


| Basic Information | |
|---|---|
| Family ID | F022449 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 214 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 214 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 97.66 % |
| % of genes from short scaffolds (< 2000 bps) | 85.05 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.196 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.701 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.037 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 214 Family Scaffolds |
|---|---|---|
| PF16868 | NMT1_3 | 50.93 |
| PF03401 | TctC | 7.01 |
| PF13620 | CarboxypepD_reg | 6.07 |
| PF09084 | NMT1 | 4.21 |
| PF13442 | Cytochrome_CBB3 | 2.80 |
| PF00903 | Glyoxalase | 1.87 |
| PF05378 | Hydant_A_N | 1.40 |
| PF01935 | DUF87 | 1.40 |
| PF04909 | Amidohydro_2 | 0.93 |
| PF01541 | GIY-YIG | 0.47 |
| PF01979 | Amidohydro_1 | 0.47 |
| PF00027 | cNMP_binding | 0.47 |
| PF12471 | GTP_CH_N | 0.47 |
| PF13603 | tRNA-synt_1_2 | 0.47 |
| PF03567 | Sulfotransfer_2 | 0.47 |
| PF00296 | Bac_luciferase | 0.47 |
| PF01799 | Fer2_2 | 0.47 |
| PF13469 | Sulfotransfer_3 | 0.47 |
| PF13437 | HlyD_3 | 0.47 |
| PF14247 | DUF4344 | 0.47 |
| PF02653 | BPD_transp_2 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 7.01 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.21 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.21 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 2.80 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.20 % |
| Unclassified | root | N/A | 2.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402H3SYE | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0849920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3013 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1028283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 889 | Open in IMG/M |
| 3300004152|Ga0062386_100233546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300004479|Ga0062595_102412104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300004480|Ga0062592_102333313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005147|Ga0066821_1020292 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005179|Ga0066684_10836738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300005332|Ga0066388_100615703 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300005332|Ga0066388_103045708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300005332|Ga0066388_107576133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300005363|Ga0008090_10118277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1426 | Open in IMG/M |
| 3300005435|Ga0070714_102102705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300005441|Ga0070700_100820782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300005454|Ga0066687_10530053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005457|Ga0070662_100125068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1975 | Open in IMG/M |
| 3300005466|Ga0070685_10248736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1177 | Open in IMG/M |
| 3300005471|Ga0070698_102056354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300005560|Ga0066670_10469424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300005561|Ga0066699_10982121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005602|Ga0070762_10564533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300005713|Ga0066905_101816189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300005764|Ga0066903_100369534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
| 3300005764|Ga0066903_100520845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2024 | Open in IMG/M |
| 3300005764|Ga0066903_101637527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300005764|Ga0066903_102859669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300005764|Ga0066903_108043251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300005764|Ga0066903_108367299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005843|Ga0068860_101438994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 710 | Open in IMG/M |
| 3300005843|Ga0068860_102468558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300005844|Ga0068862_100604222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300005844|Ga0068862_102343439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300006048|Ga0075363_100240365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300006050|Ga0075028_100352460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Stagnimonas → Stagnimonas aquatica | 831 | Open in IMG/M |
| 3300006196|Ga0075422_10252579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300006606|Ga0074062_10042085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300006796|Ga0066665_10152680 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300006800|Ga0066660_11356393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300006846|Ga0075430_101508299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300006847|Ga0075431_101997846 | Not Available | 535 | Open in IMG/M |
| 3300006853|Ga0075420_101961222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300006871|Ga0075434_101043760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 831 | Open in IMG/M |
| 3300006880|Ga0075429_101949448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300006903|Ga0075426_10235389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1332 | Open in IMG/M |
| 3300006953|Ga0074063_11742580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300009038|Ga0099829_10361664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300009098|Ga0105245_11264239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300009101|Ga0105247_11738844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300009143|Ga0099792_10363215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300009147|Ga0114129_11187077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300009147|Ga0114129_11818777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300009148|Ga0105243_13035500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300009162|Ga0075423_12283268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300009551|Ga0105238_12433887 | Not Available | 559 | Open in IMG/M |
| 3300010043|Ga0126380_10222940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300010046|Ga0126384_10806331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300010301|Ga0134070_10270075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300010358|Ga0126370_11016665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300010361|Ga0126378_11855903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300010366|Ga0126379_10691865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300010366|Ga0126379_13804263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300010373|Ga0134128_11549989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300010375|Ga0105239_11499829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300010376|Ga0126381_101699573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300010376|Ga0126381_103524249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300010400|Ga0134122_10755102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| 3300010403|Ga0134123_11171664 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010403|Ga0134123_13535092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300010863|Ga0124850_1055828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1229 | Open in IMG/M |
| 3300010868|Ga0124844_1322468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300010880|Ga0126350_11309483 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010937|Ga0137776_1212402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300011421|Ga0137462_1107309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 668 | Open in IMG/M |
| 3300012227|Ga0137449_1027306 | Not Available | 1118 | Open in IMG/M |
| 3300012359|Ga0137385_10025830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5261 | Open in IMG/M |
| 3300012905|Ga0157296_10255760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300012915|Ga0157302_10073680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300012916|Ga0157310_10294288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300012923|Ga0137359_11199992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300012929|Ga0137404_10623477 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012930|Ga0137407_10420532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1240 | Open in IMG/M |
| 3300012955|Ga0164298_10698299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300012960|Ga0164301_10315507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300012971|Ga0126369_10693991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
| 3300012971|Ga0126369_13328096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300012986|Ga0164304_11123781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300012988|Ga0164306_10042060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2710 | Open in IMG/M |
| 3300013308|Ga0157375_11943714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300014326|Ga0157380_10257066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1584 | Open in IMG/M |
| 3300014326|Ga0157380_11969260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300014968|Ga0157379_10069984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3139 | Open in IMG/M |
| 3300015242|Ga0137412_10699609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 755 | Open in IMG/M |
| 3300015356|Ga0134073_10083795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300015357|Ga0134072_10037949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1290 | Open in IMG/M |
| 3300015371|Ga0132258_10372531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3538 | Open in IMG/M |
| 3300015371|Ga0132258_10396121 | All Organisms → cellular organisms → Bacteria | 3429 | Open in IMG/M |
| 3300015371|Ga0132258_10590230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2788 | Open in IMG/M |
| 3300015371|Ga0132258_11645592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1620 | Open in IMG/M |
| 3300015372|Ga0132256_100333866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1607 | Open in IMG/M |
| 3300015373|Ga0132257_103916562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300015374|Ga0132255_106287523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300016294|Ga0182041_10644705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300016319|Ga0182033_11104353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300016357|Ga0182032_10504471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300016404|Ga0182037_11632130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300018067|Ga0184611_1300001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300018081|Ga0184625_10204705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300018476|Ga0190274_12156005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300018476|Ga0190274_13040734 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020580|Ga0210403_11508921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300020581|Ga0210399_10070600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2828 | Open in IMG/M |
| 3300021478|Ga0210402_11186875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300021560|Ga0126371_11345602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300023064|Ga0247801_1074799 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300023261|Ga0247796_1095702 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300024330|Ga0137417_1394910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2106 | Open in IMG/M |
| 3300025910|Ga0207684_11235642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300025924|Ga0207694_11453977 | Not Available | 579 | Open in IMG/M |
| 3300025926|Ga0207659_10321220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
| 3300025933|Ga0207706_11324092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300025945|Ga0207679_11274481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300026035|Ga0207703_10177676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1877 | Open in IMG/M |
| 3300026035|Ga0207703_12331975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300026041|Ga0207639_10592609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300026121|Ga0207683_11456900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300026304|Ga0209240_1024724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2299 | Open in IMG/M |
| 3300026323|Ga0209472_1085126 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300026490|Ga0257153_1008703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2017 | Open in IMG/M |
| 3300026532|Ga0209160_1140325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
| 3300026552|Ga0209577_10791801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300027181|Ga0208997_1050746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300027521|Ga0209524_1049294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300027527|Ga0209684_1032830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300027910|Ga0209583_10286229 | Not Available | 742 | Open in IMG/M |
| 3300028536|Ga0137415_10800997 | Not Available | 752 | Open in IMG/M |
| 3300028709|Ga0307279_10100083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300028711|Ga0307293_10003858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3879 | Open in IMG/M |
| 3300028712|Ga0307285_10009581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2056 | Open in IMG/M |
| 3300028718|Ga0307307_10004785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3455 | Open in IMG/M |
| 3300028720|Ga0307317_10033850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1602 | Open in IMG/M |
| 3300028791|Ga0307290_10051683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
| 3300028811|Ga0307292_10055468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1490 | Open in IMG/M |
| 3300028875|Ga0307289_10445746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300028876|Ga0307286_10155022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300028885|Ga0307304_10222829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300031199|Ga0307495_10020803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300031199|Ga0307495_10113994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300031455|Ga0307505_10092049 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300031543|Ga0318516_10012930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4090 | Open in IMG/M |
| 3300031545|Ga0318541_10342744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300031546|Ga0318538_10170103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1157 | Open in IMG/M |
| 3300031547|Ga0310887_10113529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1365 | Open in IMG/M |
| 3300031564|Ga0318573_10029125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2569 | Open in IMG/M |
| 3300031723|Ga0318493_10477114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300031724|Ga0318500_10651867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300031736|Ga0318501_10043315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2066 | Open in IMG/M |
| 3300031736|Ga0318501_10143163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
| 3300031740|Ga0307468_100696781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300031744|Ga0306918_11008751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300031744|Ga0306918_11435048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300031747|Ga0318502_10036009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2535 | Open in IMG/M |
| 3300031751|Ga0318494_10595003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300031763|Ga0318537_10147932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300031768|Ga0318509_10763161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300031769|Ga0318526_10033189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1895 | Open in IMG/M |
| 3300031769|Ga0318526_10169348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
| 3300031778|Ga0318498_10008454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4059 | Open in IMG/M |
| 3300031779|Ga0318566_10179166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300031780|Ga0318508_1003913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2978 | Open in IMG/M |
| 3300031782|Ga0318552_10456957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300031792|Ga0318529_10292386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300031795|Ga0318557_10004301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4813 | Open in IMG/M |
| 3300031795|Ga0318557_10165460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300031796|Ga0318576_10122377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300031796|Ga0318576_10473204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300031797|Ga0318550_10032375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2258 | Open in IMG/M |
| 3300031799|Ga0318565_10330776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300031819|Ga0318568_10065421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2125 | Open in IMG/M |
| 3300031819|Ga0318568_10542892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300031835|Ga0318517_10065032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1555 | Open in IMG/M |
| 3300031846|Ga0318512_10006805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4207 | Open in IMG/M |
| 3300031846|Ga0318512_10025736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2476 | Open in IMG/M |
| 3300031846|Ga0318512_10524302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300031854|Ga0310904_11384283 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031879|Ga0306919_10254249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300031880|Ga0318544_10012362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2734 | Open in IMG/M |
| 3300031893|Ga0318536_10335691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
| 3300031912|Ga0306921_12775682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300031938|Ga0308175_101256424 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031941|Ga0310912_10243207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1383 | Open in IMG/M |
| 3300031942|Ga0310916_11074492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 669 | Open in IMG/M |
| 3300031942|Ga0310916_11505477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300031946|Ga0310910_11346543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300031947|Ga0310909_10123878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2102 | Open in IMG/M |
| 3300031949|Ga0214473_11109489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 826 | Open in IMG/M |
| 3300031981|Ga0318531_10024770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2423 | Open in IMG/M |
| 3300032001|Ga0306922_11480394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300032010|Ga0318569_10556110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300032017|Ga0310899_10269569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300032035|Ga0310911_10338170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300032039|Ga0318559_10187783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300032043|Ga0318556_10344376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300032044|Ga0318558_10185967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300032054|Ga0318570_10291618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300032055|Ga0318575_10178991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300032059|Ga0318533_10030477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3493 | Open in IMG/M |
| 3300032065|Ga0318513_10037836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2115 | Open in IMG/M |
| 3300032066|Ga0318514_10530667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300032068|Ga0318553_10147452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300032163|Ga0315281_10914668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 896 | Open in IMG/M |
| 3300032180|Ga0307471_102588192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300032421|Ga0310812_10297893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300033290|Ga0318519_10328065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300033433|Ga0326726_10842468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.47% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.47% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.47% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08319430 | 2189573004 | Grass Soil | VVEILKSKEVGDMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| ICChiseqgaiiDRAFT_08499204 | 3300000033 | Soil | LQSKEVGDMLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| AP72_2010_repI_A001DRAFT_10282832 | 3300000893 | Forest Soil | MLRKMSLETGATAPADTARFFAEETALWSKVIKEAGIEPQ* |
| Ga0062386_1002335462 | 3300004152 | Bog Forest Soil | DMLHKVSLEPGATSSSETARFFADEATLWSSVIKEAGIEPQ* |
| Ga0062595_1024121042 | 3300004479 | Soil | LKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0062592_1023333132 | 3300004480 | Soil | NRDTVDILKRKEVGETLRKLSLEAGATSPSETTAFFADEAALWSKVIKEAGITPQ* |
| Ga0066821_10202922 | 3300005147 | Soil | VGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0066684_108367382 | 3300005179 | Soil | LAEKINRDVVEILHGTEVGEMLHRISLVAGATAPSETSRFFAEETALWSKVIKEAGIEPQ |
| Ga0066388_1006157033 | 3300005332 | Tropical Forest Soil | EILKSNAVGDLLHKMSLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0066388_1030457082 | 3300005332 | Tropical Forest Soil | NAVGDLLHKMSLEPGATAPAETTRFFAEETALWSKVIKEAGVAPQ* |
| Ga0066388_1075761331 | 3300005332 | Tropical Forest Soil | AALAEKINRDVVEILNGKDAGDALRKMSLEAGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0008090_101182771 | 3300005363 | Tropical Rainforest Soil | VEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0070714_1021027052 | 3300005435 | Agricultural Soil | DMLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0070700_1008207822 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | DKINRDVVEILKSKEVGEMLRRISLEAGATTPSGTARFFADETALWSKVIKEAGIQPQ* |
| Ga0066687_105300531 | 3300005454 | Soil | EILHGTEVGEMLHRMSLEPGASAPGETSRFFAEETALWSKVIKEAGIEPQ* |
| Ga0070662_1001250684 | 3300005457 | Corn Rhizosphere | INRDVVEILKSKEVGEMLRRISLEAGATTPSGTARFFADETALWSKVIKEAGIQPQ* |
| Ga0070685_102487361 | 3300005466 | Switchgrass Rhizosphere | PEVAQRLESLSLEAGATSPAETAKFFADETALWGKVIKEAGIEPQ* |
| Ga0070698_1020563542 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EILNGKDAGDVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ* |
| Ga0066670_104694242 | 3300005560 | Soil | LVAGATAPSETSRFFAEETALWSKVIKEAGIEPQ* |
| Ga0066699_109821211 | 3300005561 | Soil | MSLDVSATTRAETARFFAEETALWSRVIKQAGIVPQ* |
| Ga0070762_105645331 | 3300005602 | Soil | KEVRAILQNISLEPGATSPAKTVKFFAEETALWSKVIHEAGIEPQ* |
| Ga0066905_1018161892 | 3300005713 | Tropical Forest Soil | LRKMSLETGATAPADTARFFAEETALWSKVIKEAGIEPQ* |
| Ga0066903_1003695344 | 3300005764 | Tropical Forest Soil | SLDIGATTRAEATKFFAEETALWGRVIKEAGIPAQ* |
| Ga0066903_1005208451 | 3300005764 | Tropical Forest Soil | INRDVTAILKTTEMGGTLRKISLEAGATSRADTTRFFAEETALWSKVIREAGIEPQ* |
| Ga0066903_1016375271 | 3300005764 | Tropical Forest Soil | VEILHGTEVGQMLQRISLEPGATTPSETSRFFAEETALWSKVIKEAGIEPQ* |
| Ga0066903_1028596692 | 3300005764 | Tropical Forest Soil | RKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ* |
| Ga0066903_1080432511 | 3300005764 | Tropical Forest Soil | RKEVDEMLRRISLEAGATSPAETARFFAEETALWSKVIKEAGIEPQ* |
| Ga0066903_1083672991 | 3300005764 | Tropical Forest Soil | KINRDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAGETALWSKVIKEAGIEPQ* |
| Ga0068860_1014389941 | 3300005843 | Switchgrass Rhizosphere | LSLEAGATSPAETAKFFADETALWGKVIKEAGIEPQ* |
| Ga0068860_1024685582 | 3300005843 | Switchgrass Rhizosphere | SLEAGATSPAETAKFFADETALWGKVIKEAGIEPQ* |
| Ga0068862_1006042221 | 3300005844 | Switchgrass Rhizosphere | ISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0068862_1023434391 | 3300005844 | Switchgrass Rhizosphere | EILKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0075363_1002403651 | 3300006048 | Populus Endosphere | LEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0075028_1003524601 | 3300006050 | Watersheds | LDPGATTRPDTAKFFAEETALWSQVIKQANIEPQ* |
| Ga0075422_102525792 | 3300006196 | Populus Rhizosphere | GDMLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0074062_100420852 | 3300006606 | Soil | DAGDALRKMSLETGATAPAETTRFFAEETALWSRVIKEAGIEPQ* |
| Ga0066665_101526804 | 3300006796 | Soil | EMLHRISLVAGATAPSETSRFFAEETALWSKVIKEAGIEPQ* |
| Ga0066660_113563932 | 3300006800 | Soil | LETGATAPAETARFFAEETALWSKVIREAGIEPQ* |
| Ga0075430_1015082992 | 3300006846 | Populus Rhizosphere | LAEKINHDAVAILKSKEVGDMLRRISLEAGATSPADTTRFFTEEAALWSKVIKEAGIEPQ |
| Ga0075431_1019978461 | 3300006847 | Populus Rhizosphere | LRKLSLEAGATSPSETTAFFAGEAALWSKVIKEAGITPQ* |
| Ga0075420_1019612222 | 3300006853 | Populus Rhizosphere | DVDEMLRRISLEVGATSTADTRRFFAEETALWAKVIKEAGIQPQ* |
| Ga0075434_1010437601 | 3300006871 | Populus Rhizosphere | KDVGDMLRKMSLEAGATAPAETNRFFAEETALWSKVIKEAGIEPQ* |
| Ga0075429_1019494481 | 3300006880 | Populus Rhizosphere | EILQSKEVGDMLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0075426_102353893 | 3300006903 | Populus Rhizosphere | SKDVGDMLHKMSLEAGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0074063_117425802 | 3300006953 | Soil | VEILNSDDVVDMLRKLSLEPGATSPAETARFFAEETALWSKVIKEAGIEPQ* |
| Ga0099829_103616641 | 3300009038 | Vadose Zone Soil | ILNSNEVAGMLHKLSLEPGATSPAETARFFAEEAALWSKVIKEAGIEPQ* |
| Ga0105245_112642392 | 3300009098 | Miscanthus Rhizosphere | LRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0105247_117388441 | 3300009101 | Switchgrass Rhizosphere | EVGEMLRRISLEAGATTPSETARFFADETALWSKVIKEAGIQPQ* |
| Ga0099792_103632152 | 3300009143 | Vadose Zone Soil | VVEILNGKDVGDMLYKMSLEPGATAPAETTRFFAEEAALWSKVIKEAGIEPQ* |
| Ga0114129_111870771 | 3300009147 | Populus Rhizosphere | SKDVAEMLRKMSLEAGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0114129_118187772 | 3300009147 | Populus Rhizosphere | SLETGATAPAETARFFAEETALWSKVIKEAGIEPQ* |
| Ga0105243_130355001 | 3300009148 | Miscanthus Rhizosphere | RRISLEAGASSPAETTKFFADETALWSKVIREAGITLQ* |
| Ga0075423_122832682 | 3300009162 | Populus Rhizosphere | LHSTEVGQMLHRISLEPGATTPGETSRFFAEETALWSKVIKEAGIEPQ* |
| Ga0105238_124338872 | 3300009551 | Corn Rhizosphere | LSLEAGGTDLAGTKKFFGDETALWSKVIKDAGIKPQ* |
| Ga0126380_102229401 | 3300010043 | Tropical Forest Soil | RKEVDEMLRRISLEAGATSPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0126384_108063311 | 3300010046 | Tropical Forest Soil | AEKINRDAVDILKRKEVDEMLRRISLEAGATSPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0134070_102700751 | 3300010301 | Grasslands Soil | DVVEILNGKDAGDVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGSEPQ* |
| Ga0126370_110166652 | 3300010358 | Tropical Forest Soil | DVGDLLHKISLEAGATSPADTTKFFADETAQWSKVIKEAGIEPQ* |
| Ga0126378_118559031 | 3300010361 | Tropical Forest Soil | ILNSNEVVEMLRRISLEPGATASAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0126379_106918652 | 3300010366 | Tropical Forest Soil | SLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0126379_138042632 | 3300010366 | Tropical Forest Soil | KDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0134128_115499891 | 3300010373 | Terrestrial Soil | LTDKINRDVVEILKSKEVGEMLRRISLEAGATTPSGTARFFADETALWSKVIKEAGIQPQ |
| Ga0105239_114998291 | 3300010375 | Corn Rhizosphere | INRDVVEILKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0126381_1016995732 | 3300010376 | Tropical Forest Soil | EKINRDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0126381_1035242492 | 3300010376 | Tropical Forest Soil | GKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0134122_107551022 | 3300010400 | Terrestrial Soil | ISLEAGATSPAETTKFFADETALWSKVIKEAGIALQ* |
| Ga0134123_111716642 | 3300010403 | Terrestrial Soil | LHSPEVAARLKSLSLEAGATSPAETAAFFAGETALWGKVIKEAGIEPQ* |
| Ga0134123_135350921 | 3300010403 | Terrestrial Soil | EVLGSKEVGERLQSISLEVGATSPAATAKFFADEAALWGKVIKEAGITPN* |
| Ga0124850_10558282 | 3300010863 | Tropical Forest Soil | LAEKINRDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0124844_13224682 | 3300010868 | Tropical Forest Soil | DVVDLLKSKEVIDTLRKISLEPGATSPADTTRFFGEETALWSKVIKEAGIEPQ* |
| Ga0126350_113094832 | 3300010880 | Boreal Forest Soil | LKSLSLEAGALSQTETATFFADETALWGKVIKEAGIEPQ* |
| Ga0137776_12124022 | 3300010937 | Sediment | DVVAVLHGNDVVDMLHTISLEPSAATPPETARFFADEATLWASVIKEAGIEPQ* |
| Ga0137462_11073091 | 3300011421 | Soil | LQAISLEVGATSPAETISFFNAEAMLWSKVIKEANITPQ* |
| Ga0137449_10273061 | 3300012227 | Soil | IGERLQAISLEVGATSPAETAKFFNDEAMLWSKVIKEANITPQ* |
| Ga0137385_100258307 | 3300012359 | Vadose Zone Soil | VVEILNGKDAGDMLRKISLETGATAPADTARFFAEETALWSKVIKEAAIEPQ* |
| Ga0157296_102557601 | 3300012905 | Soil | SKEVGDMLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0157302_100736801 | 3300012915 | Soil | RISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0157310_102942882 | 3300012916 | Soil | RRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0137359_111999922 | 3300012923 | Vadose Zone Soil | DVVEILNGKDAGDVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ* |
| Ga0137404_106234772 | 3300012929 | Vadose Zone Soil | ESLSLEAGAMSPADTAKFFADETALWGKVIKEAGIEPQ* |
| Ga0137407_104205322 | 3300012930 | Vadose Zone Soil | VAEMLRKMSLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0164298_106982992 | 3300012955 | Soil | RISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0164301_103155072 | 3300012960 | Soil | LRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0126369_106939911 | 3300012971 | Tropical Forest Soil | ISLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0126369_133280962 | 3300012971 | Tropical Forest Soil | RKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0164304_111237811 | 3300012986 | Soil | AMLQNISLEPGATSRAETAKYFAEETALWSKVIHEAGIEPQ* |
| Ga0164306_100420601 | 3300012988 | Soil | ILQSKEVGDMLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ* |
| Ga0157375_119437141 | 3300013308 | Miscanthus Rhizosphere | KEVGEMLRRISLEAGATTPSDTARFFADATALWSKVIKEAGIQPQ* |
| Ga0157380_102570661 | 3300014326 | Switchgrass Rhizosphere | VTARLQSLSLEVGATNPADTAKFFADETALWGKVIKEAGIEPQ* |
| Ga0157380_119692601 | 3300014326 | Switchgrass Rhizosphere | RDVVEILKSKEVGEMLRRISLEAGATTPSGTARFFADETALWSKVIKEAGIQPQ* |
| Ga0157379_100699844 | 3300014968 | Switchgrass Rhizosphere | EMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0137412_106996091 | 3300015242 | Vadose Zone Soil | PDVDARLRDLMLEPGATSAADTARFFAEETALWGKVIKELNLAPQ* |
| Ga0134073_100837952 | 3300015356 | Grasslands Soil | MSLEPGATAPGETSRFFAEETALWSKVIKEAGIEPQ* |
| Ga0134072_100379491 | 3300015357 | Grasslands Soil | RDVVEILKSKDVGDMLHKMSLEAGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0132258_103725311 | 3300015371 | Arabidopsis Rhizosphere | AVELLRSKEVGDVLRKISLEAGATSPAETTKFFADEAALWAKVIKEAGIEPQ* |
| Ga0132258_103961211 | 3300015371 | Arabidopsis Rhizosphere | NRDVVEILKSKDVGDMLHKMSLEAGATAPAETTRFFAEETALWSKVIKEAGIEPQ* |
| Ga0132258_105902304 | 3300015371 | Arabidopsis Rhizosphere | VEILKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0132258_116455923 | 3300015371 | Arabidopsis Rhizosphere | VEILKSKEVGDMLRRISLEAGATTPADTSRFFAEETALWTKVIKEAGIEPQ* |
| Ga0132256_1003338661 | 3300015372 | Arabidopsis Rhizosphere | LLKSKEVVDTLRKISLEPGATSPADTARFFGEETALWSKVIKEAGIEPQ* |
| Ga0132257_1039165621 | 3300015373 | Arabidopsis Rhizosphere | SKEVIDTLRKISLEPGATSPADTTRFFGEETALWSKVIKEAGIEPQ* |
| Ga0132255_1062875231 | 3300015374 | Arabidopsis Rhizosphere | NRDVVEILKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ* |
| Ga0182041_106447052 | 3300016294 | Soil | DVVEILNGKDAGDVLRKMSLETGATAPVDTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0182033_111043531 | 3300016319 | Soil | EKINRDAVEILNGKDVGDMLRKMSLETGATAPADTARFFAEETALWSKVIKEAGIEPQ |
| Ga0182032_105044711 | 3300016357 | Soil | DVVEILNGNEGVEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0182037_116321302 | 3300016404 | Soil | SLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0184611_13000012 | 3300018067 | Groundwater Sediment | RRISLEAGATTPSDTARFFAEEKALWSKVIKEAGIEPQ |
| Ga0184625_102047052 | 3300018081 | Groundwater Sediment | SLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0190274_121560051 | 3300018476 | Soil | INRDVVEILKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ |
| Ga0190274_130407341 | 3300018476 | Soil | ARLQSLSLEVGATNPADTAKFFADETALWGKVIKEAGIEPQ |
| Ga0210403_115089212 | 3300020580 | Soil | VVEILKSKDVGNMLHKTSLEPGATAPAETMRFFAEEAALWSTVIKEAGIEPQ |
| Ga0210399_100706003 | 3300020581 | Soil | MLHKTSLEPGATAPAETMRFFAEEAALWSTVIKEAGIEPQ |
| Ga0210402_111868752 | 3300021478 | Soil | QNISLEPGATSPAETAKFFAEETALWSKVIHEAGIEPQ |
| Ga0126371_113456022 | 3300021560 | Tropical Forest Soil | GKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0247801_10747992 | 3300023064 | Soil | LQSLSLEVGATNPEETKTFFAGETALWGKVIKEAGITPQ |
| Ga0247796_10957021 | 3300023261 | Soil | RLQSLSLEVGATNPSETAKFFADETALWGKVIKEAGIEPQ |
| Ga0137417_13949101 | 3300024330 | Vadose Zone Soil | VDVLRRISLEAGATSPAETMTFFTEEAALWTNVIKEAGIAPQ |
| Ga0207684_112356422 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SLEPGATAPGETSRFFAEETALWSKVIKEAGIEPQ |
| Ga0207694_114539771 | 3300025924 | Corn Rhizosphere | VGERLASLSLEAGGTDLAGTKKFFGDETALWSKVIKDAGIKPQ |
| Ga0207659_103212202 | 3300025926 | Miscanthus Rhizosphere | KSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ |
| Ga0207706_113240922 | 3300025933 | Corn Rhizosphere | NRDVVEILKSKEVGEMLRRISLEAGATTPSGTARFFADETALWSKVIKEAGIQPQ |
| Ga0207679_112744812 | 3300025945 | Corn Rhizosphere | GEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ |
| Ga0207703_101776763 | 3300026035 | Switchgrass Rhizosphere | RLKSLSLEAGATSPAETAKFFADETALWGKVIKEAGIEPQ |
| Ga0207703_123319752 | 3300026035 | Switchgrass Rhizosphere | MLRRISLEAGATTPADTARFFADETTLWTKVIKEAGIQPQ |
| Ga0207639_105926092 | 3300026041 | Corn Rhizosphere | MLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ |
| Ga0207683_114569001 | 3300026121 | Miscanthus Rhizosphere | VVEILKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ |
| Ga0209240_10247241 | 3300026304 | Grasslands Soil | AGDVLRKLSLETGATAPAETARFFAEETSLWSKVIKEAGIEPQ |
| Ga0209472_10851262 | 3300026323 | Soil | MLHRISLEAGATAPSETSRFFAEETALWSKVIKEAGIEPQ |
| Ga0257153_10087031 | 3300026490 | Soil | VVEVLHSHEVGDMLRKLSLEPGATAPGETSRFFAEETALWSKVIKEAGIEPQ |
| Ga0209160_11403252 | 3300026532 | Soil | MSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0209577_107918012 | 3300026552 | Soil | RMSLEPGATAPSETSRFFAEETALWSKVIKEAGIEPQ |
| Ga0208997_10507461 | 3300027181 | Forest Soil | GLAEKINRDVVEILKSKDVGDTLRKISLVAGATSPAETTLFFAEETALWSKVIKEAGIEP |
| Ga0209524_10492941 | 3300027521 | Forest Soil | GAGISLEPGATSPPETARFFAEETALWAKVIAQAGIQPQ |
| Ga0209684_10328302 | 3300027527 | Tropical Forest Soil | LHGTEVGQMLQRISLEPGATTPSETSRFFAEETALWSKVIKEAGIEPQ |
| Ga0209583_102862293 | 3300027910 | Watersheds | ILQNISLEPGATSPAETAKFFAEETALWSKVIHEAGIEPQ |
| Ga0137415_108009971 | 3300028536 | Vadose Zone Soil | VLSKISLEAGATSPAETTTFFAEEAALWTNVIKEAGIAPQ |
| Ga0307279_101000831 | 3300028709 | Soil | RISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307293_100038581 | 3300028711 | Soil | SKEVGDMLRRISLEAGATRPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307285_100095811 | 3300028712 | Soil | EVGDMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307307_100047854 | 3300028718 | Soil | ELLKSREVGDMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307317_100338501 | 3300028720 | Soil | NRDVVEILKSKEVGDMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307290_100516832 | 3300028791 | Soil | DVVEILKSKEVGDMLRRISLEAGATRPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307292_100554683 | 3300028811 | Soil | GDMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307289_104457462 | 3300028875 | Soil | VVEILKSKEVGEMLRRISLEAGATTPSDTARFFAEETALWSKVIKEAGIEPQ |
| Ga0307286_101550222 | 3300028876 | Soil | ILKSKEVGDMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307304_102228291 | 3300028885 | Soil | SLEAGATAPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307495_100208031 | 3300031199 | Soil | DMLRRISLEAGATTPADTARFFAEETALWTKVIKEAGIEPQ |
| Ga0307495_101139942 | 3300031199 | Soil | LKSKEVGEMLRRISLEAGATTPSDTARFFADETALWSKVIKEAGIQPQ |
| Ga0307505_100920491 | 3300031455 | Soil | EKLANISLEVGATGTEETARFFGEEAALWGKVINEAGIKPN |
| Ga0318516_100129306 | 3300031543 | Soil | ALAEKINRDVVEILNGKDAGDVLRKMSLETGATAPVDTTRFFAEETALWSKVIKEAGIEP |
| Ga0318541_103427442 | 3300031545 | Soil | KMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318538_101701031 | 3300031546 | Soil | SLEPGAASPGETGKFFAEETALWGKVIKQAGIEPQ |
| Ga0310887_101135292 | 3300031547 | Soil | ERLQNISLEVGATSPAATAKFFADEAALWGKVIKEAGIAPN |
| Ga0318573_100291254 | 3300031564 | Soil | VTDMLRKISLEPGAASPGETGKFFAEETALWGKVIKQAGIEPQ |
| Ga0318493_104771141 | 3300031723 | Soil | MSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318500_106518671 | 3300031724 | Soil | LHGNDVVGMLHKISLEPGATTPAETAKFFADEATLWTSVIKEAGIEPQ |
| Ga0318501_100433151 | 3300031736 | Soil | NGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318501_101431631 | 3300031736 | Soil | LKTREVTDMLRKISLEPGAASPGETGKFFAEETALWGKVIKQAGIEPQ |
| Ga0307468_1006967811 | 3300031740 | Hardwood Forest Soil | ISLEPGATTPADTTRFFGEETALWSKVIKEAGIEPQ |
| Ga0306918_110087511 | 3300031744 | Soil | LRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0306918_114350481 | 3300031744 | Soil | VVEILNGKDAGDMLRKMSLETGATAPADTTRFFAEETALWSNVIKEAGIEPQ |
| Ga0318502_100360091 | 3300031747 | Soil | LNGKDVGDMLRKMSLETGATAPADTARFFAEETALWSKVIKEAGIEPQ |
| Ga0318494_105950032 | 3300031751 | Soil | DAGDVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0318537_101479321 | 3300031763 | Soil | VEILNGNEGVEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318509_107631612 | 3300031768 | Soil | DVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318526_100331894 | 3300031769 | Soil | AALAEKINRDVVEILNGKDAGDVLRKMSLETGATAPVDTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318526_101693481 | 3300031769 | Soil | ALAEKINRDVVEILNGNEGVEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEP |
| Ga0318498_100084541 | 3300031778 | Soil | LAEKINRDVVEILNGKDAGDVLRKMSLETGATAPVDTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318566_101791662 | 3300031779 | Soil | HNGKDAGDMLRKMSLETGATAPADTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318508_10039134 | 3300031780 | Soil | DVGDMLRKMSLETGATAPADTARFFAEETALWSKVIKEAGIEPQ |
| Ga0318552_104569571 | 3300031782 | Soil | EVTDMLRKISLEPGAASPGETGKFFAEETALWGKVIKQAGIEPQ |
| Ga0318529_102923861 | 3300031792 | Soil | ALAEKINHDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEP |
| Ga0318557_100043011 | 3300031795 | Soil | AEKINRYVVEILNGKDAGDVLRKMSLETGATAPVDTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318557_101654601 | 3300031795 | Soil | DVLRKMSLETGATAPADTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318576_101223771 | 3300031796 | Soil | RKMSLETGATAPADTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318576_104732041 | 3300031796 | Soil | ALTEKINRDAVEILNGKDVGDMLRKMSLETGATAPADTARFFAEETALWSKVIKEAGIEP |
| Ga0318550_100323754 | 3300031797 | Soil | AEKINRDVVEILHGKDAGDMLRKMSLESGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318565_103307761 | 3300031799 | Soil | AEKINHDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318568_100654211 | 3300031819 | Soil | DMLRKISLEPGAASPGETGKFFAEETALWGKVIKQAGIEPQ |
| Ga0318568_105428921 | 3300031819 | Soil | SLEPGATTPAETAKFFADEATLWTSVIKEAGIEPQ |
| Ga0318517_100650323 | 3300031835 | Soil | SLESGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318512_100068051 | 3300031846 | Soil | EKINRDVVEILNGKDAGDVLRKMSLETGATAPVDTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318512_100257364 | 3300031846 | Soil | SLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0318512_105243022 | 3300031846 | Soil | DVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0310904_113842831 | 3300031854 | Soil | QSLSLEVGATNPSETAKFFADETALWGKVIKEAGIEPQ |
| Ga0306919_102542491 | 3300031879 | Soil | KDAGDMLRKMSLESGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318544_100123621 | 3300031880 | Soil | AALAEKINRDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318536_103356912 | 3300031893 | Soil | MLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0306921_127756822 | 3300031912 | Soil | NGKDAGDVRRKLSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0308175_1012564242 | 3300031938 | Soil | VAERLKSLSLEAGATSPAETASFFAGETALWGKVIKEAGIEPQ |
| Ga0310912_102432073 | 3300031941 | Soil | AEKINRDVVEILNGKDAGDMLRKMSLESGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0310916_110744922 | 3300031942 | Soil | ELRLEPGGTSPAETTNFFAEETALWGGIIKEAKITGQ |
| Ga0310916_115054772 | 3300031942 | Soil | LRKMSLETGATAPADTTRFFAEETALWSNVIKEAGIEPQ |
| Ga0310910_113465432 | 3300031946 | Soil | VLRKMSLETGATAPADTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0310909_101238784 | 3300031947 | Soil | KINRDVVEILNGKDAGDMLRKMSLESGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0214473_111094893 | 3300031949 | Soil | REAGERLQALSLEVGATSPAETAKFFAEETALWTKVIKQAGITPR |
| Ga0318531_100247701 | 3300031981 | Soil | VGMLHRISLEPGATTPAETAKFFADEATLWASVIKEAGIEPQ |
| Ga0306922_114803942 | 3300032001 | Soil | AGDVLRKMSLETGATAPADTTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318569_105561102 | 3300032010 | Soil | LNGNEGVEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0310899_102695691 | 3300032017 | Soil | SLEAGATSPAETAKFFADETALWGKVIKEAGIEPQ |
| Ga0310911_103381702 | 3300032035 | Soil | GKDAGDVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0318559_101877832 | 3300032039 | Soil | DVVGMLHKISLEPGATTPAETAKFFADEATLWTSVIKEAGIEPQ |
| Ga0318556_103443762 | 3300032043 | Soil | RRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318558_101859672 | 3300032044 | Soil | RISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318570_102916182 | 3300032054 | Soil | VEILNGKDAGGMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318575_101789911 | 3300032055 | Soil | GMLHKISLEPGATTPAETAKFFADEATLWTSVIKEAGIEPQ |
| Ga0318533_100304771 | 3300032059 | Soil | STRAVVELLHGNEGVEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0318513_100378361 | 3300032065 | Soil | VSAGDVLRKMSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0318514_105306671 | 3300032066 | Soil | GKDAGDVLRKLSLETGATAPAETARFFAEETALWSKVIKEAGIEPQ |
| Ga0318553_101474521 | 3300032068 | Soil | VEMLRRISLEPGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0315281_109146681 | 3300032163 | Sediment | NEMANRLQAISLEVGATSLAETAKFFNDEAMLWSRVIKEANITPQ |
| Ga0307471_1025881922 | 3300032180 | Hardwood Forest Soil | KISLEPGATTPADTTRFFGQETALWSKVIKEAGIEPQ |
| Ga0310812_102978932 | 3300032421 | Soil | RLRNISLEVGATSPAATAKFFADEAALWGKVIKDAGITPN |
| Ga0318519_103280651 | 3300033290 | Soil | KINRDVVEILNGKDAGDMLRKMSLETGATAPAETTRFFAEETALWSKVIKEAGIEPQ |
| Ga0326726_108424682 | 3300033433 | Peat Soil | KLSLEAGATSRADTTAFFAEEAALWSKVIREAGIQPQ |
| ⦗Top⦘ |