


| Basic Information | |
|---|---|
| Family ID | F022107 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 216 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTDEEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 216 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.52 % |
| % of genes near scaffold ends (potentially truncated) | 3.70 % |
| % of genes from short scaffolds (< 2000 bps) | 67.59 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.463 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.963 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 216 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 13.89 |
| PF00182 | Glyco_hydro_19 | 7.41 |
| PF11351 | GTA_holin_3TM | 4.17 |
| PF13539 | Peptidase_M15_4 | 3.70 |
| PF09374 | PG_binding_3 | 3.24 |
| PF01541 | GIY-YIG | 2.78 |
| PF13518 | HTH_28 | 2.78 |
| PF08681 | DUF1778 | 2.31 |
| PF01844 | HNH | 2.31 |
| PF01510 | Amidase_2 | 1.85 |
| PF13481 | AAA_25 | 0.93 |
| PF12705 | PDDEXK_1 | 0.93 |
| PF13384 | HTH_23 | 0.93 |
| PF12684 | DUF3799 | 0.93 |
| PF14090 | HTH_39 | 0.46 |
| PF13203 | DUF2201_N | 0.46 |
| PF00583 | Acetyltransf_1 | 0.46 |
| PF10991 | DUF2815 | 0.46 |
| PF05367 | Phage_endo_I | 0.46 |
| PF16778 | Phage_tail_APC | 0.46 |
| PF03118 | RNA_pol_A_CTD | 0.46 |
| PF05658 | YadA_head | 0.46 |
| PF09967 | DUF2201 | 0.46 |
| PF09588 | YqaJ | 0.46 |
| PF01464 | SLT | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 13.89 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 7.41 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 7.41 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 2.31 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.46 % |
| All Organisms | root | All Organisms | 49.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10017870 | All Organisms → cellular organisms → Bacteria | 4238 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10042990 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10063246 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10113363 | Not Available | 1088 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10119049 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1044 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10123466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10139481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 913 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10191757 | Not Available | 696 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10244940 | Not Available | 568 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10032095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2444 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10058864 | Not Available | 1628 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10078161 | Not Available | 1320 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10082183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 1271 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10106408 | Not Available | 1044 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10202120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10000159 | All Organisms → cellular organisms → Bacteria | 38371 | Open in IMG/M |
| 3300000947|BBAY92_10062081 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1010 | Open in IMG/M |
| 3300000949|BBAY94_10011458 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300001349|JGI20160J14292_10182222 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 624 | Open in IMG/M |
| 3300001349|JGI20160J14292_10225407 | Not Available | 530 | Open in IMG/M |
| 3300001352|JGI20157J14317_10023982 | Not Available | 3396 | Open in IMG/M |
| 3300001352|JGI20157J14317_10106381 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 992 | Open in IMG/M |
| 3300001460|JGI24003J15210_10010031 | Not Available | 3861 | Open in IMG/M |
| 3300001938|GOS2221_1013848 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1510 | Open in IMG/M |
| 3300005747|Ga0076924_1250538 | Not Available | 835 | Open in IMG/M |
| 3300005941|Ga0070743_10112611 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 912 | Open in IMG/M |
| 3300006027|Ga0075462_10010675 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
| 3300006027|Ga0075462_10044657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1414 | Open in IMG/M |
| 3300006027|Ga0075462_10055527 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1255 | Open in IMG/M |
| 3300006027|Ga0075462_10071924 | Not Available | 1087 | Open in IMG/M |
| 3300006027|Ga0075462_10251389 | Not Available | 524 | Open in IMG/M |
| 3300006029|Ga0075466_1183188 | Not Available | 525 | Open in IMG/M |
| 3300006752|Ga0098048_1026402 | All Organisms → Viruses | 1911 | Open in IMG/M |
| 3300006752|Ga0098048_1029713 | Not Available | 1784 | Open in IMG/M |
| 3300006752|Ga0098048_1094965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 904 | Open in IMG/M |
| 3300006793|Ga0098055_1176217 | Not Available | 817 | Open in IMG/M |
| 3300006802|Ga0070749_10504747 | Not Available | 659 | Open in IMG/M |
| 3300006803|Ga0075467_10687348 | Not Available | 521 | Open in IMG/M |
| 3300006810|Ga0070754_10012168 | Not Available | 5340 | Open in IMG/M |
| 3300006810|Ga0070754_10050513 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300006868|Ga0075481_10199556 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 715 | Open in IMG/M |
| 3300006868|Ga0075481_10348624 | Not Available | 511 | Open in IMG/M |
| 3300006916|Ga0070750_10118939 | Not Available | 1213 | Open in IMG/M |
| 3300006916|Ga0070750_10400878 | Not Available | 573 | Open in IMG/M |
| 3300006919|Ga0070746_10112159 | Not Available | 1352 | Open in IMG/M |
| 3300006919|Ga0070746_10278456 | Not Available | 774 | Open in IMG/M |
| 3300006919|Ga0070746_10438623 | Not Available | 581 | Open in IMG/M |
| 3300006920|Ga0070748_1039706 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1901 | Open in IMG/M |
| 3300006925|Ga0098050_1163464 | Not Available | 559 | Open in IMG/M |
| 3300006990|Ga0098046_1008901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2793 | Open in IMG/M |
| 3300007344|Ga0070745_1028657 | Not Available | 2405 | Open in IMG/M |
| 3300007346|Ga0070753_1173443 | Not Available | 808 | Open in IMG/M |
| 3300007346|Ga0070753_1336696 | Not Available | 534 | Open in IMG/M |
| 3300007540|Ga0099847_1146787 | Not Available | 703 | Open in IMG/M |
| 3300007540|Ga0099847_1167033 | Not Available | 650 | Open in IMG/M |
| 3300007540|Ga0099847_1247410 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 512 | Open in IMG/M |
| 3300008012|Ga0075480_10052416 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300008012|Ga0075480_10057199 | Not Available | 2267 | Open in IMG/M |
| 3300009024|Ga0102811_1054985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1500 | Open in IMG/M |
| 3300009074|Ga0115549_1001894 | Not Available | 12287 | Open in IMG/M |
| 3300009080|Ga0102815_10184285 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1148 | Open in IMG/M |
| 3300009433|Ga0115545_1068843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1322 | Open in IMG/M |
| 3300009433|Ga0115545_1078606 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1220 | Open in IMG/M |
| 3300009433|Ga0115545_1209415 | Not Available | 663 | Open in IMG/M |
| 3300009435|Ga0115546_1005606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6417 | Open in IMG/M |
| 3300009435|Ga0115546_1145728 | Not Available | 837 | Open in IMG/M |
| 3300009438|Ga0115559_1004536 | All Organisms → cellular organisms → Bacteria | 8381 | Open in IMG/M |
| 3300009438|Ga0115559_1021020 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3228 | Open in IMG/M |
| 3300009438|Ga0115559_1247183 | Not Available | 633 | Open in IMG/M |
| 3300009442|Ga0115563_1075644 | Not Available | 1505 | Open in IMG/M |
| 3300009447|Ga0115560_1347039 | Not Available | 563 | Open in IMG/M |
| 3300009467|Ga0115565_10152197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13 | 1078 | Open in IMG/M |
| 3300009467|Ga0115565_10163229 | Not Available | 1036 | Open in IMG/M |
| 3300009496|Ga0115570_10212921 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 868 | Open in IMG/M |
| 3300009505|Ga0115564_10271895 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 856 | Open in IMG/M |
| 3300009507|Ga0115572_10230996 | Not Available | 1062 | Open in IMG/M |
| 3300010150|Ga0098056_1056322 | Not Available | 1357 | Open in IMG/M |
| 3300010316|Ga0136655_1132427 | Not Available | 747 | Open in IMG/M |
| 3300010368|Ga0129324_10075916 | Not Available | 1485 | Open in IMG/M |
| 3300010368|Ga0129324_10176106 | Not Available | 879 | Open in IMG/M |
| 3300010368|Ga0129324_10210846 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 786 | Open in IMG/M |
| 3300010430|Ga0118733_105169754 | Not Available | 689 | Open in IMG/M |
| 3300011253|Ga0151671_1002234 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 7471 | Open in IMG/M |
| 3300011253|Ga0151671_1102280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 736 | Open in IMG/M |
| 3300011258|Ga0151677_1002053 | Not Available | 1575 | Open in IMG/M |
| 3300011258|Ga0151677_1021607 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1071 | Open in IMG/M |
| 3300013010|Ga0129327_10033889 | Not Available | 2615 | Open in IMG/M |
| 3300016791|Ga0182095_1584987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300017697|Ga0180120_10130880 | Not Available | 1073 | Open in IMG/M |
| 3300017697|Ga0180120_10176335 | Not Available | 895 | Open in IMG/M |
| 3300017709|Ga0181387_1003320 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
| 3300017710|Ga0181403_1026856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1218 | Open in IMG/M |
| 3300017719|Ga0181390_1009498 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300017727|Ga0181401_1031330 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1526 | Open in IMG/M |
| 3300017735|Ga0181431_1013765 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300017735|Ga0181431_1122910 | Not Available | 578 | Open in IMG/M |
| 3300017751|Ga0187219_1018595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2569 | Open in IMG/M |
| 3300017752|Ga0181400_1150766 | Not Available | 659 | Open in IMG/M |
| 3300017770|Ga0187217_1218001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 629 | Open in IMG/M |
| 3300017782|Ga0181380_1055341 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1414 | Open in IMG/M |
| 3300017783|Ga0181379_1014871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3215 | Open in IMG/M |
| 3300017783|Ga0181379_1034574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1991 | Open in IMG/M |
| 3300017786|Ga0181424_10374516 | Not Available | 582 | Open in IMG/M |
| 3300017950|Ga0181607_10072615 | Not Available | 2247 | Open in IMG/M |
| 3300017950|Ga0181607_10460171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 685 | Open in IMG/M |
| 3300018036|Ga0181600_10522141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 561 | Open in IMG/M |
| 3300018041|Ga0181601_10052598 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300018048|Ga0181606_10246264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 1013 | Open in IMG/M |
| 3300020166|Ga0206128_1018592 | All Organisms → cellular organisms → Bacteria | 4027 | Open in IMG/M |
| 3300020166|Ga0206128_1045265 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300020166|Ga0206128_1182626 | Not Available | 818 | Open in IMG/M |
| 3300021085|Ga0206677_10004066 | Not Available | 12074 | Open in IMG/M |
| 3300021185|Ga0206682_10018435 | All Organisms → Viruses → Predicted Viral | 4527 | Open in IMG/M |
| 3300021347|Ga0213862_10176030 | Not Available | 753 | Open in IMG/M |
| 3300021375|Ga0213869_10013810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4722 | Open in IMG/M |
| 3300021375|Ga0213869_10014227 | Not Available | 4638 | Open in IMG/M |
| 3300021375|Ga0213869_10249192 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 777 | Open in IMG/M |
| 3300021957|Ga0222717_10000464 | Not Available | 35145 | Open in IMG/M |
| 3300021957|Ga0222717_10005028 | Not Available | 9621 | Open in IMG/M |
| 3300021957|Ga0222717_10170169 | Not Available | 1312 | Open in IMG/M |
| 3300021957|Ga0222717_10639812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 552 | Open in IMG/M |
| 3300021958|Ga0222718_10033999 | All Organisms → Viruses | 3380 | Open in IMG/M |
| 3300021958|Ga0222718_10049915 | Not Available | 2665 | Open in IMG/M |
| 3300021959|Ga0222716_10174299 | Not Available | 1384 | Open in IMG/M |
| 3300021960|Ga0222715_10028177 | Not Available | 4077 | Open in IMG/M |
| 3300021960|Ga0222715_10049167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2921 | Open in IMG/M |
| 3300021964|Ga0222719_10046525 | Not Available | 3321 | Open in IMG/M |
| 3300021964|Ga0222719_10150563 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1641 | Open in IMG/M |
| 3300021964|Ga0222719_10265340 | Not Available | 1133 | Open in IMG/M |
| 3300022053|Ga0212030_1002089 | Not Available | 1942 | Open in IMG/M |
| 3300022053|Ga0212030_1003711 | Not Available | 1633 | Open in IMG/M |
| 3300022053|Ga0212030_1010672 | Not Available | 1138 | Open in IMG/M |
| 3300022063|Ga0212029_1020626 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 884 | Open in IMG/M |
| 3300022065|Ga0212024_1022436 | Not Available | 1036 | Open in IMG/M |
| 3300022065|Ga0212024_1048582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 743 | Open in IMG/M |
| 3300022065|Ga0212024_1105441 | Not Available | 502 | Open in IMG/M |
| 3300022067|Ga0196895_1041366 | Not Available | 531 | Open in IMG/M |
| 3300022071|Ga0212028_1044638 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 824 | Open in IMG/M |
| 3300022187|Ga0196899_1020834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2408 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10155599 | Not Available | 981 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10513432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 542 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10170950 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 881 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10053804 | Not Available | 1531 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10411868 | Not Available | 585 | Open in IMG/M |
| 3300024185|Ga0228669_1018313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1665 | Open in IMG/M |
| 3300024221|Ga0228666_1083246 | Not Available | 609 | Open in IMG/M |
| 3300024346|Ga0244775_10026765 | Not Available | 5165 | Open in IMG/M |
| 3300024346|Ga0244775_10391983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1143 | Open in IMG/M |
| 3300024508|Ga0228663_1104283 | Not Available | 512 | Open in IMG/M |
| 3300025070|Ga0208667_1008709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2438 | Open in IMG/M |
| 3300025070|Ga0208667_1015352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
| 3300025070|Ga0208667_1073149 | Not Available | 514 | Open in IMG/M |
| 3300025120|Ga0209535_1013672 | Not Available | 4396 | Open in IMG/M |
| 3300025483|Ga0209557_1003250 | Not Available | 7869 | Open in IMG/M |
| 3300025508|Ga0208148_1038012 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1254 | Open in IMG/M |
| 3300025543|Ga0208303_1027222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1555 | Open in IMG/M |
| 3300025543|Ga0208303_1046353 | Not Available | 1075 | Open in IMG/M |
| 3300025543|Ga0208303_1079988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300025590|Ga0209195_1038809 | Not Available | 1285 | Open in IMG/M |
| 3300025617|Ga0209138_1005082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8528 | Open in IMG/M |
| 3300025617|Ga0209138_1010447 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 4990 | Open in IMG/M |
| 3300025617|Ga0209138_1076116 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1067 | Open in IMG/M |
| 3300025620|Ga0209405_1010959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4311 | Open in IMG/M |
| 3300025626|Ga0209716_1020200 | Not Available | 2697 | Open in IMG/M |
| 3300025632|Ga0209194_1031264 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300025641|Ga0209833_1037766 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1737 | Open in IMG/M |
| 3300025641|Ga0209833_1131027 | Not Available | 681 | Open in IMG/M |
| 3300025645|Ga0208643_1028027 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1888 | Open in IMG/M |
| 3300025653|Ga0208428_1203684 | Not Available | 506 | Open in IMG/M |
| 3300025658|Ga0209659_1081876 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300025668|Ga0209251_1013203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 3959 | Open in IMG/M |
| 3300025668|Ga0209251_1017055 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3288 | Open in IMG/M |
| 3300025671|Ga0208898_1002772 | All Organisms → cellular organisms → Bacteria | 10540 | Open in IMG/M |
| 3300025671|Ga0208898_1169422 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 566 | Open in IMG/M |
| 3300025684|Ga0209652_1000392 | All Organisms → cellular organisms → Bacteria | 37760 | Open in IMG/M |
| 3300025684|Ga0209652_1029022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2451 | Open in IMG/M |
| 3300025684|Ga0209652_1062543 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1245 | Open in IMG/M |
| 3300025695|Ga0209653_1071612 | Not Available | 1215 | Open in IMG/M |
| 3300025696|Ga0209532_1210007 | Not Available | 549 | Open in IMG/M |
| 3300025759|Ga0208899_1002789 | All Organisms → cellular organisms → Bacteria | 11499 | Open in IMG/M |
| 3300025759|Ga0208899_1225805 | Not Available | 575 | Open in IMG/M |
| 3300025769|Ga0208767_1027505 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3002 | Open in IMG/M |
| 3300025809|Ga0209199_1086173 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1348 | Open in IMG/M |
| 3300025809|Ga0209199_1111846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 1098 | Open in IMG/M |
| 3300025832|Ga0209307_1051695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13 | 1479 | Open in IMG/M |
| 3300025849|Ga0209603_1312048 | Not Available | 545 | Open in IMG/M |
| 3300025853|Ga0208645_1006585 | Not Available | 7699 | Open in IMG/M |
| 3300025879|Ga0209555_10024809 | All Organisms → Viruses | 2882 | Open in IMG/M |
| 3300025879|Ga0209555_10071522 | Not Available | 1526 | Open in IMG/M |
| 3300025880|Ga0209534_10004755 | Not Available | 12348 | Open in IMG/M |
| 3300025889|Ga0208644_1050465 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10105108 | Not Available | 940 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10136685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1104 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10103002 | Not Available | 1152 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10133567 | Not Available | 1019 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10501272 | Not Available | 537 | Open in IMG/M |
| 3300028287|Ga0257126_1003337 | All Organisms → cellular organisms → Bacteria | 10165 | Open in IMG/M |
| 3300028416|Ga0228614_1045300 | Not Available | 963 | Open in IMG/M |
| 3300031539|Ga0307380_10049353 | All Organisms → Viruses → Predicted Viral | 4651 | Open in IMG/M |
| 3300031673|Ga0307377_10392510 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1032 | Open in IMG/M |
| 3300031851|Ga0315320_10277429 | Not Available | 1204 | Open in IMG/M |
| 3300032257|Ga0316205_10156155 | Not Available | 890 | Open in IMG/M |
| 3300032257|Ga0316205_10272576 | Not Available | 602 | Open in IMG/M |
| 3300032277|Ga0316202_10011380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4564 | Open in IMG/M |
| 3300032277|Ga0316202_10049654 | All Organisms → Viruses → Predicted Viral | 1971 | Open in IMG/M |
| 3300032277|Ga0316202_10133513 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300033742|Ga0314858_002232 | Not Available | 3078 | Open in IMG/M |
| 3300034374|Ga0348335_002453 | Not Available | 12802 | Open in IMG/M |
| 3300034375|Ga0348336_066299 | Not Available | 1381 | Open in IMG/M |
| 3300034418|Ga0348337_186314 | Not Available | 535 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 12.04% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.87% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.87% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.02% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.56% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.24% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.78% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.78% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.31% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.39% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.39% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.39% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.93% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.46% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.46% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100178709 | 3300000101 | Marine | MTDEELERKLHIAGALGCAIGFICGAGLMALVGIIF* |
| DelMOSum2010_100429903 | 3300000101 | Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMALVGVIF* |
| DelMOSum2010_100632466 | 3300000101 | Marine | MKSKFTEHEVHIAGLVGAIVGFLSGAGLMAMVGIIF* |
| DelMOSum2010_101133632 | 3300000101 | Marine | MKSKFTEHEVHIAGLVGALVGFISGAGLMAAVGIVF* |
| DelMOSum2010_101190492 | 3300000101 | Marine | MTDEEVERKIHIAGLVGAIFGFASGAGLMALVGIIF* |
| DelMOSum2010_101234662 | 3300000101 | Marine | MTDEELERKLHIAGALGCAIGFICGAGLMAAVGIIF* |
| DelMOSum2010_101394812 | 3300000101 | Marine | MKSKFTEHEVHIAGLIGAIVGFLSGAGLMAMVGIIF* |
| DelMOSum2010_101917572 | 3300000101 | Marine | MTDEELERKLHIAGALGCAIGFASGAGLMALVGIIF* |
| DelMOSum2010_102449402 | 3300000101 | Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMALVGIIF* |
| DelMOSpr2010_100320955 | 3300000116 | Marine | MTDEEIERKLHIAGALGCAIGFICGAGLMTLVGIIF* |
| DelMOSpr2010_100588642 | 3300000116 | Marine | MSDKELERMINAAGLIGAVFGFASGAGLMMMVGIIF* |
| DelMOSpr2010_100781612 | 3300000116 | Marine | MTDEEVERKIHIAGLVGAIFGFASGAGLMMLVAIIF* |
| DelMOSpr2010_100821833 | 3300000116 | Marine | MTDEEVERKIHIAGLVGAIFGFASGAGLMALVAIIF* |
| DelMOSpr2010_101064082 | 3300000116 | Marine | MTDEEVERKIHIAGALGCAIGFASGAGLMTLVGIIF* |
| DelMOSpr2010_102021202 | 3300000116 | Marine | MTDEELERKIHIAGALGCAIGFICGAGLMALVGIIF* |
| DelMOWin2010_1000015929 | 3300000117 | Marine | MIDEEVERKIHIAGLVGAIFGFISGAGLMALVGIIF* |
| DelMOWin2010_100837523 | 3300000117 | Marine | LTDEEIDKKIEIAGAIGAVVGFICGAGLMTLVGIIF* |
| BBAY92_100620812 | 3300000947 | Macroalgal Surface | MMGMSDQEIEHKIHIAGLVGAIFGFASGAGLMMMVGIIF* |
| BBAY94_100114587 | 3300000949 | Macroalgal Surface | MTDEELERKLHIAGALGCAIGLICGAGLMTLVAIIF* |
| JGI20160J14292_101822221 | 3300001349 | Pelagic Marine | MTDEELERKIHIAGLVGATFGFASGAGLMVLVAIIF* |
| JGI20160J14292_102254071 | 3300001349 | Pelagic Marine | MKSKFTEHEVHIAGLVGAIVGFLSGAGLMMMVGIIF* |
| JGI20157J14317_100239822 | 3300001352 | Pelagic Marine | MKSKFTEHEVHIAGLIGALVGFISGAGLMMLVGIIF* |
| JGI20157J14317_101063812 | 3300001352 | Pelagic Marine | MIDEEVERKINIAGLVGAIFGFASGAGLMALVGVIF* |
| JGI24003J15210_100100318 | 3300001460 | Marine | MSEEEVEKRINLAGFLGCIFGFICGAGLMTMVGVIF* |
| GOS2221_10138483 | 3300001938 | Marine | MTDEELERKIHIAGLVGAIFGFICGAGLMALVGIIF* |
| Ga0076924_10154101 | 3300005747 | Marine | LTDEEIDKKIEIAGAIGAVVGFICGAGLMTLVGII |
| Ga0076924_12505383 | 3300005747 | Marine | MKSNFTEHEVHIAGLIGAIVGFLSGAGLMTLVGIIF* |
| Ga0070743_101126113 | 3300005941 | Estuarine | MSDEEIERKIHIAGLVGAIFGFASGAGLMSMVGIIF* |
| Ga0075462_100106753 | 3300006027 | Aqueous | MTDEEVERKIHIAGLVGAIFGFISGAGLMALVGIIF* |
| Ga0075462_100446571 | 3300006027 | Aqueous | MNDEELERKLHIAGALGCAIGFICGAGLMALVGIIF* |
| Ga0075462_100555272 | 3300006027 | Aqueous | MTDEELERKLHIAGALGCAIGFICGAGLMTLVGIIF* |
| Ga0075462_100719243 | 3300006027 | Aqueous | MTDEEVERKIHIAGALGCAIGFICGAGLMAAVGIIF* |
| Ga0075462_102513892 | 3300006027 | Aqueous | MNDEEVERKIHIAGLVGAIFGFASGASLMMLVAIIF* |
| Ga0075466_11831882 | 3300006029 | Aqueous | MIDEEVERKIHIAGLVGATFGFASGAGLMMLVAIIF* |
| Ga0098048_10264023 | 3300006752 | Marine | MSDYELEKKIHIAGTVGCAVGFVCGAGLMTMVAIIF* |
| Ga0098048_10297133 | 3300006752 | Marine | MQEEEFEKKLHIAGAVGCAFGFICGAGLMTMVGIIF* |
| Ga0098048_10949652 | 3300006752 | Marine | MKSKFTEQEIHMAGLIGAIVGFISGAGLMMLVGIIF* |
| Ga0098055_11762172 | 3300006793 | Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMMLVAIIF* |
| Ga0070749_105047471 | 3300006802 | Aqueous | MTDEEVERKIHIAGALGCAIGFASGAGLMMLVAIIF* |
| Ga0075467_106873482 | 3300006803 | Aqueous | MIDEEVERKIHIAGLVGATFGFASGAGLMALVGIIF* |
| Ga0070754_100121684 | 3300006810 | Aqueous | MGMSDQEIEHKIHIAGLVGAIFGFASGAGLMMMVGIIF* |
| Ga0070754_100505133 | 3300006810 | Aqueous | MIDEDVERKIHIAGLVGAIFGFASGAGLMMLVAIIF* |
| Ga0075481_101995561 | 3300006868 | Aqueous | MSDEELERKIHIAGALGCAIGFASGAGLMALVGIIF* |
| Ga0075481_103486241 | 3300006868 | Aqueous | MTDEEVERKIHIAGALGCAIGFASGAGLMALVGIIF* |
| Ga0070750_101189391 | 3300006916 | Aqueous | MADEELERKIHIAGFVGAIFGFASGAGLMMLVAIIF* |
| Ga0070750_104008782 | 3300006916 | Aqueous | VMTDEEVERKIHIAGALGCAIGFASGAGLMALVGIIF* |
| Ga0070746_101121595 | 3300006919 | Aqueous | MKSKFTEHEVHIAGLIGAIVGFLSGAGLMTLVGIIF* |
| Ga0070746_102784561 | 3300006919 | Aqueous | MTDEEVERKIHIAGALGCAIGFICGAGLMTLVGIIF* |
| Ga0070746_104386231 | 3300006919 | Aqueous | MNDEEVERKIHIAGLVGAIFGFASGAGLMMLVAIIF* |
| Ga0070748_10397066 | 3300006920 | Aqueous | MTDEELERKLHIAGALGCAIGFICGASLMTLVGIIF* |
| Ga0098050_11634642 | 3300006925 | Marine | MSEEEIEKKIHLAGSLGCAFGFICGAGLMMLVAIIF* |
| Ga0098046_10089014 | 3300006990 | Marine | MSDEELEKKIHIAGLVGAVFGFISGAGLMALIAIIF* |
| Ga0070745_10286572 | 3300007344 | Aqueous | MKSKFTEHEVHIAGLVGAIVGFLSGAVLMALVGIIF* |
| Ga0070753_11734432 | 3300007346 | Aqueous | MTDEEIERKLHIAGALGCAIGFICGAGLMAAVGIIF* |
| Ga0070753_13366961 | 3300007346 | Aqueous | MIDEEVERKIHIAGLVGATFGFASGAGLMALVAIIF* |
| Ga0099847_11467873 | 3300007540 | Aqueous | MMTDEELERKLHIAGALGCAIGFICGAGLMTLVGVIF* |
| Ga0099847_11670332 | 3300007540 | Aqueous | MIDEEVERKIHIAGALGCAFGFASGAGLMALVGIIF* |
| Ga0099847_12474101 | 3300007540 | Aqueous | MMTDEELERKLHIAGALGCAIGFICGAGLMAAVGIIF* |
| Ga0075480_100524163 | 3300008012 | Aqueous | MIDEDVERKIHIAGLVGAIYGFASGAGLMMLVAIIF* |
| Ga0075480_100571994 | 3300008012 | Aqueous | MSDQEIEHKIHIAGLVGAIFGFASGAGLMMMVGIIF* |
| Ga0102811_10549852 | 3300009024 | Estuarine | MAMKNDEEVERLINVAGLVGAVFGFASGAGLMMLVAIIF* |
| Ga0115549_10018943 | 3300009074 | Pelagic Marine | MTDEELERKLHIAGALGCAIGFISGAGLMALVGIIF* |
| Ga0102815_101842853 | 3300009080 | Estuarine | MSDEEIERKIHIADLVGAIFGFASGAGLMSMVGIIF* |
| Ga0115545_10688432 | 3300009433 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMTLVGIIF* |
| Ga0115545_10786062 | 3300009433 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF* |
| Ga0115545_12094152 | 3300009433 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMMMVGIIF* |
| Ga0115546_10056062 | 3300009435 | Pelagic Marine | MNDKEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF* |
| Ga0115546_11457282 | 3300009435 | Pelagic Marine | MTDEEVERKLHIAGLVGAIFGFASGAGLMALVAIIF* |
| Ga0115559_10045363 | 3300009438 | Pelagic Marine | MTDEELERKIHIAGLVGAIFGFASGAGLIMLAALIF* |
| Ga0115559_10210202 | 3300009438 | Pelagic Marine | MTDEELERKLHIAGALGCAIGFISGAGLMALVAIIF* |
| Ga0115559_12471831 | 3300009438 | Pelagic Marine | MKSKFTEHEVHIAGLIGAIVGFLSGAGLMTLVAIVF* |
| Ga0115563_10756441 | 3300009442 | Pelagic Marine | MIDEEVERKINIAGLVGAIFGFASGAGLMMLVAIIF* |
| Ga0115560_13470392 | 3300009447 | Pelagic Marine | MTDEEVERKIHIAGLIGAIFGFASGSGLMMLVAIIF* |
| Ga0115565_101521972 | 3300009467 | Pelagic Marine | MIDEGVERKIHIAGLVGAIFGFASGAGLMMLVAIIF* |
| Ga0115565_101632291 | 3300009467 | Pelagic Marine | MKGNFTEHEIHIAGLVGALVGFISGAGLMMMVGIIF* |
| Ga0115570_102129212 | 3300009496 | Pelagic Marine | MTDEEVERKIHIAGLAGAIFGFASGAGLMMLVAIIF* |
| Ga0115564_102718952 | 3300009505 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMTLVAIIF* |
| Ga0115572_102309964 | 3300009507 | Pelagic Marine | MKSNFTEHEVHIAGLIGAIVGFLSGAGLMMLVGIIF* |
| Ga0098056_10563222 | 3300010150 | Marine | MTDEEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF* |
| Ga0136655_11324272 | 3300010316 | Freshwater To Marine Saline Gradient | MIDEELERKIHIAGLVGAIFGFASGAGLMMLVAIIF* |
| Ga0129324_100759164 | 3300010368 | Freshwater To Marine Saline Gradient | MTDEEVERKIHIAGALGCAIGFICGAGLMALVGIIF* |
| Ga0129324_101761062 | 3300010368 | Freshwater To Marine Saline Gradient | MTDEEVERKIHIAGLVGAIFGFASGASLMMLVAIIF* |
| Ga0129324_102108462 | 3300010368 | Freshwater To Marine Saline Gradient | MTDEELERKLHIAGALGCAIGFASGAGLMALVAIIF* |
| Ga0118733_1051697542 | 3300010430 | Marine Sediment | MSDQEIEHKIHIAGLVGAIFGFASGAGLMALVGVIF* |
| Ga0151671_100223412 | 3300011253 | Marine | MSDQEIERKIHIAGLVGAVFGFASGAGVMMLVAIIF* |
| Ga0151671_11022801 | 3300011253 | Marine | MDEQEVERMIHVAGLVGALFGFASGAGLMMLVAIIF |
| Ga0151677_10020536 | 3300011258 | Marine | MMSDQEIERKIHIAGLVGALFGFASGAGVMMLVAIIF* |
| Ga0151677_10216072 | 3300011258 | Marine | MSDQEIERKIHIAGLVGALFGFASGAGVMMLVAIIF* |
| Ga0129327_100338895 | 3300013010 | Freshwater To Marine Saline Gradient | MADEELERKIHIAGFVGAIFGFASGAGLMMLVALIF* |
| Ga0182095_15849871 | 3300016791 | Salt Marsh | MTDKEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF |
| Ga0180120_101308802 | 3300017697 | Freshwater To Marine Saline Gradient | MIDEEVERKIHIAGLVGATFGFASGAGLMALVGIIF |
| Ga0180120_101763353 | 3300017697 | Freshwater To Marine Saline Gradient | FRGGCMMTDEELERKLHIAGALGCAIGFICGAGLMTLVGVIF |
| Ga0181387_10033204 | 3300017709 | Seawater | MKSKFTEHEVHIAGLIGALVGFLSGAGLMTLVAIVF |
| Ga0181403_10268563 | 3300017710 | Seawater | MKSKFTEHEIHIAGLVGALVGFVSGAGLMALVAVIF |
| Ga0181390_100949810 | 3300017719 | Seawater | MNDKDIERKIHIAGLVGAVFGFASGAGMMMLVAIIF |
| Ga0181401_10313302 | 3300017727 | Seawater | MSDDEIEKKLHIAGAVGCAVGFICGAGLMALVGIIF |
| Ga0181431_10137655 | 3300017735 | Seawater | VGTAMEEEEFEKKLHIAGAVGCAFGFICGAGLMTMVGIIF |
| Ga0181431_11229101 | 3300017735 | Seawater | MNDEEIERKIHIAGLVGAIVGFLSGAGLMTLVAIIF |
| Ga0187219_10185951 | 3300017751 | Seawater | MKSKFTEHEIHIAGLVGALVGFVSGAGLMALVGIIF |
| Ga0181400_11507662 | 3300017752 | Seawater | MIDEEVERKIHIAGLVGAIFGFASGAGLMALIAIIF |
| Ga0187217_12180012 | 3300017770 | Seawater | MKSKFTEHEIHIAGMVGALVGFVSGAGLMALVAIIF |
| Ga0181380_10553414 | 3300017782 | Seawater | MMAMSDQEIERKIHIAGLVGAVFGFASGAGVMMLIAIIF |
| Ga0181379_10148713 | 3300017783 | Seawater | MSDQEIERKIHIAGLVGAVFGFGSGAGLMMLVAIIF |
| Ga0181379_10345746 | 3300017783 | Seawater | MDDQEIERKIHIAGLVGALFGFASGASMMMLVAIIF |
| Ga0181424_103745161 | 3300017786 | Seawater | MAMSDQEIERKIHIAGLVGAVFGFASGAGVMMLIAIIF |
| Ga0181607_100726157 | 3300017950 | Salt Marsh | MMTDEELERKLHIAGALGCAIGFICGAGLMTLVGIIF |
| Ga0181607_104601712 | 3300017950 | Salt Marsh | MTDEEVERKIHIAGLVGAIFGFASGAGLMMLVAIIF |
| Ga0181600_105221412 | 3300018036 | Salt Marsh | MIDEEVERKIHIAGLVGAIFGFASGAGLMMLVAIIF |
| Ga0181601_100525984 | 3300018041 | Salt Marsh | MIDEEVERKIHIAGLVGAIFGFASGAGLMMLVAIRF |
| Ga0181606_102462642 | 3300018048 | Salt Marsh | MTDEEVERKIHIAGALGCAIGFICGAGLMTLVGIIF |
| Ga0206128_10185924 | 3300020166 | Seawater | MTDEEVERKLHIAGLVGAIFGFASGAGLMALVGIIF |
| Ga0206128_10452653 | 3300020166 | Seawater | MIDEEVERKIHIAGLVGAIFGFASGAGLMALVGIIF |
| Ga0206128_11826262 | 3300020166 | Seawater | MTDEEVERKIHIAGLVGAIFGFASGAGLMALVAIIF |
| Ga0206677_1000406625 | 3300021085 | Seawater | MEEEEFEKKLHIAGAVGCAFGFICGAGLMTMVGIIF |
| Ga0206682_100184351 | 3300021185 | Seawater | MEEEEFEKKLHIAGAVGCAFGFICGAGLMTMVSIIF |
| Ga0213862_101760302 | 3300021347 | Seawater | MNDEEIERKLHIAGALGCAIGFICGAGLMALVGIIF |
| Ga0213869_100138103 | 3300021375 | Seawater | MIDEEVERKIHIAGLVGAIFGFISGAGLMALVGIIF |
| Ga0213869_1001422710 | 3300021375 | Seawater | MKSKFTEHEVHIAGLIGAIVGFLSGAGLMAMVGIIF |
| Ga0213869_102491921 | 3300021375 | Seawater | MTDEELERKLHIAGALGCAIGFASGAGLMALVAIIF |
| Ga0222717_1000046438 | 3300021957 | Estuarine Water | MKSKFTEHEVHIAGLVGAIFGFISGAGLMALIAIIF |
| Ga0222717_1000502815 | 3300021957 | Estuarine Water | MKSKFTEHEIHIAGLVGAIFGFISGAGLMALIAIIF |
| Ga0222717_101701692 | 3300021957 | Estuarine Water | MIDEEVERKIHIAGLVGAIFGFASGAGLMMLVALIF |
| Ga0222717_102934142 | 3300021957 | Estuarine Water | LTDEEIDKKIEIAGAVGAVVGFICGAGLMTLVGIIF |
| Ga0222717_106398122 | 3300021957 | Estuarine Water | MKSKFTEHEIHIAGLVGALVGFVSGAGLMALVAIIF |
| Ga0222718_100339992 | 3300021958 | Estuarine Water | MTDEELERKLHIAGALGCAIGFICGAGLMTLVGIIF |
| Ga0222718_100499152 | 3300021958 | Estuarine Water | MTDEELERKLHIAGALGCAIGFICGAGLMALVGIIF |
| Ga0222716_101742992 | 3300021959 | Estuarine Water | MSDQEIERKIHIAGLVGAIFGFVSGAGLMTLVGIIF |
| Ga0222715_1002817711 | 3300021960 | Estuarine Water | MDDQEIKRKIHIAGLVGAVFGFVSGAGLMTLVGIIF |
| Ga0222715_100491677 | 3300021960 | Estuarine Water | MKSKFTEHEVHIAGLVGAIVGFLSGAGLMALVGIIF |
| Ga0222719_100465253 | 3300021964 | Estuarine Water | MTDEEVERKIHIAGLVGAIFGFASGAGLMTLVGIIF |
| Ga0222719_101505633 | 3300021964 | Estuarine Water | MSDQEIERKIHIAGLVGAVFGFASGAGMMMLVAIIF |
| Ga0222719_102653402 | 3300021964 | Estuarine Water | MADEELERKIHIAGLVGAIFGFASGAGLMMLVAIIF |
| Ga0212030_10020895 | 3300022053 | Aqueous | MTDEEIERKLHIAGALGCAIGFICGAGLMAAVGIIF |
| Ga0212030_10037112 | 3300022053 | Aqueous | MTDEELERKLHIAGALGCAIGFICGAGLMAAVGIIF |
| Ga0212030_10106722 | 3300022053 | Aqueous | MTDEELERKLHIAGALGCAIGFASGAGLMALVGIIF |
| Ga0212029_10206262 | 3300022063 | Aqueous | MIDEELERKIHIAGLVGAIFGFASGAGLMMLVAIIF |
| Ga0212024_10224362 | 3300022065 | Aqueous | MTDEEVERKIHIAGLVGAIFGFISGAGLMALVGIIF |
| Ga0212024_10485822 | 3300022065 | Aqueous | MNDEEVERKIHIAGLVGAIFGFASGASLMMLVAIIF |
| Ga0212024_11054411 | 3300022065 | Aqueous | MTDEEVERKIHIAGALGCAIGFICGAGLMAAVGIIF |
| Ga0196895_10413661 | 3300022067 | Aqueous | MMGMSDQEIEHKIHIAGLVGAIFGFASGAGLMMMVGIIF |
| Ga0212028_10446382 | 3300022071 | Aqueous | MTDEEVERKIHIAGALGCAIGFASGAGLMMLVAIIF |
| Ga0212028_10710711 | 3300022071 | Aqueous | LTDEEIDKKIEIAGAIGAVVGFICGAGLMTLVGIP |
| Ga0196899_10208348 | 3300022187 | Aqueous | MKSNFTEHEVHIAGLIGAIVGFLSGAGLMTLVGIIF |
| (restricted) Ga0233412_101555992 | 3300023210 | Seawater | MSDQEIERKIHIAGLVGAVFGFVSGAGLMMLVAIIF |
| (restricted) Ga0233412_105134321 | 3300023210 | Seawater | MKSKFTEHEVHIAGLVGAVFGFISGAGLMALIAIIF |
| (restricted) Ga0255040_101709502 | 3300024059 | Seawater | MSDQEIERKIHIAGFVGAVFGFASGAGVMMLVAIIF |
| (restricted) Ga0255039_100538045 | 3300024062 | Seawater | AMIDQEIERKIHIAGLVGAIFGFASGAGLMMLVAIIF |
| (restricted) Ga0255039_104118682 | 3300024062 | Seawater | MNDKEIERKIHIAGLVGAVFGFASGAGMMMLVAIIF |
| Ga0228669_10183133 | 3300024185 | Seawater | MSDQEIERKIHIAGLVGAVFGFASGAGVMMLVAIIF |
| Ga0228666_10832461 | 3300024221 | Seawater | MTDEEVERKIHIAGLIGAIFGFASGAGLMMMVAIIF |
| Ga0244775_100267659 | 3300024346 | Estuarine | MSDEEIERKIHIAGLVGAIFGFASGAGLMSMVGIIF |
| Ga0244775_103919832 | 3300024346 | Estuarine | MAMKNDEEVERLINVAGLVGAVFGFASGAGLMMLVAIIF |
| Ga0228663_11042831 | 3300024508 | Seawater | MNVMDYQEIERKIHIAGLVGALFGFASGASMIMLVAIIF |
| Ga0208667_10087092 | 3300025070 | Marine | MSDEELEKKIHIAGLVGAVFGFISGAGLMALIAIIF |
| Ga0208667_10153524 | 3300025070 | Marine | MKSKFTEQEIHMAGLIGAIVGFISGAGLMMLVGIIF |
| Ga0208667_10731491 | 3300025070 | Marine | MSDYELEKKIHIAGTVGCAVGFVCGAGLMTMVAIIF |
| Ga0209535_10136726 | 3300025120 | Marine | MSEEEVEKRINLAGFLGCIFGFICGAGLMTMVGVIF |
| Ga0209557_100325010 | 3300025483 | Marine | MTDKEIERKIHIAGLVGALAGFVAGAGLMSAVGIIF |
| Ga0208148_10380123 | 3300025508 | Aqueous | MIDEEVERKIHIAGLVGATFGFASGAGLMMLVAIIF |
| Ga0208303_10272226 | 3300025543 | Aqueous | MKSKFTEHEVHIAGLVGAIVGFLSGAGLMAMVGIIF |
| Ga0208303_10463533 | 3300025543 | Aqueous | MTDEELERKLHIAGALGCAIGFICGAGLMTLVGVIF |
| Ga0208303_10799882 | 3300025543 | Aqueous | MTDEELERKIHIAGALGCAIGFICGAGLMALVGIIF |
| Ga0209195_10388093 | 3300025590 | Pelagic Marine | MTDEELERKLHIAGALGCAIGFISGAGLMALVGIIF |
| Ga0209138_100508214 | 3300025617 | Marine | MSEEELEKKINIAGLVGALAGFISGAALMAVVGIIF |
| Ga0209138_10104473 | 3300025617 | Marine | MTDEEVERKIHIAGLVGAIFGFASGAGLMALVGIIF |
| Ga0209138_10737271 | 3300025617 | Marine | LTDEEIDKKIEIAGAVGAVVGFICGAGLMALVGIIF |
| Ga0209138_10761162 | 3300025617 | Marine | MDDKEIERKIHIAGLVGALAGFVSGAGLMAAVGIIF |
| Ga0209405_10109592 | 3300025620 | Pelagic Marine | MKSKFTEHEVHIAGLVGAIVGFLSGAGLMMMVGIIF |
| Ga0209716_10202006 | 3300025626 | Pelagic Marine | MTDEELERKIHIAGLVGATFGFASGAGLMVLVAIIF |
| Ga0209194_10312642 | 3300025632 | Pelagic Marine | MNDKEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF |
| Ga0209833_10377664 | 3300025641 | Pelagic Marine | MTDEEVERKIHIAGLIGAIFGFASGSGLMMLVAIIF |
| Ga0209833_11310272 | 3300025641 | Pelagic Marine | MTDEELERKIHIAGLVGAIFGFASGAGLIMLAALIF |
| Ga0208643_10280271 | 3300025645 | Aqueous | MTDEELERKLHIAGALGCAIGFICGASLMTLVGIIF |
| Ga0208428_12036842 | 3300025653 | Aqueous | MTDEEVERKIHIAGALGCAIGFASGAGLMALVGIIF |
| Ga0209659_10818762 | 3300025658 | Marine | MSDEELEKKIHIAGLVGAIAGFISGVSLMALVAIIF |
| Ga0209251_10132038 | 3300025668 | Marine | MSDQEIERKIHIAGLVGAVFGFASGAGLMTLVAIIF |
| Ga0209251_10170553 | 3300025668 | Marine | MSDQEIERKIHIAGFVGAAFGFASGAGMMMLVAIIF |
| Ga0208898_100277213 | 3300025671 | Aqueous | MIDEDVERKIHIAGLVGAIFGFASGAGLMMLVAIIF |
| Ga0208898_11694222 | 3300025671 | Aqueous | MGMSDQEIEHKIHIAGLVGAIFGFASGAGLMMMVGIIF |
| Ga0209652_10003922 | 3300025684 | Marine | MTDEEVERKIHIAGLVGAIFGFASGAGLMMLVALIF |
| Ga0209652_10290222 | 3300025684 | Marine | MDDKEIERKIHIAGLIGAIFGFISGAGLMSAVGIIF |
| Ga0209652_10625433 | 3300025684 | Marine | MSDQEIERKIHIAGFVGAVFGFASGAGMMMLVAIIF |
| Ga0209653_10716123 | 3300025695 | Marine | MNDQEIERKIHIAGLVGAVFGFASGAGMMMLVAIIF |
| Ga0209532_12100071 | 3300025696 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMMLVGIIF |
| Ga0208899_10027892 | 3300025759 | Aqueous | MNDEELERKLHIAGALGCAIGFICGAGLMALVGIIF |
| Ga0208899_12258052 | 3300025759 | Aqueous | RVMTDEEVERKIHIAGALGCAIGFASGAGLMALVGIIF |
| Ga0208767_10275058 | 3300025769 | Aqueous | MADEELERKIHIAGFVGAIFGFASGAGLMMLVAIIF |
| Ga0209199_10861732 | 3300025809 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMTLVAIIF |
| Ga0209199_11118462 | 3300025809 | Pelagic Marine | MIDEEVERKIHIAGLVGAIFGFASGAGLMALVGVIF |
| Ga0209307_10516953 | 3300025832 | Pelagic Marine | MIDEGVERKIHIAGLVGAIFGFASGAGLMTLVAIIF |
| Ga0209603_13120481 | 3300025849 | Pelagic Marine | MKSNFTEHEVHIAGLIGAIVGFLSGAGLMMLVGIIF |
| Ga0208645_10065854 | 3300025853 | Aqueous | MSDQEIEHKIHIAGLVGAIFGFASGAGLMMMVGIIF |
| Ga0209555_100248095 | 3300025879 | Marine | MKSKFTEHEVHIAGLIGAIVGFLSGAGLMALVGIIF |
| Ga0209555_100715224 | 3300025879 | Marine | AMSDQEIERKIHIAGLVGAVFGFASGAGMMMLVAIIF |
| Ga0209534_100047552 | 3300025880 | Pelagic Marine | MKSKFTEHEVHIAGLIGALVGFISGAGLMMLVGIIF |
| Ga0208644_10504654 | 3300025889 | Aqueous | MTDEEVERKIHIAGLVGAIFGFASGAGFMTLVGIIF |
| (restricted) Ga0255041_101051082 | 3300027837 | Seawater | MSDREIERKIHIAGFVGAAFGFASGAGVMMLVAIIF |
| (restricted) Ga0233415_101366852 | 3300027861 | Seawater | MKSKFTEHEVHIAGLIGAIVGFLSGAALMTLVAIIF |
| (restricted) Ga0233413_101030023 | 3300027996 | Seawater | MSDQEIERKIHIAGLVGAVFGFASGSGMMMLVAIIF |
| (restricted) Ga0233413_101335672 | 3300027996 | Seawater | MIDQEIERKIHIAGLVGAIFGFASGAGLMMLVALIF |
| (restricted) Ga0233413_105012721 | 3300027996 | Seawater | MTDEEVERKIHIAGLVGAVFGFASGAGLMMLVGIIF |
| Ga0257126_10033371 | 3300028287 | Marine | MDDQEIERKIHIAGFVGAAFGFVSGAALMTLVGIIF |
| Ga0228614_10453002 | 3300028416 | Seawater | MSDQEIERKIHITGLVGAVFGFASGAGVMMLVAIIF |
| Ga0307380_100493534 | 3300031539 | Soil | MTDEEIDKKIEIAGAIGAVVGFICGAGLMTLVGIIF |
| Ga0307377_103925102 | 3300031673 | Soil | MNDEELERKLHIAGALGCAIGFICGAGLMTLVGIIF |
| Ga0315320_102774293 | 3300031851 | Seawater | MNDEEIERKIHIAGLVGALFGFASGASMMMLVGIIF |
| Ga0316205_101561551 | 3300032257 | Microbial Mat | KSKFTEHEVHIAGLIGVIVGFLSGAGLMTLVAIVF |
| Ga0316205_102725761 | 3300032257 | Microbial Mat | MIDEEVGRKIHIAGLVGATFGFASGAGLMMLVAIIF |
| Ga0316202_100113802 | 3300032277 | Microbial Mat | MKSKFTEHEVHIAGLIGVIVGFLSGAGLMTLVAIVF |
| Ga0316202_100496542 | 3300032277 | Microbial Mat | MKSKFTEHEINIAGLIGAIFGFISGAGLMTLIAIIF |
| Ga0316202_101335132 | 3300032277 | Microbial Mat | MTDEEVERKIHIAGLIGAIFGFASGAGLMMLVAIIF |
| Ga0314858_002232_141_251 | 3300033742 | Sea-Ice Brine | MKSKFTEHEVHIAGLVGALVGFVSGAGLMAMVGVIF |
| Ga0348335_002453_11183_11293 | 3300034374 | Aqueous | MKSKFTEHEVHIAGLVGAIVGFLSGAVLMALVGIIF |
| Ga0348336_066299_57_167 | 3300034375 | Aqueous | MSDEELERKIHIAGALGCAIGFASGAGLMALVGIIF |
| Ga0348337_184977_249_359 | 3300034418 | Aqueous | LTDEEIDKKIEIAGVIGAVVGFICGAGLMTLVGIIF |
| Ga0348337_186314_162_272 | 3300034418 | Aqueous | MSDEELERKIHIAGALGCAIGFICGAGLMTLVGIIF |
| ⦗Top⦘ |