


| Basic Information | |
|---|---|
| Family ID | F022196 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 215 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAAQEAKQKPAKK |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 215 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.91 % |
| % of genes near scaffold ends (potentially truncated) | 15.81 % |
| % of genes from short scaffolds (< 2000 bps) | 66.05 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.465 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.884 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.395 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 19.44% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 215 Family Scaffolds |
|---|---|---|
| PF14090 | HTH_39 | 7.44 |
| PF00004 | AAA | 2.79 |
| PF06056 | Terminase_5 | 1.86 |
| PF01521 | Fe-S_biosyn | 0.47 |
| PF03796 | DnaB_C | 0.47 |
| PF01833 | TIG | 0.47 |
| PF01755 | Glyco_transf_25 | 0.47 |
| PF06941 | NT5C | 0.47 |
| PF05203 | Hom_end_hint | 0.47 |
| PF16363 | GDP_Man_Dehyd | 0.47 |
| PF02622 | DUF179 | 0.47 |
| PF00154 | RecA | 0.47 |
| PF04851 | ResIII | 0.47 |
| PF02617 | ClpS | 0.47 |
| PF00313 | CSD | 0.47 |
| PF10528 | GLEYA | 0.47 |
| PF01075 | Glyco_transf_9 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.47 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.47 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.47 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.47 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.47 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.53 % |
| Unclassified | root | N/A | 40.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002161|JGI24766J26685_10009792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2584 | Open in IMG/M |
| 3300002161|JGI24766J26685_10025797 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
| 3300002835|B570J40625_100337277 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300002835|B570J40625_100486134 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300003787|Ga0007811_1002075 | All Organisms → Viruses → Predicted Viral | 2703 | Open in IMG/M |
| 3300003787|Ga0007811_1007389 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300003787|Ga0007811_1009076 | Not Available | 983 | Open in IMG/M |
| 3300003789|Ga0007835_1002156 | All Organisms → Viruses → Predicted Viral | 2406 | Open in IMG/M |
| 3300003789|Ga0007835_1007826 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300003815|Ga0007856_1007426 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti | 768 | Open in IMG/M |
| 3300004282|Ga0066599_100221824 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300004481|Ga0069718_13575347 | Not Available | 651 | Open in IMG/M |
| 3300004481|Ga0069718_15280084 | Not Available | 753 | Open in IMG/M |
| 3300004481|Ga0069718_15759077 | All Organisms → Viruses | 538 | Open in IMG/M |
| 3300004481|Ga0069718_16007698 | All Organisms → Viruses → Predicted Viral | 2614 | Open in IMG/M |
| 3300004481|Ga0069718_16169269 | All Organisms → Viruses → Predicted Viral | 2440 | Open in IMG/M |
| 3300004685|Ga0065177_1011196 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
| 3300004770|Ga0007804_1018543 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300004777|Ga0007827_10122494 | Not Available | 581 | Open in IMG/M |
| 3300004805|Ga0007792_10238024 | Not Available | 559 | Open in IMG/M |
| 3300005525|Ga0068877_10027093 | All Organisms → Viruses → Predicted Viral | 3969 | Open in IMG/M |
| 3300005527|Ga0068876_10015514 | Not Available | 4891 | Open in IMG/M |
| 3300005662|Ga0078894_10296981 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300005662|Ga0078894_10555711 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300005662|Ga0078894_10612625 | Not Available | 968 | Open in IMG/M |
| 3300005662|Ga0078894_10799262 | All Organisms → Viruses | 825 | Open in IMG/M |
| 3300005941|Ga0070743_10082327 | Not Available | 1086 | Open in IMG/M |
| 3300006037|Ga0075465_10137469 | Not Available | 553 | Open in IMG/M |
| 3300006037|Ga0075465_10147839 | All Organisms → Viruses | 534 | Open in IMG/M |
| 3300006072|Ga0007881_1005297 | All Organisms → Viruses → Predicted Viral | 4233 | Open in IMG/M |
| 3300006103|Ga0007813_1109676 | Not Available | 526 | Open in IMG/M |
| 3300006112|Ga0007857_1011351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2016 | Open in IMG/M |
| 3300006112|Ga0007857_1105189 | Not Available | 508 | Open in IMG/M |
| 3300006118|Ga0007859_1053502 | Not Available | 835 | Open in IMG/M |
| 3300006120|Ga0007867_1070815 | Not Available | 756 | Open in IMG/M |
| 3300006123|Ga0007852_1084739 | Not Available | 717 | Open in IMG/M |
| 3300006484|Ga0070744_10239979 | Not Available | 513 | Open in IMG/M |
| 3300006639|Ga0079301_1032583 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
| 3300006805|Ga0075464_10622957 | Not Available | 665 | Open in IMG/M |
| 3300006875|Ga0075473_10081461 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300006917|Ga0075472_10260763 | Not Available | 854 | Open in IMG/M |
| 3300006917|Ga0075472_10637813 | Not Available | 534 | Open in IMG/M |
| 3300007642|Ga0102876_1157675 | Not Available | 607 | Open in IMG/M |
| 3300008113|Ga0114346_1002024 | Not Available | 22156 | Open in IMG/M |
| 3300008113|Ga0114346_1019470 | All Organisms → Viruses → Predicted Viral | 3672 | Open in IMG/M |
| 3300008116|Ga0114350_1005591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6156 | Open in IMG/M |
| 3300009079|Ga0102814_10796401 | Not Available | 522 | Open in IMG/M |
| 3300009081|Ga0105098_10002012 | Not Available | 7312 | Open in IMG/M |
| 3300009082|Ga0105099_10705347 | All Organisms → Viruses | 626 | Open in IMG/M |
| 3300009082|Ga0105099_10874291 | Not Available | 566 | Open in IMG/M |
| 3300009082|Ga0105099_11027892 | Not Available | 525 | Open in IMG/M |
| 3300009151|Ga0114962_10003113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13552 | Open in IMG/M |
| 3300009151|Ga0114962_10110229 | Not Available | 1701 | Open in IMG/M |
| 3300009151|Ga0114962_10174826 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300009154|Ga0114963_10083892 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
| 3300009154|Ga0114963_10145344 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
| 3300009154|Ga0114963_10180425 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300009154|Ga0114963_10301073 | Not Available | 893 | Open in IMG/M |
| 3300009154|Ga0114963_10344203 | Not Available | 820 | Open in IMG/M |
| 3300009154|Ga0114963_10504879 | Not Available | 643 | Open in IMG/M |
| 3300009155|Ga0114968_10089837 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300009159|Ga0114978_10000050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 88394 | Open in IMG/M |
| 3300009159|Ga0114978_10031170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3809 | Open in IMG/M |
| 3300009159|Ga0114978_10052159 | All Organisms → Viruses → Predicted Viral | 2818 | Open in IMG/M |
| 3300009159|Ga0114978_10855499 | Not Available | 510 | Open in IMG/M |
| 3300009169|Ga0105097_10255154 | Not Available | 966 | Open in IMG/M |
| 3300009182|Ga0114959_10055566 | All Organisms → Viruses → Predicted Viral | 2278 | Open in IMG/M |
| 3300009184|Ga0114976_10518912 | Not Available | 612 | Open in IMG/M |
| 3300009194|Ga0114983_1001177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10554 | Open in IMG/M |
| 3300009419|Ga0114982_1006969 | All Organisms → Viruses → Predicted Viral | 4190 | Open in IMG/M |
| 3300009419|Ga0114982_1010722 | All Organisms → Viruses → Predicted Viral | 3242 | Open in IMG/M |
| 3300009419|Ga0114982_1010723 | All Organisms → Viruses → Predicted Viral | 3242 | Open in IMG/M |
| 3300009419|Ga0114982_1029979 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300009419|Ga0114982_1042823 | Not Available | 1441 | Open in IMG/M |
| 3300009419|Ga0114982_1042946 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
| 3300009419|Ga0114982_1066302 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300009419|Ga0114982_1095723 | Not Available | 918 | Open in IMG/M |
| 3300009419|Ga0114982_1169908 | Not Available | 674 | Open in IMG/M |
| 3300009474|Ga0127390_1008427 | Not Available | 3125 | Open in IMG/M |
| 3300009508|Ga0115567_10803322 | Not Available | 561 | Open in IMG/M |
| 3300009684|Ga0114958_10000752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27254 | Open in IMG/M |
| 3300009692|Ga0116171_10055872 | All Organisms → Viruses → Predicted Viral | 2534 | Open in IMG/M |
| 3300010157|Ga0114964_10027494 | All Organisms → Viruses → Predicted Viral | 3165 | Open in IMG/M |
| 3300010158|Ga0114960_10107597 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300010158|Ga0114960_10143342 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300010158|Ga0114960_10180686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300010158|Ga0114960_10216558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300010158|Ga0114960_10569986 | All Organisms → Viruses | 538 | Open in IMG/M |
| 3300010354|Ga0129333_10551506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300010374|Ga0114986_1012244 | All Organisms → Viruses → Predicted Viral | 1692 | Open in IMG/M |
| 3300010885|Ga0133913_10018884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18373 | Open in IMG/M |
| 3300010885|Ga0133913_10429494 | All Organisms → Viruses → Predicted Viral | 3489 | Open in IMG/M |
| 3300010885|Ga0133913_12170526 | Not Available | 1371 | Open in IMG/M |
| 3300010965|Ga0138308_123176 | All Organisms → Viruses → Predicted Viral | 3052 | Open in IMG/M |
| 3300011268|Ga0151620_1108865 | Not Available | 869 | Open in IMG/M |
| 3300012352|Ga0157138_1003421 | All Organisms → Viruses → Predicted Viral | 2702 | Open in IMG/M |
| 3300012663|Ga0157203_1000151 | Not Available | 24368 | Open in IMG/M |
| 3300012663|Ga0157203_1039882 | Not Available | 645 | Open in IMG/M |
| 3300012667|Ga0157208_10002470 | All Organisms → Viruses → Predicted Viral | 3556 | Open in IMG/M |
| 3300013004|Ga0164293_10069977 | All Organisms → Viruses → Predicted Viral | 2766 | Open in IMG/M |
| 3300013004|Ga0164293_10090789 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300013004|Ga0164293_10312012 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300013005|Ga0164292_10596244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 714 | Open in IMG/M |
| 3300013005|Ga0164292_10940478 | Not Available | 541 | Open in IMG/M |
| 3300013006|Ga0164294_11230146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Massilimicrobiota | 502 | Open in IMG/M |
| 3300013286|Ga0136641_1012884 | All Organisms → Viruses → Predicted Viral | 2716 | Open in IMG/M |
| 3300013286|Ga0136641_1136406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300013295|Ga0170791_14800556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300014711|Ga0134314_103549 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300014962|Ga0134315_1045885 | Not Available | 673 | Open in IMG/M |
| 3300018775|Ga0188848_1031404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300020048|Ga0207193_1241007 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300020141|Ga0211732_1541115 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300020151|Ga0211736_10138048 | All Organisms → Viruses → Predicted Viral | 3695 | Open in IMG/M |
| 3300020151|Ga0211736_10341092 | Not Available | 779 | Open in IMG/M |
| 3300020159|Ga0211734_11110979 | Not Available | 791 | Open in IMG/M |
| 3300020160|Ga0211733_10204046 | Not Available | 703 | Open in IMG/M |
| 3300020162|Ga0211735_10399990 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
| 3300020162|Ga0211735_11372393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 950 | Open in IMG/M |
| 3300020172|Ga0211729_10386524 | Not Available | 509 | Open in IMG/M |
| 3300020172|Ga0211729_10550422 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300020205|Ga0211731_10266235 | Not Available | 1243 | Open in IMG/M |
| 3300020498|Ga0208050_1027191 | Not Available | 575 | Open in IMG/M |
| 3300020527|Ga0208232_1036878 | Not Available | 651 | Open in IMG/M |
| 3300020539|Ga0207941_1045150 | All Organisms → Viruses | 577 | Open in IMG/M |
| 3300020718|Ga0214178_1002160 | Not Available | 4206 | Open in IMG/M |
| 3300021131|Ga0214206_1001166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6285 | Open in IMG/M |
| 3300021137|Ga0214165_1080275 | Not Available | 651 | Open in IMG/M |
| 3300021139|Ga0214166_1005743 | All Organisms → Viruses → Predicted Viral | 3989 | Open in IMG/M |
| 3300021142|Ga0214192_1043304 | Not Available | 1433 | Open in IMG/M |
| 3300021519|Ga0194048_10216849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Massilimicrobiota | 704 | Open in IMG/M |
| 3300021956|Ga0213922_1001946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7366 | Open in IMG/M |
| 3300021956|Ga0213922_1072464 | Not Available | 727 | Open in IMG/M |
| 3300022169|Ga0196903_1010111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
| 3300022747|Ga0228703_1003542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7929 | Open in IMG/M |
| 3300022747|Ga0228703_1024232 | All Organisms → Viruses → Predicted Viral | 1898 | Open in IMG/M |
| 3300022928|Ga0255758_10330409 | Not Available | 635 | Open in IMG/M |
| 3300023184|Ga0214919_10038044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4841 | Open in IMG/M |
| 3300023184|Ga0214919_10049541 | All Organisms → Viruses → Predicted Viral | 4037 | Open in IMG/M |
| 3300023311|Ga0256681_10192600 | Not Available | 517 | Open in IMG/M |
| 3300024343|Ga0244777_10276732 | Not Available | 1064 | Open in IMG/M |
| 3300024346|Ga0244775_10142871 | Not Available | 2022 | Open in IMG/M |
| 3300024346|Ga0244775_11511928 | Not Available | 513 | Open in IMG/M |
| 3300025353|Ga0208255_124092 | Not Available | 534 | Open in IMG/M |
| 3300025358|Ga0208504_1004370 | All Organisms → Viruses → Predicted Viral | 2296 | Open in IMG/M |
| 3300025358|Ga0208504_1008811 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300025379|Ga0208738_1000376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12280 | Open in IMG/M |
| 3300025392|Ga0208380_1004510 | All Organisms → Viruses → Predicted Viral | 2731 | Open in IMG/M |
| 3300025396|Ga0208874_1007371 | Not Available | 2113 | Open in IMG/M |
| 3300025407|Ga0208378_1017422 | Not Available | 1366 | Open in IMG/M |
| 3300025421|Ga0207958_1063522 | Not Available | 517 | Open in IMG/M |
| 3300025470|Ga0208389_1007608 | All Organisms → Viruses → Predicted Viral | 3001 | Open in IMG/M |
| 3300025570|Ga0208660_1058504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300025858|Ga0209099_1108619 | Not Available | 1192 | Open in IMG/M |
| 3300025872|Ga0208783_10163155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300027114|Ga0208009_1032851 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300027365|Ga0209300_1000985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12211 | Open in IMG/M |
| 3300027708|Ga0209188_1000278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 54983 | Open in IMG/M |
| 3300027708|Ga0209188_1000531 | Not Available | 36384 | Open in IMG/M |
| 3300027708|Ga0209188_1007272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6691 | Open in IMG/M |
| 3300027708|Ga0209188_1084466 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300027710|Ga0209599_10005909 | All Organisms → Viruses → Predicted Viral | 4194 | Open in IMG/M |
| 3300027710|Ga0209599_10007265 | All Organisms → Viruses → Predicted Viral | 3624 | Open in IMG/M |
| 3300027710|Ga0209599_10008626 | All Organisms → Viruses → Predicted Viral | 3242 | Open in IMG/M |
| 3300027710|Ga0209599_10010451 | Not Available | 2853 | Open in IMG/M |
| 3300027710|Ga0209599_10014489 | All Organisms → Viruses → Predicted Viral | 2318 | Open in IMG/M |
| 3300027710|Ga0209599_10022428 | All Organisms → Viruses → Predicted Viral | 1765 | Open in IMG/M |
| 3300027710|Ga0209599_10022832 | Not Available | 1748 | Open in IMG/M |
| 3300027710|Ga0209599_10041554 | Not Available | 1228 | Open in IMG/M |
| 3300027710|Ga0209599_10046592 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300027710|Ga0209599_10048247 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300027710|Ga0209599_10216084 | Not Available | 520 | Open in IMG/M |
| 3300027712|Ga0209499_1000496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28870 | Open in IMG/M |
| 3300027712|Ga0209499_1001282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17707 | Open in IMG/M |
| 3300027741|Ga0209085_1117713 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300027749|Ga0209084_1130085 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300027759|Ga0209296_1260214 | Not Available | 709 | Open in IMG/M |
| 3300027764|Ga0209134_10213299 | Not Available | 664 | Open in IMG/M |
| 3300027769|Ga0209770_10213155 | Not Available | 759 | Open in IMG/M |
| 3300027777|Ga0209829_10037846 | Not Available | 2650 | Open in IMG/M |
| 3300027782|Ga0209500_10000316 | Not Available | 42981 | Open in IMG/M |
| 3300027782|Ga0209500_10325939 | Not Available | 642 | Open in IMG/M |
| 3300027805|Ga0209229_10075138 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
| 3300027805|Ga0209229_10212696 | Not Available | 864 | Open in IMG/M |
| 3300027896|Ga0209777_11136530 | Not Available | 526 | Open in IMG/M |
| 3300027963|Ga0209400_1180144 | Not Available | 893 | Open in IMG/M |
| 3300027969|Ga0209191_1003011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10164 | Open in IMG/M |
| 3300027969|Ga0209191_1012933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4361 | Open in IMG/M |
| 3300027976|Ga0209702_10001759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39813 | Open in IMG/M |
| 3300028025|Ga0247723_1126200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 620 | Open in IMG/M |
| 3300028392|Ga0304729_1017953 | All Organisms → Viruses → Predicted Viral | 3076 | Open in IMG/M |
| 3300028393|Ga0304728_1116121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1284323 | Not Available | 578 | Open in IMG/M |
| 3300031758|Ga0315907_10000318 | Not Available | 70348 | Open in IMG/M |
| 3300031758|Ga0315907_10173406 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
| 3300031784|Ga0315899_10079101 | All Organisms → Viruses → Predicted Viral | 3403 | Open in IMG/M |
| 3300032050|Ga0315906_10002698 | Not Available | 24325 | Open in IMG/M |
| 3300032050|Ga0315906_10172665 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
| 3300032116|Ga0315903_10228020 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300033992|Ga0334992_0110985 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
| 3300033992|Ga0334992_0156456 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300033992|Ga0334992_0273771 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 802 | Open in IMG/M |
| 3300033994|Ga0334996_0239280 | Not Available | 941 | Open in IMG/M |
| 3300033995|Ga0335003_0345057 | Not Available | 654 | Open in IMG/M |
| 3300034018|Ga0334985_0058573 | All Organisms → Viruses → Predicted Viral | 2828 | Open in IMG/M |
| 3300034066|Ga0335019_0002165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12983 | Open in IMG/M |
| 3300034082|Ga0335020_0113984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
| 3300034095|Ga0335022_0370975 | Not Available | 784 | Open in IMG/M |
| 3300034095|Ga0335022_0648120 | All Organisms → Viruses | 527 | Open in IMG/M |
| 3300034102|Ga0335029_0347503 | Not Available | 916 | Open in IMG/M |
| 3300034161|Ga0370513_053804 | Not Available | 1052 | Open in IMG/M |
| 3300034200|Ga0335065_0524283 | Not Available | 704 | Open in IMG/M |
| 3300034279|Ga0335052_0333020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Ligilactobacillus → Ligilactobacillus agilis | 828 | Open in IMG/M |
| 3300034284|Ga0335013_0151315 | All Organisms → Viruses → Predicted Viral | 1578 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 12.09% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 11.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.19% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.79% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.33% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.86% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.86% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.40% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.40% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.93% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.47% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.47% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.47% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.47% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.47% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.47% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.47% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.47% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.47% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025470 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034161 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24766J26685_100097924 | 3300002161 | Freshwater And Sediment | MQKSIASSTGGVITFTATGLIHTAKNGAYSGKIAIKEAKQVKGKK* |
| JGI24766J26685_100257972 | 3300002161 | Freshwater And Sediment | MTQTKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKSNKGK* |
| B570J40625_1003372772 | 3300002835 | Freshwater | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAALEAKQKPAKK* |
| B570J40625_1004861344 | 3300002835 | Freshwater | MQKTITSSTGGTITFTKTGLIHKAGTAYSGKIAAVEAKQKPAKKKG* |
| Ga0007811_10020756 | 3300003787 | Freshwater | MNKTAKSSTGGTITYTKTGLIHRAGQAYSGKIAQQESKKR* |
| Ga0007811_10073893 | 3300003787 | Freshwater | MNKTAKSSTGGTITYTKTGLIHRAGNAYSGRIAQQELKKKG* |
| Ga0007811_10090761 | 3300003787 | Freshwater | MTTLPKPIASSAGGTITYTKTGLIHSAGKAYSGKIATQEEKSKKS* |
| Ga0007835_10021563 | 3300003789 | Freshwater | MNKPVKSSTGGTITYTKTGLIHRAGNTYSGKIAQQELKKKG* |
| Ga0007835_10078263 | 3300003789 | Freshwater | MNKTTPSSTGGTITYTKTGLIHKAGSTYSGKLAALEAKNKPKKG* |
| Ga0007856_10074262 | 3300003815 | Freshwater | MSTLPKPQASSTGGTITYTKTGLIHTAGKAYSGKIAQQEAKQSKGK* |
| Ga0066599_1002218242 | 3300004282 | Freshwater | MKSIPSSTGGTITPIIVNGVQVGIRHTAGKAYSGKIAAQESKLTKGKK* |
| Ga0069718_135753471 | 3300004481 | Sediment | MKSIPSSTGGTITPIMEKGVQVGIRHSAGKAYSGKIAAQEAKQKPAKK* |
| Ga0069718_152800842 | 3300004481 | Sediment | MQKTIASSTGGTITFTKTGLIHKAGTAYSGKIAAVEAKAKAPKKSK* |
| Ga0069718_157590771 | 3300004481 | Sediment | MNKPKSIPSSTGGTITFTATGLIHSAGKAYSGKIAAQEAKQKPSKK* |
| Ga0069718_160076987 | 3300004481 | Sediment | MTQPKSIASSTGGVITYTKTGLIHTAGKAYSGKIAQQESKLTKGKK* |
| Ga0069718_161692699 | 3300004481 | Sediment | MNKPKSIPSSTGGTITFTATGLIHSAGKAYSGKIAAQEAKQKPA |
| Ga0065177_10111965 | 3300004685 | Freshwater | MTKTVKSSTGGTITYTKTGLVHKTGNAYSGKIAQQEAKKR* |
| Ga0007804_10185434 | 3300004770 | Freshwater | MIKSIPSSTGGVITYTKTGLIHSAGKAYSGKIAQQEAKQKKVK* |
| Ga0007827_101224942 | 3300004777 | Freshwater | MTKTVKSSTGGIITYTKTGLIHRAGNTYSGKIAQQELKKKG* |
| Ga0007792_102380242 | 3300004805 | Freshwater | MNTLPKPQASSTGGVITYTKTGLIHTAGKAYSGKIAQQESKGK* |
| Ga0068877_100270939 | 3300005525 | Freshwater Lake | MFKKGAIMQKSIPSSTGGTITFTKTGLIHKSGNAYSGKIAAVEAKQKPVAQKG* |
| Ga0068876_1001551410 | 3300005527 | Freshwater Lake | MQKSIPSSTGGTITFTKTGLIHKSGNAYSGKIAAVEAKQKPVAQKG* |
| Ga0078894_102969813 | 3300005662 | Freshwater Lake | MQNKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQESKSTKGK* |
| Ga0078894_105557113 | 3300005662 | Freshwater Lake | MSKTIPSSTGGTITPIMEKGVQVGIRHTAGKAYSGKIAALEAKQKPAKNKG* |
| Ga0078894_106126252 | 3300005662 | Freshwater Lake | MQNKTVPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKGK* |
| Ga0078894_107992623 | 3300005662 | Freshwater Lake | QGLQMQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAAQEAKQKPAKK* |
| Ga0070743_100823273 | 3300005941 | Estuarine | MTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKSKSK* |
| Ga0075465_101374692 | 3300006037 | Aqueous | MTKSNTIISSTGGTITYTKTGLIHRSNGAYSGRVAAIESAKKSSK* |
| Ga0075465_101478393 | 3300006037 | Aqueous | SSTGGTITFTATGLIHSAGKAYSGKIAAQEAKQKPAKK* |
| Ga0007881_10052973 | 3300006072 | Freshwater | MTTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIATQEEKSKKS* |
| Ga0007813_11096761 | 3300006103 | Freshwater | MNKTAKSSTGGTITYTKTGLIHRAGQAYSGKIAQQELKKKS* |
| Ga0007857_10113518 | 3300006112 | Freshwater | MNKTAPSSTGGTITYTKTGLIHKAGSTYSGKLAALEAKNKPK |
| Ga0007857_11051892 | 3300006112 | Freshwater | LRNNMTTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIATQEEKSKKS* |
| Ga0007859_10535024 | 3300006118 | Freshwater | MSTLPKPQASSTGGTITYTKTGLIHTAGKAYSGKIAQQEAKQS |
| Ga0007867_10708151 | 3300006120 | Freshwater | MNKTAPSSTGGTITYTKTGLIHKAGSTYSGKLAALEAKNKPKKG* |
| Ga0007852_10847391 | 3300006123 | Freshwater | ASSTGGTITYTKTGLTHSAGKAYSGKIATQEEKSKKS* |
| Ga0070744_102399792 | 3300006484 | Estuarine | MQTEQKTIPSSTGGVITFTATGLIHTAGNAYSGKMAAVEAKPKSK* |
| Ga0079301_10325834 | 3300006639 | Deep Subsurface | MKSIPSSTGGTITPIIENGVQVGIRHSAGKAYSGKIAALEAKQKPAKK* |
| Ga0075464_106229571 | 3300006805 | Aqueous | MQKTFTSSTGGTVTYTKTGLIHTAGKAYSGKIAAQEAKQTKGK* |
| Ga0075473_100814614 | 3300006875 | Aqueous | MIGKSIPSSTGGTITFTKTGLIHKAGNAYSGKIAAQEAKQKPAKKTK* |
| Ga0075472_102607635 | 3300006917 | Aqueous | MKPGTTIPSSTGGVITYTKTGLIHSAGKAYSGKIAQ |
| Ga0075472_106378132 | 3300006917 | Aqueous | MIGKSIPSSTGGTITFTKTGLIHKAGTAYSGKIAAQEAKQKPAKKSK* |
| Ga0102876_11576753 | 3300007642 | Estuarine | MTLPKPIASSTGGTITYTKTGLIHSAGKAYSGNIAAQEAKSKSK* |
| Ga0114346_10020247 | 3300008113 | Freshwater, Plankton | MFKKGAIMQKSIPSSTGGTITFTKTGLIHKSGNAYSGKIAAVEAKQKPVAPKG* |
| Ga0114346_101947014 | 3300008113 | Freshwater, Plankton | MTQKSIPSSTGGVITFTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG* |
| Ga0114350_100559122 | 3300008116 | Freshwater, Plankton | MQSKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG* |
| Ga0102814_107964012 | 3300009079 | Estuarine | MTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKSNKGK* |
| Ga0105098_1000201221 | 3300009081 | Freshwater Sediment | MFNKGAIMQKSIPSSTGGTITFTKTGLIHKAGTAYSGKIAAVEAKQKPAKKKG* |
| Ga0105099_107053472 | 3300009082 | Freshwater Sediment | MQKTIASSTGGTITFTKTGLIHKAGTAYSGKIAAVEAKQKPAKKSK* |
| Ga0105099_108742912 | 3300009082 | Freshwater Sediment | MQKTIASSTSGTITFTKTGLIHKAGTAYSGKIAAVEAKQKPAKKKG* |
| Ga0105099_110278922 | 3300009082 | Freshwater Sediment | MFKIGAIMQKTIPSSTGGTITYTKTGLIHKSGNAYSGKIAAVEAKQKPAKQ* |
| Ga0114962_100031137 | 3300009151 | Freshwater Lake | MTTVPKPIPSSTGGVITYTPTGLIHSAGKAYSGKIAQQEAKGK* |
| Ga0114962_101102294 | 3300009151 | Freshwater Lake | MTTLAKPIASSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKAGK* |
| Ga0114962_101748261 | 3300009151 | Freshwater Lake | MTTVPKPIPSSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKAGK* |
| Ga0114963_100838924 | 3300009154 | Freshwater Lake | MTQPKSIPSSTGGLITFTKTGLIHSAGKAYSGKIAALEAKQKPTEK* |
| Ga0114963_101453441 | 3300009154 | Freshwater Lake | GIITYTKTGLIHTAGKAYSGKIAALEAKQKPAKN* |
| Ga0114963_101804252 | 3300009154 | Freshwater Lake | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEAKQKPGKR* |
| Ga0114963_103010732 | 3300009154 | Freshwater Lake | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEARQKPAKK* |
| Ga0114963_103442033 | 3300009154 | Freshwater Lake | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEARQKPGKK* |
| Ga0114963_105048792 | 3300009154 | Freshwater Lake | MTQTNSLPSSTGGLITYTKTGLIHKAGRTYSGRIAALEVKQKPAKK* |
| Ga0114968_100898373 | 3300009155 | Freshwater Lake | MTQPKSIPSSTGGLITFTKTGLIHSAGKAYSGKIAALEAKQKPAKK* |
| Ga0114978_1000005017 | 3300009159 | Freshwater Lake | MSQTVQSSTGGTITYTKTGLIHKAGTAYSGKIAQLEAKKPAKK* |
| Ga0114978_100311703 | 3300009159 | Freshwater Lake | MKPGTQIKSSTGGTITYTKTGLVHSAGKAYSGKLATEEAKKKG* |
| Ga0114978_100521598 | 3300009159 | Freshwater Lake | MNKQGHTMTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKSNKGK* |
| Ga0114978_108554991 | 3300009159 | Freshwater Lake | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQESKSTKGK* |
| Ga0105097_102551542 | 3300009169 | Freshwater Sediment | MTKSIASSTGGTITPVFNKEGAQTGLIHTAGKAYSGKIAAQEAKQKTKGK* |
| Ga0114959_100555665 | 3300009182 | Freshwater Lake | MTTVAKTIPSSTGGIITYTKTGLIHTAGKAYSGKIAALEAKQKPAKN* |
| Ga0114976_105189121 | 3300009184 | Freshwater Lake | MKPGTQIKSSTGGTITYTKTGLVHSAGKAYSGKLATEEAKKK |
| Ga0114983_100117711 | 3300009194 | Deep Subsurface | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKGK* |
| Ga0114982_10069695 | 3300009419 | Deep Subsurface | MQKTFTSSTGGTVTYTKTGLIHTAGKAYSGKIAAQEAKQKPAKK* |
| Ga0114982_10107228 | 3300009419 | Deep Subsurface | MQKTIASSTGGTITFTATGLIHKAGTAYSGKIAAVEAKQKPAKKSK* |
| Ga0114982_10107235 | 3300009419 | Deep Subsurface | MKAGTTVPSSTGGVITYTKTGLIHTAGKAYSGKIAQQEAKQSKGK* |
| Ga0114982_10299797 | 3300009419 | Deep Subsurface | MTQKPIASSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG* |
| Ga0114982_10428234 | 3300009419 | Deep Subsurface | MQAKSIPSSTGGTITPVFNKEGAQTGLIHTAGKAYSGKIAAQEAKQKTKGK* |
| Ga0114982_10429463 | 3300009419 | Deep Subsurface | MQNKQVPSSAGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKGK* |
| Ga0114982_10663023 | 3300009419 | Deep Subsurface | MNGKSIPSSTGGTITFTKTGLIHKAGKTYSGNIAQVEAKMKTAKKAK* |
| Ga0114982_10957232 | 3300009419 | Deep Subsurface | MQNKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQESKLTKGKK* |
| Ga0114982_11699081 | 3300009419 | Deep Subsurface | MTLPKAIASSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKQTKGK* |
| Ga0127390_10084275 | 3300009474 | Meromictic Pond | MQKSILSSTGGTITFTPTGLIHRTKSGAYSGKISLKENKQKSNVKVK* |
| Ga0115567_108033222 | 3300009508 | Pelagic Marine | STQVTIRSSSGGTITYTKTGLIHRSGGAYSGKIAALEKPPKK* |
| Ga0114958_1000075243 | 3300009684 | Freshwater Lake | MTLPKPIPSSTGGVITFTATGLNHSAGKAYSGRIAAQEAKQKPGKR* |
| Ga0116171_100558726 | 3300009692 | Anaerobic Digestor Sludge | MQKSIPSSTGGTITYTKTGLIHKAGNAYSGKAAQQDEKAKAKKK* |
| Ga0114964_100274944 | 3300010157 | Freshwater Lake | MTLPKSIPSSTGGTITFTATGLIHSAGKAYSGKIAAQEAKQKPAKK* |
| Ga0114960_101075973 | 3300010158 | Freshwater Lake | MNTTYTTSKGGTVTLTKTGLVHRTGNAYSGKIAAQEAKQKPAKK* |
| Ga0114960_101433425 | 3300010158 | Freshwater Lake | KAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEARQKPGKK* |
| Ga0114960_101806862 | 3300010158 | Freshwater Lake | MTQSKPIPSSTGGLITFTKTGLIHTAGKAYSGKIAALEAKQKPAKK* |
| Ga0114960_102165581 | 3300010158 | Freshwater Lake | TMTTVAKTIPSSTGGIITYTKTGLIHTAGKAYSGKIAALEAKQKPAKN* |
| Ga0114960_105699862 | 3300010158 | Freshwater Lake | MTKAKSIPRSTGGVITFTATGLIHSAGKAYSGKIAAQEAKQKPAKSKG* |
| Ga0129333_105515062 | 3300010354 | Freshwater To Marine Saline Gradient | MQNSIPSSTGGTITFTKTGLIHRAKSGAYSGVIATKEAKQKPAKKNG* |
| Ga0114986_10122441 | 3300010374 | Deep Subsurface | TLTHTQRNTQMQKPIPSSTGGVITYTKTGLIHTAGKAYSGKIAALEAKQKPAKK* |
| Ga0133913_1001888414 | 3300010885 | Freshwater Lake | MQKPIVSSTGGVITFTATGLIHTAKNGAYSGKIAVKEAKQVKGKK* |
| Ga0133913_1042949411 | 3300010885 | Freshwater Lake | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEAKQKPAKSKG* |
| Ga0133913_121705264 | 3300010885 | Freshwater Lake | MTQTKSLPSSTGGLITYTKTGLIHKAGRTYSGRIAALEVKQKPAKK* |
| Ga0138308_1231763 | 3300010965 | Lake Chemocline | MTLPKAIASSTGGTITFTKTGLIHTAGKAYSGKIAAQEAKQKPAKK* |
| Ga0151620_11088654 | 3300011268 | Freshwater | MKPGTTIPSSTGGVITYTKTGLIHTAGKAYSGKIAQQESKQTKGK* |
| Ga0157138_10034211 | 3300012352 | Freshwater | SSTGGTITYTATGLVHKAGTAYSGKIAQAEAKQKPAKKSK* |
| Ga0157203_100015127 | 3300012663 | Freshwater | MNTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKQKPAKR* |
| Ga0157203_10398821 | 3300012663 | Freshwater | SSTGGTITPIIVNGVQVGIRHTAGKAYSGKIATEEAKQKKSK* |
| Ga0157208_1000247010 | 3300012667 | Freshwater | MQKTITSSTGGTITFTATGLIHKAGTAYSGKIAAVEAKAKPAKKSK* |
| Ga0164293_100699777 | 3300013004 | Freshwater | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAAQEAKQKPAKK* |
| Ga0164293_100907896 | 3300013004 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKLSKGK* |
| Ga0164293_103120123 | 3300013004 | Freshwater | MTQKSIPSSTGGVITFTKTGLIHTAGKAYSGKIAAQEAKQKPAKR* |
| Ga0164292_105962443 | 3300013005 | Freshwater | MQKTIASSTGGTITFTKTGLIHSAGKAYTGKIAAQEAKQKPAKAKG* |
| Ga0164292_109404781 | 3300013005 | Freshwater | MTKSIPSSTGGTITFTKTGLIHKAGSAYSGKIAAQEAKQKPAKKKG* |
| Ga0164294_112301461 | 3300013006 | Freshwater | MNTLPKPQASSTGGVITYTKTGLIHTAGKAYSGKIAQQEAKGK* |
| Ga0136641_10128848 | 3300013286 | Freshwater | MTTLPKPIPSSTGGVITYTKTGLIHTAGKAYSGKIAQQESKGK* |
| Ga0136641_11364062 | 3300013286 | Freshwater | MNTLPKPKASSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKQKKAK* |
| Ga0170791_148005563 | 3300013295 | Freshwater | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEARQ |
| Ga0134314_1035492 | 3300014711 | Surface Water | MKIGTKIPSSTGGTIEFTKTGLIHRAGQGAYSGKLAQKEAKEKKKSK* |
| Ga0134315_10458852 | 3300014962 | Surface Water | MKIGTKIPSSTGGTIEFTKTGWIHRAGQGAYSGKLAQKEAKEKKKSK* |
| Ga0188848_10314041 | 3300018775 | Freshwater Lake | MQKTIASSTGGTITFTKTGLIHSAGKAYSGKIAAQEAKQKPSKK |
| Ga0207193_12410071 | 3300020048 | Freshwater Lake Sediment | MFNKGAIMQKSIPSSTGGTITFTKTGLIHKAGTAYSGKIAAVEAKQKPAKKK |
| Ga0211732_15411153 | 3300020141 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKSNKGK |
| Ga0211736_1013804811 | 3300020151 | Freshwater | MTQAKSIPSSTGGTITFTKTGLIHSAGKAYSGKIAAQEAKQKPAKK |
| Ga0211736_103410921 | 3300020151 | Freshwater | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAALEAKQKPSKK |
| Ga0211734_111109793 | 3300020159 | Freshwater | SSTGGTITFTKTGLIHTAGKAYSGKIAAQEAKQKPSKK |
| Ga0211733_102040461 | 3300020160 | Freshwater | MQNKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAA |
| Ga0211735_103999902 | 3300020162 | Freshwater | MTQAKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKQ |
| Ga0211735_113723932 | 3300020162 | Freshwater | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAAQEAKQKPSKK |
| Ga0211729_103865242 | 3300020172 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAQQESKSNKGK |
| Ga0211729_105504227 | 3300020172 | Freshwater | MTQKSIPSSTGGTITFTKTGLIHTAGKAYTGKIAAQEAKQKPAKAKG |
| Ga0211731_102662355 | 3300020205 | Freshwater | MTQTTKPSSTGGVITYTKTGLIHSAGKAYSGKIAAQESKLTKGKK |
| Ga0208050_10271911 | 3300020498 | Freshwater | MTQKTIPSSTGGTITFTKTGLIHKAGSAYSGKIAAQEAKQKPAKKKG |
| Ga0208232_10368781 | 3300020527 | Freshwater | MQKTITSSTGGTITFTKTGLIHKAGTAYSGKIAAVEAKQKPAKKKG |
| Ga0207941_10451502 | 3300020539 | Freshwater | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAALEAKQKPAKK |
| Ga0214178_10021606 | 3300020718 | Freshwater | MNKTTPSSTGGTITYTKTGLIHKAGSTYSGKLAALEAKNKPKKG |
| Ga0214206_100116617 | 3300021131 | Freshwater | MNKTVKSSTGGTITYTKTGLIHRAGNAYSGKIAQQELKEKG |
| Ga0214165_10802752 | 3300021137 | Freshwater | MSTLPKPQASSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKAGK |
| Ga0214166_100574313 | 3300021139 | Freshwater | MSTLPKPQASSTGGTITYTKTGLIHTAGKAYSGKIAQQEAKQSKGK |
| Ga0214192_10433041 | 3300021142 | Freshwater | MNKTAKSSTGGTITYTKTGLIHRAGQAYSGKIAQQELK |
| Ga0194048_102168493 | 3300021519 | Anoxic Zone Freshwater | MTTLPKPQASSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKGK |
| Ga0213922_100194618 | 3300021956 | Freshwater | MQNKTKPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKGK |
| Ga0213922_10724641 | 3300021956 | Freshwater | MQKTVQSSTGGTITYTKTGLIHTAGKAYSGQIAQQESKQKKSK |
| Ga0196903_10101111 | 3300022169 | Aqueous | VTIRSSSGGTITYTKTGLIHRSGGAYSGKIAALEKPPKK |
| Ga0228703_10035426 | 3300022747 | Freshwater | MKPGTTIPSSTGGTITYTKTGLVHSAGKAYSGKIAQQEAKATKSKKG |
| Ga0228703_10242324 | 3300022747 | Freshwater | MQKTVQSSTGGTITYTKTGLIHTAGKAYSGQIAQQEAKQKKSK |
| Ga0255758_103304091 | 3300022928 | Salt Marsh | MMPKENTIRSSSGGTITYTKTGLIHRSGGAYSGKIAALEKPLKK |
| Ga0214919_100380444 | 3300023184 | Freshwater | MSDKLKTIPSSAGGTITFTKTGLIHSAGKAYSGKIAAQEAKQKPAKSKG |
| Ga0214919_1004954111 | 3300023184 | Freshwater | MSDKLKSIPSSTGGTITFTKTGLIHSAGKAYSGKIAAQEAKQKPAKK |
| Ga0256681_101926001 | 3300023311 | Freshwater | MTQAKSIPSSTGGTITFTATGLIHSAGKAYSGKIAAQEAKQKPSKK |
| Ga0244777_102767325 | 3300024343 | Estuarine | KPIASSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKSKSK |
| Ga0244775_101428714 | 3300024346 | Estuarine | MTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKSKSK |
| Ga0244775_115119282 | 3300024346 | Estuarine | MQTEQKTIPSSTGGVITFTATGLIHTAGNAYSGKMAAVEAKPKSK |
| Ga0208255_1240922 | 3300025353 | Freshwater | MIKSIPSSTGGVITYTKTGLIHSAGKAYSGKIAQQEAKQKKVK |
| Ga0208504_10043706 | 3300025358 | Freshwater | MNKTAKSSTGGTITYTKTGLIHRAGQAYSGKIAQQESKKR |
| Ga0208504_10088114 | 3300025358 | Freshwater | MNKPVKSSTGGTITYTKTGLIHRAGNTYSGKIAQQELKKKG |
| Ga0208738_100037629 | 3300025379 | Freshwater | MTTLPKPIASSAGGTITYTKTGLIHSAGKAYSGKIATQEEKSKKS |
| Ga0208380_10045104 | 3300025392 | Freshwater | MTKTVKSSTGGIITYTKTGLIHRAGNTYSGKIAQQELKKKG |
| Ga0208874_10073714 | 3300025396 | Freshwater | MNKTAPSSTGGTITYTKTGLIHKAGSTYSGKLAALEAKNKPKKG |
| Ga0208378_10174222 | 3300025407 | Freshwater | MTKTVKSSTGGTITYTKTGLIHRAGQAYSGKIAQQELKKKS |
| Ga0207958_10635222 | 3300025421 | Freshwater | TLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIATQEEKSKKS |
| Ga0208389_100760811 | 3300025470 | Freshwater | MTTLPKPIASSTGGTITYTKTGLIHSAGKAYSGKIATQEEKSKKS |
| Ga0208660_10585044 | 3300025570 | Aqueous | RSSSGGTITYTKTGLIHRSGGAYSGKIAALEKPPKK |
| Ga0209099_11086192 | 3300025858 | Anaerobic Digestor Sludge | MQKSIPSSTGGTITYTKTGLIHKAGNAYSGKAAQQDEKAKAKKK |
| Ga0208783_101631552 | 3300025872 | Aqueous | MIGKSIPSSTGGTITFTKTGLIHKAGNAYSGKIAAQEAKQKPAKKTK |
| Ga0208009_10328511 | 3300027114 | Deep Subsurface | MKSIPSSTGGTITPIIENGVQVGIRHSAGKAYSGKIAALEAKQKPAKK |
| Ga0209300_100098510 | 3300027365 | Deep Subsurface | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKGK |
| Ga0209188_100027871 | 3300027708 | Freshwater Lake | MTTLAKPIASSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKAGK |
| Ga0209188_100053137 | 3300027708 | Freshwater Lake | MTTVPKPIPSSTGGVITYTPTGLIHSAGKAYSGKIAQQEAKGK |
| Ga0209188_100727213 | 3300027708 | Freshwater Lake | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEARQKPGKK |
| Ga0209188_10844664 | 3300027708 | Freshwater Lake | MTTVAKTIPSSTGGIITYTKTGLIHTAGKAYSGKIAALEAKQKPAKN |
| Ga0209599_100059099 | 3300027710 | Deep Subsurface | MQKTFTSSTGGTVTYTKTGLIHTAGKAYSGKIAAQEAKQKPAKK |
| Ga0209599_100072659 | 3300027710 | Deep Subsurface | MKAGTTVPSSTGGVITYTKTGLIHTAGKAYSGKIAQQEAKQSKGK |
| Ga0209599_100086264 | 3300027710 | Deep Subsurface | MQKTIASSTGGTITFTATGLIHKAGTAYSGKIAAVEAKQKPAKKSK |
| Ga0209599_100104516 | 3300027710 | Deep Subsurface | MQAKSIPSSTGGTITPVFNKEGAQTGLIHTAGKAYSGKIAAQEAKQKTKGK |
| Ga0209599_100144898 | 3300027710 | Deep Subsurface | MQNKSIASSTGGVITYTKTGLIHTAGKAYSGKIAAQES |
| Ga0209599_100224281 | 3300027710 | Deep Subsurface | MTQKPIASSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG |
| Ga0209599_100228324 | 3300027710 | Deep Subsurface | MQNKTVPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQSKGK |
| Ga0209599_100415542 | 3300027710 | Deep Subsurface | MTLPKAIASSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKQTKGK |
| Ga0209599_100465922 | 3300027710 | Deep Subsurface | MQNKQVPSSAGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKGK |
| Ga0209599_100482471 | 3300027710 | Deep Subsurface | MNGKSIPSSTGGTITFTKTGLIHKAGKTYSGNIAQVEAKMKTAKKAK |
| Ga0209599_102160842 | 3300027710 | Deep Subsurface | MQAKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKTKGK |
| Ga0209499_100049629 | 3300027712 | Freshwater Lake | MTLPKPIPSSTGGVITFTATGLNHSAGKAYSGRIAAQEAKQKPGKR |
| Ga0209499_100128242 | 3300027712 | Freshwater Lake | MIKSIPSSTGGVITPLIEKGVQVGIRHTAGKAYTGKIAQQEARQKKVK |
| Ga0209085_11177132 | 3300027741 | Freshwater Lake | MTKAKSIPSSTGGVITFTATGLIHSAGKAYSGKIAAQEARQKPAKK |
| Ga0209084_11300851 | 3300027749 | Freshwater Lake | MTTVPKPIPSSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKAGK |
| Ga0209296_12602142 | 3300027759 | Freshwater Lake | MNKQGHTMTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKSNKGK |
| Ga0209134_102132992 | 3300027764 | Freshwater Lake | MQKTIASSTGGLIKFTATGLIHTAGKAYSGKIAAQEAKQKPSKK |
| Ga0209770_102131551 | 3300027769 | Freshwater Lake | ASSTGGTITFTKTGLIHTAGKAYSGKIAALEAKQKPAKK |
| Ga0209829_100378461 | 3300027777 | Freshwater Lake | TTVPKPIPSSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKGK |
| Ga0209500_1000031617 | 3300027782 | Freshwater Lake | MSQTVQSSTGGTITYTKTGLIHKAGTAYSGKIAQLEAKKPAKK |
| Ga0209500_103259392 | 3300027782 | Freshwater Lake | MNKQGHTMTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQESKSTKGK |
| Ga0209229_100751384 | 3300027805 | Freshwater And Sediment | MTQTKSIASSTGGVITYTKTGLIHTAGKAYSGKIAAQESKLTKGKK |
| Ga0209229_102126962 | 3300027805 | Freshwater And Sediment | MQKSIASSTGGVITFTATGLIHTAKNGAYSGKIAIKEAKQVKGKK |
| Ga0209777_111365302 | 3300027896 | Freshwater Lake Sediment | MNTTLPKPQASSTGGTITYTKTGLIHTAGKAYSGKIAAQEAKAGK |
| Ga0209400_11801443 | 3300027963 | Freshwater Lake | MTQPKSIPSSTGGLITFTKTGLIHSAGKAYSGKIAALEAKQKPAKK |
| Ga0209191_100301114 | 3300027969 | Freshwater Lake | MQKPIVSSTGGVITFTATGLIHTAKNGAYSGKIAVKEAKQVKGKK |
| Ga0209191_10129337 | 3300027969 | Freshwater Lake | MKPGTQIKSSTGGTITYTKTGLVHSAGKAYSGKLATEEAKKKG |
| Ga0209702_1000175946 | 3300027976 | Freshwater | MSKQVTIRSSTGGTITYTKTGLIHSSGGAYSGKIAALEQPPKK |
| Ga0247723_11262001 | 3300028025 | Deep Subsurface Sediment | MQKTIASSTGGTITFTKTGLIHTAGKAYSGKIAALEA |
| Ga0304729_10179539 | 3300028392 | Freshwater Lake | MTLPKSIPSSTGGTITFTATGLIHSAGKAYSGKIAAQEAKQKPAKK |
| Ga0304728_11161211 | 3300028393 | Freshwater Lake | TVAKTIPSSTGGIITYTKTGLIHTAGKAYSGKIAALEAKQKPAKN |
| (restricted) Ga0247843_12843232 | 3300028569 | Freshwater | MNTLPKPQASSTGGTITYTKTGLIHTAGKAYTGKIADQEAKQKPAKAKG |
| Ga0315907_10000318125 | 3300031758 | Freshwater | MFKKGAIMQKSIPSSTGGTITFTKTGLIHKSGNAYSGKIAAVEAKQKPVAQKG |
| Ga0315907_101734062 | 3300031758 | Freshwater | MQSKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG |
| Ga0315899_100791011 | 3300031784 | Freshwater | KSIPSSTGGTITFTKTGLIHKSGNAYSGKIAAVEAKQKPVAPKG |
| Ga0315906_1000269847 | 3300032050 | Freshwater | MQKSIPSSTGGTITFTKTGLIHKSGNAYSGKIAAVEAKQKPVAPKG |
| Ga0315906_101726651 | 3300032050 | Freshwater | ILKQHKGHTMQSKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG |
| Ga0315903_102280206 | 3300032116 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQKPAKAKG |
| Ga0334992_0110985_349_486 | 3300033992 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKSNKGKK |
| Ga0334992_0156456_120_254 | 3300033992 | Freshwater | MTHKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKSNKGK |
| Ga0334992_0273771_502_636 | 3300033992 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKQTKGK |
| Ga0334996_0239280_762_908 | 3300033994 | Freshwater | MKSIPSSTGGTITPIMEKGVQVGIRHTAGKAYSGKIAALEAKQKPGKK |
| Ga0335003_0345057_396_530 | 3300033995 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEAKLSKGK |
| Ga0334985_0058573_42_179 | 3300034018 | Freshwater | MTQKSIPSSTGGTITFTKTGLIHTAGKAYTGKIAAQEAKQKPAKK |
| Ga0335019_0002165_4676_4816 | 3300034066 | Freshwater | MTKSIPSSTGGTITFTKTGLIHKAGSAYSGKIAAQEAKQKPAKKKG |
| Ga0335020_0113984_444_587 | 3300034082 | Freshwater | MNTLPKPIASSTGGTITFTKTGLIHSAGKAYTGKIAAQEAKQKPAAK |
| Ga0335022_0370975_3_116 | 3300034095 | Freshwater | MTQKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQEA |
| Ga0335022_0648120_177_311 | 3300034095 | Freshwater | MQKTIASSTGGTITFTKTGLTHTAGKAYSGKIAAQEAKQKPAKK |
| Ga0335029_0347503_72_203 | 3300034102 | Freshwater | MTQKSIPSSTGGTITYTKTGLIHSAGKAYSGKIAAQEAKSKSK |
| Ga0370513_053804_294_431 | 3300034161 | Untreated Peat Soil | MKHTETSSSGGTITYTKTGLIHKSGNAYTGKQAAAEAKLLEKKAK |
| Ga0335065_0524283_49_183 | 3300034200 | Freshwater | MQNKSIPSSTGGVITYTKTGLIHTAGKAYSGKIAAQESKLSKGK |
| Ga0335052_0333020_268_423 | 3300034279 | Freshwater | MSKTIPSSTGGTITPIMEKGVQVGIRHTAGKAYSGKIAALEAKQKPAKNKG |
| Ga0335013_0151315_1435_1569 | 3300034284 | Freshwater | MTQKSIPSSTGGVITFTKTGLIHTAGKAYSGKIAAQEAKLSKGK |
| Ga0335048_0413873_555_665 | 3300034356 | Freshwater | TGGTITFTKTGLIHTAGKAYTGKIAAQEAKQKPAKK |
| ⦗Top⦘ |