Ga0137360_11690572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012362|Ga0137361_10223857 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300012362|Ga0137361_10521308 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300012376|Ga0134032_1179080 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012469|Ga0150984_101497845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300012582|Ga0137358_10175061 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300012582|Ga0137358_10716195 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012917|Ga0137395_10612656 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 787 | Open in IMG/M |
| 3300012923|Ga0137359_10305159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1417 | Open in IMG/M |
| 3300012930|Ga0137407_10687249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 963 | Open in IMG/M |
| 3300012930|Ga0137407_11057746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 769 | Open in IMG/M |
| 3300012944|Ga0137410_10937192 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012948|Ga0126375_10574173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300012948|Ga0126375_10686615 | Not Available | 795 | Open in IMG/M |
| 3300012948|Ga0126375_11080280 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012971|Ga0126369_11059858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300012971|Ga0126369_13258620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300013306|Ga0163162_12087131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300013306|Ga0163162_12532028 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300015241|Ga0137418_10863937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300015245|Ga0137409_10731617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300015373|Ga0132257_102056743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300015374|Ga0132255_105348567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300016294|Ga0182041_10556208 | Not Available | 1002 | Open in IMG/M |
| 3300016319|Ga0182033_10960218 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300016319|Ga0182033_11698885 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300016341|Ga0182035_11379617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300016341|Ga0182035_11568123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300016371|Ga0182034_11523764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300016404|Ga0182037_10439342 | Not Available | 1083 | Open in IMG/M |
| 3300016422|Ga0182039_10613323 | Not Available | 952 | Open in IMG/M |
| 3300017659|Ga0134083_10479790 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300019360|Ga0187894_10130683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1300 | Open in IMG/M |
| 3300022195|Ga0222625_1007177 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300025936|Ga0207670_11712559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300025939|Ga0207665_10643103 | Not Available | 831 | Open in IMG/M |
| 3300025961|Ga0207712_11006402 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 740 | Open in IMG/M |
| 3300025961|Ga0207712_11055384 | Not Available | 722 | Open in IMG/M |
| 3300025972|Ga0207668_10729987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300025972|Ga0207668_11048594 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300026297|Ga0209237_1217563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300026494|Ga0257159_1033804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300026507|Ga0257165_1034169 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300027577|Ga0209874_1027377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1577 | Open in IMG/M |
| 3300027577|Ga0209874_1152034 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027646|Ga0209466_1122403 | Not Available | 529 | Open in IMG/M |
| 3300027654|Ga0209799_1089011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 699 | Open in IMG/M |
| 3300027655|Ga0209388_1093538 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300027874|Ga0209465_10251411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300027874|Ga0209465_10620436 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027875|Ga0209283_10094659 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1949 | Open in IMG/M |
| 3300027875|Ga0209283_10496747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300027882|Ga0209590_10014862 | All Organisms → cellular organisms → Bacteria | 3780 | Open in IMG/M |
| 3300027882|Ga0209590_10205003 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1247 | Open in IMG/M |
| 3300027882|Ga0209590_10336619 | Not Available | 972 | Open in IMG/M |
| 3300027882|Ga0209590_10751739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300027903|Ga0209488_10700027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300027907|Ga0207428_10688483 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300027909|Ga0209382_10022351 | All Organisms → cellular organisms → Bacteria | 7667 | Open in IMG/M |
| 3300027910|Ga0209583_10728181 | Not Available | 520 | Open in IMG/M |
| 3300027952|Ga0209889_1015313 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300027954|Ga0209859_1005476 | Not Available | 2726 | Open in IMG/M |
| 3300027961|Ga0209853_1027507 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300028590|Ga0247823_10986973 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300028828|Ga0307312_10330827 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300030903|Ga0308206_1035221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300031095|Ga0308184_1010513 | Not Available | 871 | Open in IMG/M |
| 3300031114|Ga0308187_10013678 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300031564|Ga0318573_10562392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300031573|Ga0310915_10224349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1318 | Open in IMG/M |
| 3300031573|Ga0310915_10414699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis → Nitrococcus mobilis Nb-231 | 956 | Open in IMG/M |
| 3300031744|Ga0306918_10751928 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031835|Ga0318517_10478916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031890|Ga0306925_11058339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300031896|Ga0318551_10470382 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031946|Ga0310910_11453685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031947|Ga0310909_10564374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300032064|Ga0318510_10384504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032065|Ga0318513_10314648 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 761 | Open in IMG/M |
| 3300032076|Ga0306924_10695635 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300032090|Ga0318518_10463727 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032261|Ga0306920_100814177 | Not Available | 1370 | Open in IMG/M |
| 3300032261|Ga0306920_103901517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300034672|Ga0314797_153366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300034680|Ga0370541_046670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.63% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.41% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.41% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.47% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_111716032 | 3300000858 | Soil | MVSHLFFYQLTLIVLVWLCVMLHWVWPSNSAAGCPTPLAPPPSRPKRKH |
| JGI11643J12802_101511781 | 3300000890 | Soil | MVPGLFFYQLVLIALVWLCLMLHWTWPSDPATCPMTPT |
| JGI11643J12802_120751621 | 3300000890 | Soil | MVSPLFFYQLVLVTLVWLCVMLHWVWPSDPATACPTTREPTPPLPKRH |
| JGI1027J12803_1027320523 | 3300000955 | Soil | MVSTLFFSQLVLVALVWLCVMLQWAWPSALATGPPPPAPLP |
| Ga0063356_1003164701 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVSPLFFYQLTLIALVWLCVMLHWVWPSDSAAACPTTLAPPP |
| Ga0066395_103291213 | 3300004633 | Tropical Forest Soil | MVSDLFFYQLVLVALMWLCLMLQWAWPSDTAACPTTPAPPLPKRTREP |
| Ga0066684_100801884 | 3300005179 | Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSAPTAVCPTTPEP |
| Ga0066678_102870091 | 3300005181 | Soil | MVSHLFFYQLTLIARVWRCVMLQWAWPSDSAAGPTPLASPPHSPSATVRRNSLRA |
| Ga0065705_101081153 | 3300005294 | Switchgrass Rhizosphere | MVSPLFFYRLVLIVLVWLCVMLQWAWPGDPAAAFPPPVKLQVI* |
| Ga0065705_110489713 | 3300005294 | Switchgrass Rhizosphere | MVSPLFFYQLTLIALVWLCLMLQWAWPSDLAAGCPTTPEP |
| Ga0065707_101712761 | 3300005295 | Switchgrass Rhizosphere | MVPALFFYQLLLVVLLWLCVMLHGAWPSDPATGPTTSEPTPLPPK |
| Ga0066388_1035578141 | 3300005332 | Tropical Forest Soil | MVSHLFFYQLGLIALVWLWVILHWVWPSDSATAYPTTLEPTPP |
| Ga0066388_1041622312 | 3300005332 | Tropical Forest Soil | MVSHLFFYQLMLIVLVWLCAMLQWVWPSDSVAACPPPLVPFLG* |
| Ga0066388_1069491931 | 3300005332 | Tropical Forest Soil | MVSHLFFYQLTLIVLVWLCVMLQWVWLSDSATGCPTPLAPIYARISCKS* |
| Ga0070713_1019000252 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSHLFFYQLVLIALVWLCVMLHWAWPSDPAAACPPPELPPLLPKRTR |
| Ga0066689_104382762 | 3300005447 | Soil | VSHLFFYQLTLIALVWLCLMLHWMWPSDSAACPTIPEPLP |
| Ga0070662_1006053802 | 3300005457 | Corn Rhizosphere | MVSHLFFYQLTLIALVWLCVMLQWAWPSDSAAACPTTLDPTPF* |
| Ga0070698_1006374032 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSHLFFSQLVLVALVWLCLMLQWVWPSDSVAACLTTLEPPPPRRKRSREP |
| Ga0070698_1007417182 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPDLFFYQLMLITLVWLCLMLQWMWPSAVATCPTTPELTPPVPKRNR |
| Ga0066701_100385754 | 3300005552 | Soil | MVSPLFFSQLVLVALVWLCVMLHVLWPSDPATCPTTLPPPLPKRHR |
| Ga0066695_107057352 | 3300005553 | Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSDPTAQAPP* |
| Ga0066661_105405201 | 3300005554 | Soil | MVPDLFFYPLVLVALVWLCLMLQRAWPSDRVTTPPTLP |
| Ga0066692_103943982 | 3300005555 | Soil | MVPNLFFYQLVLVALVWLCVMLHWAWPSDCAPAQLTPSQPTPPRHKRR |
| Ga0066692_105626081 | 3300005555 | Soil | MVSPLFFYQLTLIALVWLCLMLQWMWPSDSAACPTIPEPLPPLPKRKREPTP |
| Ga0066692_109081401 | 3300005555 | Soil | MVSPLFFYQLTLIALVWLCVMLQWAWPSDSAACPTPLA |
| Ga0068861_1001362651 | 3300005719 | Switchgrass Rhizosphere | MVSHLFFYPLVLIALVWLCVMLQWAWPSDPAAACPPP |
| Ga0066903_1002624315 | 3300005764 | Tropical Forest Soil | MVPALFFYQLVLLALLWLWLMLQWAWPSDSAAACPTTPELPSP |
| Ga0066903_1033021092 | 3300005764 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCVMLHWVWPSDSAAACPTILAPPTPTAEAAPCAETL* |
| Ga0066903_1049070581 | 3300005764 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSAPTAVCPTTPEPP |
| Ga0066903_1074851222 | 3300005764 | Tropical Forest Soil | MVSPLFFYQLTLIVLVWLCVMLQWVWPSDSAAECPTPL |
| Ga0081455_100097492 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVSHLFFYQLMLIALVWLCLMLQWMWPSNSAACPTIPEPLLPRPKCVFR* |
| Ga0081455_1002222910 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVSDLFFYQLMLIALVWLCLMLHGLWPSAPATCPPPPE |
| Ga0075417_100598493 | 3300006049 | Populus Rhizosphere | MVSHLFFYQLVLIALVWLCLILHGLWPSDPVAACSTTLEPLLPRRKRRREPYP |
| Ga0075422_100309743 | 3300006196 | Populus Rhizosphere | MVSHLFFYQLTLIALIWLCVMLHWAWPSDCAAAYPSTRD |
| Ga0097621_1015167672 | 3300006237 | Miscanthus Rhizosphere | MVSPLFFYQLTLIALVWLCVMLHWMWPSDSAACPTLPEPLPPRPKRTREPKPFV |
| Ga0066665_114515211 | 3300006796 | Soil | MVSHLFLYPLTLIALVWLCVMLHGVWPSDSAAACPTPLAPPPLPVSYPQILF* |
| Ga0066659_117678892 | 3300006797 | Soil | MIPALFFYQLMLVALVWLCLMLQWAWPSDRVTAQPTPPPP |
| Ga0075421_1000147031 | 3300006845 | Populus Rhizosphere | MVSPLFFYQLTLIALVWLYVMLQWAWLSDATTASPTP |
| Ga0075430_1007912952 | 3300006846 | Populus Rhizosphere | MVSHLFFYQLTLIALVWLCVLLHWAWPSDSAACPTP |
| Ga0075431_1022086461 | 3300006847 | Populus Rhizosphere | MVSHLFFYQLTLIALVWLCVMLQWVWPSDSAAACPTPLAPPPP |
| Ga0075433_101918213 | 3300006852 | Populus Rhizosphere | MVSHLFFYQLMLIALVWLCLMLQWMWPSDSAACPTIPEPL |
| Ga0075424_1022834682 | 3300006904 | Populus Rhizosphere | MVSALFFYQLMLVALVWLCVMLHWAWPSDTATYPTALEPLPPLPKRTREP |
| Ga0075424_1024174892 | 3300006904 | Populus Rhizosphere | MVSHLFFYQLTLIALVWLCLMLQWMWPSASAACPTIPEPLPPR |
| Ga0075419_103131831 | 3300006969 | Populus Rhizosphere | MVSHLFFYQLTLIALVWLCLMLQWMWPSASAACPTIPEPL |
| Ga0075435_1015831802 | 3300007076 | Populus Rhizosphere | MVSHLFFYQLVRVALVWLCLVRHWVWPSDPAAVCPTAP |
| Ga0075435_1017303761 | 3300007076 | Populus Rhizosphere | MVSPLFFYQLTLIALVWLCVMLQWAWPSDSAACPTP |
| Ga0099791_103773572 | 3300007255 | Vadose Zone Soil | MVSHLFFSQLVLVALIGLCVMLHWAWPSDPTAVCPTI |
| Ga0099794_101541322 | 3300007265 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCIMLQWAWPSDPAAVCPTAPEP |
| Ga0066710_1007565081 | 3300009012 | Grasslands Soil | MLSTLCFYQLVLVALVWRCVMPHWAWPSDPSAVCR |
| Ga0066710_1011994281 | 3300009012 | Grasslands Soil | MGSHLFFYQLVLVALVWLCVMLQWAWPSDPAAVCPTTPEPPGPR |
| Ga0066710_1023552921 | 3300009012 | Grasslands Soil | MVSPLFFYQLVLVALVWLCLILQWAWPSDTAACPPTPEPPLP |
| Ga0066710_1030515721 | 3300009012 | Grasslands Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSDPTAVCPTTPEPPP |
| Ga0066710_1037006381 | 3300009012 | Grasslands Soil | MVSHLFFYQLVLIALVWLCVMLQWAWPSDPAAAGPT |
| Ga0099829_104761332 | 3300009038 | Vadose Zone Soil | MVSPLFFYQLVLVALVWLCVMLHWAWPSDPAAVCPTTPEPPGPLPKHNRE |
| Ga0099827_100342696 | 3300009090 | Vadose Zone Soil | MVSTLFFSQLVLVALVWLYVMLQWAWPSDPAAVCPTAPEPT* |
| Ga0099827_100708666 | 3300009090 | Vadose Zone Soil | MVPNLFFYQLVLVALVWLCVMLHWAWPSDCAPAQLTPSQSTPP |
| Ga0099827_101458144 | 3300009090 | Vadose Zone Soil | VLELNFMPFGSDLFFYELVLVALVWLCVRLQWAWPSDSAAACPTTPDLPSPGPK |
| Ga0099827_112713101 | 3300009090 | Vadose Zone Soil | MVSPLFFYQLVLVALVWLCVMLHWAWPSDPAAVCPTTPEPPGPLPKH |
| Ga0099827_114353571 | 3300009090 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCLMLQWAWPSDPAAVCPTAPEPTP |
| Ga0111539_112239672 | 3300009094 | Populus Rhizosphere | MVSHLFFYQLVLVALVWLCVMLHWAWPSDPATACRTTRQPTPPRPKRD |
| Ga0111539_128663631 | 3300009094 | Populus Rhizosphere | MVPGLFFSQWVLIALVWLGLMFYGMWPSATATCLPTPEPTP |
| Ga0111539_134022792 | 3300009094 | Populus Rhizosphere | MVSDLFFYQLVLVALVWLCVMLQWAWPSDPAVVCPTTPEPPGPRPKR |
| Ga0066709_1036301121 | 3300009137 | Grasslands Soil | MVPNLFFYQVVLVALVWLCLMLQWAWPNDCATAQLTPSQPTPPRHKRRREPKPF |
| Ga0114129_103179064 | 3300009147 | Populus Rhizosphere | MVPNLFFYQLGLVALVWLCVMLQWAWPSDCATPQLTPSQ |
| Ga0114129_107412431 | 3300009147 | Populus Rhizosphere | MVSHLFFYQLTLIALVWLCLMLQWMWPSASAACPTIPEP |
| Ga0114129_107894291 | 3300009147 | Populus Rhizosphere | MRSFAMVPDLFFYQLVLIALVWLYCMLHWVWPRDSAACPMTP |
| Ga0075423_129865991 | 3300009162 | Populus Rhizosphere | MVSHLFFYQLVLIALVWLCVMLHWAWPSDTAAYPTTSEPPPPRPKRKHE |
| Ga0105249_109959342 | 3300009553 | Switchgrass Rhizosphere | MVSHLFFYPLVLIALVWLCVMLQWAWPSDPAAACPPPAE |
| Ga0105249_120934352 | 3300009553 | Switchgrass Rhizosphere | MVSHLFFSQLTLIALVWLYVMLQWAWLSDATTASP |
| Ga0105068_10088981 | 3300009836 | Groundwater Sand | MVSHLFFYQLVLIALVWLCVMLQWAWPSDPAACPTTLDPTQCHQLSVN* |
| Ga0105058_10563802 | 3300009837 | Groundwater Sand | MVSALFFYQLVLVALVWLCVMLHWAWPSDTATYPTALEPLPPLPKRKRE |
| Ga0126380_107329472 | 3300010043 | Tropical Forest Soil | MVSALCFYPLVLVALVWLCLMLYWAWPSDTRAYPTSPELPPSPRMREPSTTVVTR* |
| Ga0126380_112774032 | 3300010043 | Tropical Forest Soil | MVSHLFFYQLLLIALVWRCVMLQWVWPSAPAACPT |
| Ga0126380_120717411 | 3300010043 | Tropical Forest Soil | MVPALFFYQLTLIALVWLCLMLQWAWPSDPAVCPTTPEPPP |
| Ga0126382_109652771 | 3300010047 | Tropical Forest Soil | MVSHLFFYQLVLVALVWLCVMLHWTWPSDPTSVCPTTP |
| Ga0126382_114617371 | 3300010047 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCLMLQWAWPSDPATACPTTLEPTPPRPK |
| Ga0126373_104168493 | 3300010048 | Tropical Forest Soil | MVSTLFFYQLVLVALVWLCVMLHWAWPSDYATLCPTTPAPPCPRRKR |
| Ga0134071_102835372 | 3300010336 | Grasslands Soil | MVSHLFFYQLVLVALVWLCVMLHWAWPSDPTAVCPTTPEPPG |
| Ga0126370_111571672 | 3300010358 | Tropical Forest Soil | MVPDLFFYQLVLIALVWLCIMLQWAWPSAPAAAGPPPELPPLLPK |
| Ga0126370_112140082 | 3300010358 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSDPTAVCPTTPEP |
| Ga0126370_123800581 | 3300010358 | Tropical Forest Soil | MRAFAMVSHLFFYQLVLIALVWLCVMLHWAWPSDP |
| Ga0126376_110286871 | 3300010359 | Tropical Forest Soil | MVSALFFSQLVLMALVWLCLMLHWAWPSDPATCPTTPEPSSALPKRKREPKPF |
| Ga0126376_121012532 | 3300010359 | Tropical Forest Soil | MVSDLFFSQLLLIALLWLCVLLHWVWPSDSTTAGPTP |
| Ga0126376_122014461 | 3300010359 | Tropical Forest Soil | MVPALFFYQLLLVALIWLCVMLHWVWPSDPTLCPTPSEPTP |
| Ga0126372_104902294 | 3300010360 | Tropical Forest Soil | MVSHLFYYQLALIALVWLCLMLHWAWPSDPATCPPP |
| Ga0126372_109797941 | 3300010360 | Tropical Forest Soil | MVSHLFFYQLVLIALVWLCLMLQWAWPSDPAACPTTPEPP |
| Ga0126372_109891331 | 3300010360 | Tropical Forest Soil | MVSHLFFYQLVLVALVWLCLMLQWAWPSDRALAQPTPPQPAPPRRTR |
| Ga0126372_125444291 | 3300010360 | Tropical Forest Soil | MVSHLFFYQLVLVALVWLCVMLQWVWPSDPVAACSTTREPP |
| Ga0126378_109578093 | 3300010361 | Tropical Forest Soil | MVPALFFSQLVLIALVWLCVMLHWAWPSDPAACPTTLDPTPPLPKRHRAPKPFE |
| Ga0126378_112106261 | 3300010361 | Tropical Forest Soil | MVPALFFYQLALIALVWLCLMLQWAWPSARTLSPTTPEPPPPRLKR |
| Ga0126378_115131172 | 3300010361 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSDAAACPTIPKPLPPRPK |
| Ga0126378_130800021 | 3300010361 | Tropical Forest Soil | MVSHLFFYQLVLVTLVWLCVMLHWAWPSDPAPVWP |
| Ga0126377_103127542 | 3300010362 | Tropical Forest Soil | MVSDLFFYQLVLVALVWLCLILQWAWPSDPATCPPTRISGRI* |
| Ga0126377_123197602 | 3300010362 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCLMLHWIWPSDSAACPTTLEPPLPRRK |
| Ga0126379_104870354 | 3300010366 | Tropical Forest Soil | MVSDLFFSQRMLVALVWLCLMLHWLWPSAPATCPP |
| Ga0126379_105786761 | 3300010366 | Tropical Forest Soil | MVSSLFFYQLTLIALVWLYVMLQWAWLSDATAASPTPP |
| Ga0126379_119235721 | 3300010366 | Tropical Forest Soil | MVSHLFFYQLGLIALVWLCVILHWVWPSAYAVCPATPEPLSPLAK |
| Ga0126383_101511532 | 3300010398 | Tropical Forest Soil | MVSPLFFYQLTLIALIWLCVMLHWVWPSDAAACPTLPEPLPPRPKR |
| Ga0126383_109020852 | 3300010398 | Tropical Forest Soil | MVSHLFFSQLVLIALVWLCLMLQWTWPSDPAPCPP |
| Ga0126383_112343712 | 3300010398 | Tropical Forest Soil | MVSHLFFYQLVLVALVWLCLMLQWAWPSAPAAAGPPPELPPLLPKRTREP |
| Ga0126383_122933352 | 3300010398 | Tropical Forest Soil | MVSHLFFYQLVLVALVWLCVMLHWEWPSDPAPVCP |
| Ga0124850_11405232 | 3300010863 | Tropical Forest Soil | MVSPLFFYQLTLIALIWLCVMLHWVWPSDAAACPTLPEPLPPRPKRKREPTQG |
| Ga0137393_102212501 | 3300011271 | Vadose Zone Soil | MVSPLFFSQLVLVALVWLCVMLHWAWPSDPAVCPTT |
| Ga0137393_110262641 | 3300011271 | Vadose Zone Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSDPTAVCPTPPE |
| Ga0137389_109312861 | 3300012096 | Vadose Zone Soil | MISHLFFYQLVLVALVWLCVMHKWAWPSDPAAAGQTTLEPTPPRPK |
| Ga0137388_118422432 | 3300012189 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCVMLHWAWPSDPAAVCPTTPEPPCPLPKHH |
| Ga0137364_105943723 | 3300012198 | Vadose Zone Soil | MVSHLFFYQLVLIALVWLCVMLQWAWPSDPAAAGPTTREPTPPLPKR |
| Ga0137383_100349314 | 3300012199 | Vadose Zone Soil | MVSHLCFYQLTLIALVWLCLMLHGMWPSDSATCPTTPEP |
| Ga0137383_109439521 | 3300012199 | Vadose Zone Soil | MVSHLFFYQLTLIALVWLCVMLQWAWPSDPATVCPTTPEPP |
| Ga0137365_105320711 | 3300012201 | Vadose Zone Soil | MVSPLFFSQLVLVALVWLCVMLHVLWPSDPATCPTTLPPPLPKRHRTPKPFAGLTVS* |
| Ga0137380_112027061 | 3300012206 | Vadose Zone Soil | MVSDLFFYQLGLIVLVWLCLMLQWVWPSDSAAVCPT |
| Ga0137380_115554392 | 3300012206 | Vadose Zone Soil | MVPDLFFSQLVLVALVWVCLMLHWVWPSDCATAHPTPPQP |
| Ga0137381_110053441 | 3300012207 | Vadose Zone Soil | MVSPLFFYQLVLVALVWLCAMLQWAWRRDPAAVCPTTPE |
| Ga0137381_116144892 | 3300012207 | Vadose Zone Soil | MVSHLFFSQLVLVALVWLCLMLQWAWPSGCATAQLTPSQPTPSRHKRRREPKPFAGVTHK |
| Ga0137378_103088914 | 3300012210 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCVMLQWAWPSDPAAVCPTTPEPPGP |
| Ga0137377_101221484 | 3300012211 | Vadose Zone Soil | MVSHLFFYQLTLIALVWLCVMLHGVWPSDSAAACPTPLAPPPLPVSYPQILF* |
| Ga0137377_114693181 | 3300012211 | Vadose Zone Soil | MVSDLFFYQLGLIVLVWLCLMLQWVWPSDSAAVCPTTPELPSPVPKRHREPTPFA |
| Ga0137387_106794942 | 3300012349 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCVVLQWAWPSDPATVGPT |
| Ga0137366_111496011 | 3300012354 | Vadose Zone Soil | MVSALFFYQLVLVALVWLCVMLHWAWPSDPATVCPTTPEPSGPRPK |
| Ga0137384_100930451 | 3300012357 | Vadose Zone Soil | MVSPLFFYQLTLVALVWLCVMLHWAWPSDPATACPTTLQPTPPRPKRDRAPKPFA |
| Ga0137384_101874171 | 3300012357 | Vadose Zone Soil | MVSNLFFHQLVLIALVWLCVMLHVLWPSDPATCPTT |
| Ga0137384_104744482 | 3300012357 | Vadose Zone Soil | MVPDLFFYQLMLIALVWLCLMLQWMWPSAVAPCPTTPELTP |
| Ga0137375_104673461 | 3300012360 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCVMLHWAWPSDPAACPTTLDPIPWGVATID |
| Ga0137360_116905721 | 3300012361 | Vadose Zone Soil | MVSHLFFYQLVLIVLVWLCLMLQWAWPSDPASVCPT |
| Ga0137361_102238572 | 3300012362 | Vadose Zone Soil | MVSDLFFYQLVLVALVWLCVMLHWAWPSDPTAVCPTIPEPPCPRPKRHREP |
| Ga0137361_105213083 | 3300012362 | Vadose Zone Soil | MVSHLFFYHLVLVALVWLCLMLQWAWPSDPAAVCPTASEPTPPRPKRRRE |
| Ga0134032_11790801 | 3300012376 | Grasslands Soil | MVPNLFFYQVVLVALVWLCLMLQWAWPNDCATAQLTPSQPTPPRHKR |
| Ga0150984_1014978451 | 3300012469 | Avena Fatua Rhizosphere | MVSHLFFYQLVLVALVWLCLMLQWAWPSAPAVVGPTPPEPPG |
| Ga0137358_101750614 | 3300012582 | Vadose Zone Soil | MVSPLFFSQLVLVALVWLCVMLHWMWPSDPPPVWPA |
| Ga0137358_107161951 | 3300012582 | Vadose Zone Soil | MGSPLFFYQLVLVALVWLCVMLHCAWPGDPAAACQTLPQ |
| Ga0137395_106126563 | 3300012917 | Vadose Zone Soil | MVSHLFFSQLVLVALIGLCVMLHWAWPSDPATWPPTPEPTP |
| Ga0137359_103051591 | 3300012923 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCVMLHWAWPSDPAAVCPTTPEPPGPR |
| Ga0137407_106872493 | 3300012930 | Vadose Zone Soil | MVSHLFFYQLVLIALVWLCLMLHWMWPSDPAAACPPPELPP |
| Ga0137407_110577462 | 3300012930 | Vadose Zone Soil | MVSDLFFSQLVLVALVWLCVMLHGVWPSDPTIACPTIPLPIPPLPKR |
| Ga0137410_109371922 | 3300012944 | Vadose Zone Soil | MVSPLFFSQWVLVALVWLCVMRHWAWPSDPAVCPTTLG |
| Ga0126375_105741732 | 3300012948 | Tropical Forest Soil | MVSYLFYYQLVLIALLWLCVMLHWAWPSDPATVYPM |
| Ga0126375_106866153 | 3300012948 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLWVMLQWVWPSDAAACPTIPEPLPPLPK |
| Ga0126375_110802801 | 3300012948 | Tropical Forest Soil | MVSHLFFYQLVLVALVWLCVMLHWAWPSDPATVYPM |
| Ga0126369_110598582 | 3300012971 | Tropical Forest Soil | MVSHLFFYQLTLIALVWLCVMLHWVWPSDSAAACPTILAPPTPTAEAAP* |
| Ga0126369_132586202 | 3300012971 | Tropical Forest Soil | MVSHLFFCQLALVALVRLCVMLHWMWPSDPATACPTTLE |
| Ga0163162_120871311 | 3300013306 | Switchgrass Rhizosphere | MVSPLFFYQLVLVTLVWLCVMLHWAWPSDPATACPTTREPTPPRPKRH |
| Ga0163162_125320282 | 3300013306 | Switchgrass Rhizosphere | MVSPLFFYQLALIALVWLCVMLQMAWPSDPAAAGPPPELPPL |
| Ga0137418_108639371 | 3300015241 | Vadose Zone Soil | MVSHLFFYQLVLIVLVWLCLMLQWAWPSDPASVCPTALAPTPPLPKRRREPKP |
| Ga0137409_107316173 | 3300015245 | Vadose Zone Soil | MVSHLFYYQLVLVVLVWLWVMLQWAWPSDPAAVCPTI |
| Ga0132257_1020567432 | 3300015373 | Arabidopsis Rhizosphere | MVSPLFFYQLTLIALVWLCVMLHWMWPSDSAACPTLPEPLPPRPKRKREPTPF |
| Ga0132255_1053485671 | 3300015374 | Arabidopsis Rhizosphere | MVSHLFFYQLTLIALVWLCVMLHWMWPSDSAACPTLPEPLPPRPKRKREPKP |
| Ga0182041_105562082 | 3300016294 | Soil | MVSPLFFYQLTLIALVWLCVMLQWAWPSAPATACATTLEPP |
| Ga0182033_109602182 | 3300016319 | Soil | MVSHLFFYQLVLVVLVWLCLMLQWAWPSDPAAVCPTAPEPPP |
| Ga0182033_116988851 | 3300016319 | Soil | MVPDLFFSQLVLLALVWLDFMLHWVWPSHSAACPMTPEPPSPL |
| Ga0182035_113796171 | 3300016341 | Soil | MVSHLFFYQLTLIVLVWLCVMLQWVWPSDSATACPTPLAPPPP |
| Ga0182035_115681231 | 3300016341 | Soil | MVPALFFYQLVLIALVWLCIMLQWAWPSAPTAACPPPE |
| Ga0182034_115237642 | 3300016371 | Soil | MVSHLFFSQLVLVALVWLCVMLHWVWPSDPATACPMTRE |
| Ga0182040_109164642 | 3300016387 | Soil | MVSHLFFYQLTLIALVWRCVMLHGVWPSDSAAACPTPLALPPPRPTRHRVP |
| Ga0182037_104393422 | 3300016404 | Soil | MVSHLFFYQLVLVALVWLCLMLQWVWPSDPATVRPTTQEPAPPRP |
| Ga0182039_106133231 | 3300016422 | Soil | MVPDLFFYQLVLIALVWLCIMLQWAWPSAPAAAGPPLELPPLLPKRTREPKPALRKGT |
| Ga0134083_104797902 | 3300017659 | Grasslands Soil | MVSYLFFYQLVLIALVWLCVMLHWAWPSDPAAACP |
| Ga0187894_101306832 | 3300019360 | Microbial Mat On Rocks | MASDLVFYQLGLIVLVWLCLMLQWAWLRGSAATCPTTPEPTPPTAKA |
| Ga0222625_10071772 | 3300022195 | Groundwater Sediment | MVSPLFFYQLVLVALVWLCLMLHWAWPSDSAACPTTLDPTPPLPKRHRESTPLTSPLREF |
| Ga0207670_117125591 | 3300025936 | Switchgrass Rhizosphere | MVSPLFFYQLTLIALVWLCVMLHWMWPSDSAACPTLPEPLPPRPKRKR |
| Ga0207665_106431031 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSHLFFYQLTLIALVWLCVMLQWAWPSDSAAACPSPL |
| Ga0207712_110064021 | 3300025961 | Switchgrass Rhizosphere | MVSDLFFYQLVLVALVWLCVMLQWAWPSNPAAVCPTTPESPGPRPKRHHELTP |
| Ga0207712_110553842 | 3300025961 | Switchgrass Rhizosphere | MVSHLFFYQLTLIALVWLCVMLQWVWPSDRTAVCPTTPEPPP |
| Ga0207668_107299872 | 3300025972 | Switchgrass Rhizosphere | MVSALFFYPLVLVALVWLCVMLQWAWPSNPAAVCPTTPESPGPRPKRHHE |
| Ga0207668_110485941 | 3300025972 | Switchgrass Rhizosphere | MVSPLLFYQLTLIALVWLCVMLQWAWPSDALTCPPPPEAYTPSAKA |
| Ga0209237_12175632 | 3300026297 | Grasslands Soil | MVSPLFFSQLVLIALVWLCVMLQWAWPSAPAAAGPPPELPPLLPKRTRE |
| Ga0257159_10338041 | 3300026494 | Soil | MVSHLFFYQLVLVALVWLCVMLQWAWPSDPAAACPTT |
| Ga0257165_10341691 | 3300026507 | Soil | MVSHLFFYQLVLIALVWLCLMLQWAWSSDPAAACPPPL |
| Ga0209058_12812861 | 3300026536 | Soil | MVPTLFFYQLVLVALVWLCVMLQWAWPSDPAAVCPTTPEGSVAKLPFGGKI |
| Ga0209874_10273772 | 3300027577 | Groundwater Sand | MVPTLFFYQLVLVALVWLCVMLQWAWPSGCATAVIFLI |
| Ga0209874_11520342 | 3300027577 | Groundwater Sand | MVSHLFFYQLTLIALVWLCVMLQWAWPSDSVAACPST |
| Ga0209466_11224032 | 3300027646 | Tropical Forest Soil | MVSALFFYQLMLVALVWLCVMLHWAWPSDTATYPTALEPLPPLPKRTREPKPFVG |
| Ga0209799_10890112 | 3300027654 | Tropical Forest Soil | MVSHLFFYQLALIALVWLCLMLQWAWPSAPTLSPTTPDAP |
| Ga0209388_10935381 | 3300027655 | Vadose Zone Soil | MVSHLFFSQLVLIALVWLCVMLHWAWPSDPAAACPPPELPPLLPKRKREPT |
| Ga0209814_105308411 | 3300027873 | Populus Rhizosphere | MVSQLFFSQLWLIALVWLCVILHWVWPSDPATAYPT |
| Ga0209465_102514111 | 3300027874 | Tropical Forest Soil | MVTHLFYYQLTLIALVWLCVMLQWAWSSDPAAVCPTAPEPTPPVPKRHRERTPFAG |
| Ga0209465_106204361 | 3300027874 | Tropical Forest Soil | MVSHLFFYQLVLIALVWLCVMLQWAWPSDSAAACPLPLE |
| Ga0209283_100946591 | 3300027875 | Vadose Zone Soil | MVSHLFFYQLVLIALVWLCVMLQWAWPSDPAAACPPPELPPLLPKRK |
| Ga0209283_104967471 | 3300027875 | Vadose Zone Soil | MVSHLFFYQLVLVALVWLCVMLHWTWPSDPAPVWPTTPESLPPLRK |
| Ga0209481_106610441 | 3300027880 | Populus Rhizosphere | MVSPLFFYQLVLVALVWLCVMLHWAWPSDPATVRLTTLEGPV |
| Ga0209590_100148623 | 3300027882 | Vadose Zone Soil | MVSTLFFSQLVLVALVWLYVMLQWAWPSDPAAVCPTAPEPT |
| Ga0209590_102050032 | 3300027882 | Vadose Zone Soil | MVSHLFFYQLTLIALVWLCIMLQWGWPSDSAAACPTTLAPPPHRRQDKL |
| Ga0209590_103366192 | 3300027882 | Vadose Zone Soil | MVSPLFFYQLVLVALVWLCVMLHWAWPSDPAAVCPTTPEPPGPLPKHN |
| Ga0209590_107517391 | 3300027882 | Vadose Zone Soil | MVPDLFFYQLVLVALIWLCVMLHWAWPSDPATCPPTP |
| Ga0209488_107000271 | 3300027903 | Vadose Zone Soil | MVSHLFFSQLVLVALVWLCVMLHWAWPSDPAVCPTTLDPTPPRPKRNRA |
| Ga0207428_106884832 | 3300027907 | Populus Rhizosphere | MVSPLFFYQLTLIALVWLYVMLQWAWLSDATTASPTPPR |
| Ga0209382_100223511 | 3300027909 | Populus Rhizosphere | MVSPLFFYQLTLIALVWLYVMLQWAWLSDATTASPTPPP |
| Ga0209583_107281811 | 3300027910 | Watersheds | MVSHLFFYQLALIALVWLCVMLQWVWPSAAAACPTPLA |
| Ga0209889_10153131 | 3300027952 | Groundwater Sand | MVSHLFFYQLVLVALVWLCLMLHWAWPSDPTAGCPTAPEPTPLTRGGFVKK |
| Ga0209859_10054761 | 3300027954 | Groundwater Sand | MVPTLFFYQLVLVALVWLCVMLQWAWPSGCATAPL |
| Ga0209857_10692712 | 3300027957 | Groundwater Sand | MVPDLFFYQLVLVALVWVCLMLHWVWPSDCATAHPTPPQPTPPRRQRS |
| Ga0209853_10275071 | 3300027961 | Groundwater Sand | MVSHLFFSQLVLVALVWLCVMLQWAWPSDPAACPTTLDPTQCHQLRVN |
| Ga0247823_109869732 | 3300028590 | Soil | MVSHLFFYQLALIALVWLCVMLQMAWPSDPAAAGPPPEFPPLLPK |
| Ga0307312_103308273 | 3300028828 | Soil | MVSPLFFYQLVLVALVWLCLMLHWAWPSDSAACPTTLDPTPPLP |
| Ga0308206_10352212 | 3300030903 | Soil | MVSHLFFYQLALVALVWLCVMLDWVWPSDPAAVGPTAP |
| Ga0308184_10105131 | 3300031095 | Soil | MVPYVFFYQLVLIALVWLFVMMHAAWASQRAATAQRP |
| Ga0308187_100136783 | 3300031114 | Soil | HLFFYQLTLIALVWLCVMLHWAWPSDSAAACPTTLAPHKRQDKL |
| Ga0318573_105623921 | 3300031564 | Soil | MVSHLFFYQLTLIALVWLCLMLQWAWPSDLAAGCPTT |
| Ga0310915_102243491 | 3300031573 | Soil | MVSHLFFYQLVLVALVWLCIMLHCVWPSDAGAACLTTLEPP |
| Ga0310915_104146992 | 3300031573 | Soil | MVSDLFFYQLVLVALVWLCLMLQWAWPSDTAAYPTTSEPPPPLPKRKHEP |
| Ga0306918_107519281 | 3300031744 | Soil | MVPDLFFYQLGLIALVWLYFMLYWVWPSDAAACPMTPEPPSPLPK |
| Ga0318517_104789161 | 3300031835 | Soil | MVSPLFFYQLTLIALVWLCVMLQWAWPSAPATACATTLEPPPPRPKRRREPKPF |
| Ga0306925_110583391 | 3300031890 | Soil | MVSHLFFYQLVLVALVWLCLMLQWAWPSDPATACPTTQEPPP |
| Ga0318551_104703821 | 3300031896 | Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSDPTAVRPT |
| Ga0310910_114536851 | 3300031946 | Soil | MVSPLFFYQLVLVALVWLCVMLQWAWPSDPAAVCPTT |
| Ga0310909_105643742 | 3300031947 | Soil | MVSHLFFYQLTLIVLVWLCVMLQWVWPSDSATACPTPLAP |
| Ga0318510_103845041 | 3300032064 | Soil | MVSHLFFYQLVLVALVWLCVMLQWAWPSDSATVCPTTLDPTPSR |
| Ga0318513_103146481 | 3300032065 | Soil | MVSHLFFYQLVLVALVWLCIMLQWAWPSDPAACPTALDPTPPRPK |
| Ga0306924_106956351 | 3300032076 | Soil | MVPDLFFYQLVLIALVWLYCMLHGVWPSDSAACPMTPEPPSPLPKRKRE |
| Ga0318518_104637271 | 3300032090 | Soil | MVSHLFFYQLTLIALVWLCVMLQWAWPSDSAAVCPTAPEPPP |
| Ga0306920_1008141771 | 3300032261 | Soil | MVSHLFFYQLTLIALVWLCVMLQWVWPSAPTAMCPTTPEPPP |
| Ga0306920_1039015171 | 3300032261 | Soil | MVSHLFFYQLTLIALVWLCLMLQWAWPSARTLSPTIPEPPPSRLKRKRVPKPFTGLT |
| Ga0314797_153366_282_425 | 3300034672 | Soil | MVSPLFFYQRTLLALVWLCVMLHWVWPSDSAATCPTTLPPFGQLTRL |
| Ga0370541_046670_410_559 | 3300034680 | Soil | MVSHLFFYQLVLVALVWLCLMLQWAWPSDHAAVCPTAPEPTPPLPKHSRE |
| ⦗Top⦘ |