


| Basic Information | |
|---|---|
| Family ID | F021980 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 216 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 215 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.72 % |
| % of genes near scaffold ends (potentially truncated) | 18.98 % |
| % of genes from short scaffolds (< 2000 bps) | 67.13 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.148 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.204 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.037 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.88% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 215 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 4.19 |
| PF07603 | DUF1566 | 2.33 |
| PF07728 | AAA_5 | 1.86 |
| PF13392 | HNH_3 | 1.86 |
| PF12850 | Metallophos_2 | 1.86 |
| PF01541 | GIY-YIG | 1.40 |
| PF02617 | ClpS | 1.40 |
| PF04851 | ResIII | 0.93 |
| PF13203 | DUF2201_N | 0.93 |
| PF00271 | Helicase_C | 0.93 |
| PF00692 | dUTPase | 0.93 |
| PF08406 | CbbQ_C | 0.93 |
| PF01503 | PRA-PH | 0.93 |
| PF02511 | Thy1 | 0.47 |
| PF01555 | N6_N4_Mtase | 0.47 |
| PF00092 | VWA | 0.47 |
| PF03167 | UDG | 0.47 |
| PF13604 | AAA_30 | 0.47 |
| PF07453 | NUMOD1 | 0.47 |
| PF07661 | MORN_2 | 0.47 |
| PF00004 | AAA | 0.47 |
| PF07463 | NUMOD4 | 0.47 |
| PF06940 | DUF1287 | 0.47 |
| PF09471 | Peptidase_M64 | 0.47 |
| PF13479 | AAA_24 | 0.47 |
| PF00136 | DNA_pol_B | 0.47 |
| PF00085 | Thioredoxin | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
|---|---|---|---|
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 0.93 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.93 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.93 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.47 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.47 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.47 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.47 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.47 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.47 |
| COG3738 | Uncharacterized conserved protein YijF, DUF1287 family | Function unknown [S] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.85 % |
| Unclassified | root | N/A | 48.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200041723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1973 | Open in IMG/M |
| 3300000882|FwDRAFT_10052801 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300000882|FwDRAFT_10141210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2580 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106480908 | Not Available | 601 | Open in IMG/M |
| 3300002447|JGI24768J34885_10038451 | Not Available | 1591 | Open in IMG/M |
| 3300002447|JGI24768J34885_10044138 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300002835|B570J40625_100019913 | Not Available | 11390 | Open in IMG/M |
| 3300002835|B570J40625_100138043 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
| 3300002835|B570J40625_100246081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300002835|B570J40625_101602882 | Not Available | 532 | Open in IMG/M |
| 3300003277|JGI25908J49247_10005870 | Not Available | 3913 | Open in IMG/M |
| 3300003277|JGI25908J49247_10007882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3361 | Open in IMG/M |
| 3300003277|JGI25908J49247_10104245 | Not Available | 681 | Open in IMG/M |
| 3300003394|JGI25907J50239_1006365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2831 | Open in IMG/M |
| 3300003430|JGI25921J50272_10024525 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1571 | Open in IMG/M |
| 3300003860|Ga0031658_1010528 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300003860|Ga0031658_1050780 | Not Available | 716 | Open in IMG/M |
| 3300004096|Ga0066177_10451915 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 564 | Open in IMG/M |
| 3300005517|Ga0070374_10284112 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 842 | Open in IMG/M |
| 3300005527|Ga0068876_10463540 | Not Available | 700 | Open in IMG/M |
| 3300005580|Ga0049083_10103277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300005582|Ga0049080_10115724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300005656|Ga0073902_10232550 | Not Available | 827 | Open in IMG/M |
| 3300005662|Ga0078894_10002658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13507 | Open in IMG/M |
| 3300005662|Ga0078894_10618157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 963 | Open in IMG/M |
| 3300005758|Ga0078117_1042602 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
| 3300005805|Ga0079957_1051100 | All Organisms → Viruses → Predicted Viral | 2533 | Open in IMG/M |
| 3300005832|Ga0074469_10015060 | Not Available | 791 | Open in IMG/M |
| 3300006037|Ga0075465_10026984 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
| 3300006056|Ga0075163_10000352 | All Organisms → cellular organisms → Bacteria | 58596 | Open in IMG/M |
| 3300006484|Ga0070744_10177312 | Not Available | 609 | Open in IMG/M |
| 3300006484|Ga0070744_10196381 | Not Available | 575 | Open in IMG/M |
| 3300006484|Ga0070744_10198603 | Not Available | 571 | Open in IMG/M |
| 3300006484|Ga0070744_10206038 | Not Available | 559 | Open in IMG/M |
| 3300006805|Ga0075464_10712756 | Not Available | 621 | Open in IMG/M |
| 3300006920|Ga0070748_1129841 | Not Available | 946 | Open in IMG/M |
| 3300006920|Ga0070748_1261022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 621 | Open in IMG/M |
| 3300007622|Ga0102863_1254875 | Not Available | 514 | Open in IMG/M |
| 3300008108|Ga0114341_10001140 | All Organisms → cellular organisms → Bacteria | 52653 | Open in IMG/M |
| 3300008113|Ga0114346_1009162 | Not Available | 7998 | Open in IMG/M |
| 3300008259|Ga0114841_1021957 | All Organisms → cellular organisms → Bacteria | 7996 | Open in IMG/M |
| 3300008259|Ga0114841_1042800 | All Organisms → Viruses → Predicted Viral | 2251 | Open in IMG/M |
| 3300008261|Ga0114336_1000685 | All Organisms → cellular organisms → Bacteria | 60271 | Open in IMG/M |
| 3300008261|Ga0114336_1012555 | All Organisms → cellular organisms → Bacteria | 5250 | Open in IMG/M |
| 3300008267|Ga0114364_1047391 | Not Available | 1564 | Open in IMG/M |
| 3300008267|Ga0114364_1060679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges → Alkanindiges illinoisensis | 1311 | Open in IMG/M |
| 3300008448|Ga0114876_1137008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300008450|Ga0114880_1002990 | Not Available | 9436 | Open in IMG/M |
| 3300008459|Ga0114865_1127440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 826 | Open in IMG/M |
| 3300009079|Ga0102814_10476615 | Not Available | 680 | Open in IMG/M |
| 3300009082|Ga0105099_10292019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 954 | Open in IMG/M |
| 3300009082|Ga0105099_10655860 | Not Available | 648 | Open in IMG/M |
| 3300009085|Ga0105103_10002433 | Not Available | 9689 | Open in IMG/M |
| 3300009085|Ga0105103_10151888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 1223 | Open in IMG/M |
| 3300009085|Ga0105103_10835662 | Not Available | 536 | Open in IMG/M |
| 3300009085|Ga0105103_10899195 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123 | 519 | Open in IMG/M |
| 3300009160|Ga0114981_10352139 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 796 | Open in IMG/M |
| 3300009161|Ga0114966_10021511 | All Organisms → cellular organisms → Bacteria | 4881 | Open in IMG/M |
| 3300009165|Ga0105102_10166524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300009165|Ga0105102_10244704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300009165|Ga0105102_10690571 | Not Available | 572 | Open in IMG/M |
| 3300009168|Ga0105104_10082804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1728 | Open in IMG/M |
| 3300009169|Ga0105097_10002857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 8570 | Open in IMG/M |
| 3300009169|Ga0105097_10090473 | Not Available | 1669 | Open in IMG/M |
| 3300009169|Ga0105097_10782632 | Not Available | 543 | Open in IMG/M |
| 3300009169|Ga0105097_10932157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300009170|Ga0105096_10766818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300009181|Ga0114969_10239860 | Not Available | 1094 | Open in IMG/M |
| 3300009419|Ga0114982_1016967 | All Organisms → Viruses → Predicted Viral | 2462 | Open in IMG/M |
| 3300009506|Ga0118657_11475107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300009681|Ga0116174_10567662 | Not Available | 511 | Open in IMG/M |
| 3300010354|Ga0129333_10173193 | All Organisms → Viruses → Predicted Viral | 1973 | Open in IMG/M |
| 3300010354|Ga0129333_10715791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300010354|Ga0129333_11238187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300010368|Ga0129324_10143850 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 998 | Open in IMG/M |
| 3300010885|Ga0133913_10201746 | Not Available | 5301 | Open in IMG/M |
| 3300010885|Ga0133913_12853563 | Not Available | 1161 | Open in IMG/M |
| 3300010942|Ga0139176_112940 | Not Available | 856 | Open in IMG/M |
| 3300010946|Ga0139175_107729 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300010966|Ga0137675_1000206 | Not Available | 5112 | Open in IMG/M |
| 3300012012|Ga0153799_1000011 | All Organisms → cellular organisms → Bacteria | 124151 | Open in IMG/M |
| 3300012667|Ga0157208_10000087 | All Organisms → cellular organisms → Bacteria | 31202 | Open in IMG/M |
| 3300015050|Ga0181338_1007039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1888 | Open in IMG/M |
| 3300015050|Ga0181338_1030142 | Not Available | 826 | Open in IMG/M |
| 3300015050|Ga0181338_1044894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300015050|Ga0181338_1066255 | Not Available | 516 | Open in IMG/M |
| 3300017700|Ga0181339_1025238 | Not Available | 659 | Open in IMG/M |
| 3300017700|Ga0181339_1037704 | Not Available | 526 | Open in IMG/M |
| 3300017716|Ga0181350_1001965 | Not Available | 5995 | Open in IMG/M |
| 3300017716|Ga0181350_1055639 | Not Available | 1040 | Open in IMG/M |
| 3300017722|Ga0181347_1040250 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300017747|Ga0181352_1071062 | Not Available | 983 | Open in IMG/M |
| 3300017754|Ga0181344_1107936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 806 | Open in IMG/M |
| 3300017754|Ga0181344_1171639 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123 | 615 | Open in IMG/M |
| 3300017778|Ga0181349_1025798 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 2383 | Open in IMG/M |
| 3300017780|Ga0181346_1004596 | Not Available | 6012 | Open in IMG/M |
| 3300017784|Ga0181348_1054373 | Not Available | 1632 | Open in IMG/M |
| 3300017785|Ga0181355_1066703 | Not Available | 1515 | Open in IMG/M |
| 3300018416|Ga0181553_10360236 | Not Available | 797 | Open in IMG/M |
| 3300019781|Ga0181360_104562 | Not Available | 1175 | Open in IMG/M |
| 3300020048|Ga0207193_1000139 | Not Available | 122312 | Open in IMG/M |
| 3300020159|Ga0211734_10930316 | Not Available | 540 | Open in IMG/M |
| 3300020167|Ga0194035_1000660 | All Organisms → cellular organisms → Bacteria | 19326 | Open in IMG/M |
| 3300020205|Ga0211731_11614456 | Not Available | 753 | Open in IMG/M |
| 3300020525|Ga0207938_1036134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 747 | Open in IMG/M |
| 3300020541|Ga0208359_1009583 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300020561|Ga0207934_1059364 | Not Available | 642 | Open in IMG/M |
| 3300020562|Ga0208597_1065059 | Not Available | 653 | Open in IMG/M |
| 3300021075|Ga0194063_10082399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
| 3300021079|Ga0194055_10278877 | Not Available | 624 | Open in IMG/M |
| 3300021141|Ga0214163_1059355 | Not Available | 966 | Open in IMG/M |
| 3300021519|Ga0194048_10145632 | Not Available | 892 | Open in IMG/M |
| 3300021600|Ga0194059_1110261 | Not Available | 853 | Open in IMG/M |
| 3300021602|Ga0194060_10139795 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300022179|Ga0181353_1075990 | Not Available | 853 | Open in IMG/M |
| 3300022407|Ga0181351_1001878 | Not Available | 7070 | Open in IMG/M |
| 3300022407|Ga0181351_1118051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 999 | Open in IMG/M |
| 3300022543|Ga0212119_1047535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10150628 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300024346|Ga0244775_10003811 | Not Available | 15953 | Open in IMG/M |
| 3300024346|Ga0244775_10399071 | Not Available | 1131 | Open in IMG/M |
| 3300024346|Ga0244775_10440905 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300024346|Ga0244775_10939985 | Not Available | 685 | Open in IMG/M |
| 3300024346|Ga0244775_11129481 | Not Available | 613 | Open in IMG/M |
| 3300024549|Ga0256308_1000004 | Not Available | 27337 | Open in IMG/M |
| 3300027418|Ga0208022_1082847 | Not Available | 676 | Open in IMG/M |
| 3300027631|Ga0208133_1105304 | Not Available | 658 | Open in IMG/M |
| 3300027693|Ga0209704_1031417 | Not Available | 1405 | Open in IMG/M |
| 3300027705|Ga0209063_1247503 | Not Available | 592 | Open in IMG/M |
| 3300027707|Ga0209443_1008454 | Not Available | 5136 | Open in IMG/M |
| 3300027710|Ga0209599_10013181 | All Organisms → Viruses → Predicted Viral | 2462 | Open in IMG/M |
| 3300027721|Ga0209492_1000743 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 10029 | Open in IMG/M |
| 3300027721|Ga0209492_1079143 | Not Available | 1161 | Open in IMG/M |
| 3300027732|Ga0209442_1075697 | Not Available | 1398 | Open in IMG/M |
| 3300027743|Ga0209593_10089239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300027754|Ga0209596_1038013 | All Organisms → Viruses → Predicted Viral | 2634 | Open in IMG/M |
| 3300027764|Ga0209134_10005363 | All Organisms → Viruses → Predicted Viral | 3757 | Open in IMG/M |
| 3300027769|Ga0209770_10011736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3959 | Open in IMG/M |
| 3300027769|Ga0209770_10203014 | Not Available | 782 | Open in IMG/M |
| 3300027770|Ga0209086_10008102 | All Organisms → cellular organisms → Bacteria | 7281 | Open in IMG/M |
| 3300027836|Ga0209230_10002833 | All Organisms → cellular organisms → Bacteria | 7189 | Open in IMG/M |
| 3300027899|Ga0209668_10000056 | All Organisms → cellular organisms → Bacteria | 43794 | Open in IMG/M |
| 3300027899|Ga0209668_10011897 | All Organisms → Viruses → Predicted Viral | 4116 | Open in IMG/M |
| 3300027899|Ga0209668_10083191 | All Organisms → Viruses → Predicted Viral | 1821 | Open in IMG/M |
| 3300027899|Ga0209668_10707041 | Not Available | 676 | Open in IMG/M |
| 3300027900|Ga0209253_10980732 | Not Available | 586 | Open in IMG/M |
| 3300027972|Ga0209079_10021230 | All Organisms → Viruses → Predicted Viral | 2155 | Open in IMG/M |
| 3300027974|Ga0209299_1320660 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 535 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10016090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2781 | Open in IMG/M |
| 3300031539|Ga0307380_10169050 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 2148 | Open in IMG/M |
| 3300031539|Ga0307380_10293866 | Not Available | 1512 | Open in IMG/M |
| 3300031539|Ga0307380_10297323 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1500 | Open in IMG/M |
| 3300031539|Ga0307380_10298030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1498 | Open in IMG/M |
| 3300031539|Ga0307380_10394802 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300031539|Ga0307380_10702889 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 851 | Open in IMG/M |
| 3300031539|Ga0307380_10788392 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031565|Ga0307379_10023791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7536 | Open in IMG/M |
| 3300031565|Ga0307379_10205292 | Not Available | 2013 | Open in IMG/M |
| 3300031565|Ga0307379_11446291 | Not Available | 551 | Open in IMG/M |
| 3300031566|Ga0307378_10023646 | All Organisms → cellular organisms → Bacteria | 7373 | Open in IMG/M |
| 3300031578|Ga0307376_10182995 | Not Available | 1437 | Open in IMG/M |
| 3300031578|Ga0307376_10262073 | Not Available | 1163 | Open in IMG/M |
| 3300031673|Ga0307377_10025775 | Not Available | 5305 | Open in IMG/M |
| 3300031707|Ga0315291_10083241 | All Organisms → Viruses → Predicted Viral | 3494 | Open in IMG/M |
| 3300031707|Ga0315291_10413460 | Not Available | 1279 | Open in IMG/M |
| 3300031746|Ga0315293_10178210 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300031746|Ga0315293_10332878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
| 3300031746|Ga0315293_10365190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300031746|Ga0315293_10455377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 996 | Open in IMG/M |
| 3300031772|Ga0315288_10702656 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031784|Ga0315899_10026385 | Not Available | 6143 | Open in IMG/M |
| 3300031784|Ga0315899_10323631 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 1519 | Open in IMG/M |
| 3300031784|Ga0315899_10943833 | Not Available | 773 | Open in IMG/M |
| 3300031786|Ga0315908_10361545 | Not Available | 1215 | Open in IMG/M |
| 3300031857|Ga0315909_10023804 | Not Available | 6084 | Open in IMG/M |
| 3300031857|Ga0315909_10132396 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 2086 | Open in IMG/M |
| 3300031857|Ga0315909_10356220 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300031952|Ga0315294_10009717 | All Organisms → cellular organisms → Bacteria | 10556 | Open in IMG/M |
| 3300031952|Ga0315294_10160994 | All Organisms → Viruses → Predicted Viral | 2267 | Open in IMG/M |
| 3300031952|Ga0315294_10857123 | Not Available | 775 | Open in IMG/M |
| 3300031952|Ga0315294_10984965 | Not Available | 705 | Open in IMG/M |
| 3300031952|Ga0315294_11448898 | Not Available | 540 | Open in IMG/M |
| 3300031963|Ga0315901_10455145 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300031963|Ga0315901_10555400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter endophyticus | 882 | Open in IMG/M |
| 3300031963|Ga0315901_10669299 | Not Available | 775 | Open in IMG/M |
| 3300031999|Ga0315274_10020423 | All Organisms → cellular organisms → Bacteria | 9295 | Open in IMG/M |
| 3300031999|Ga0315274_10505753 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300031999|Ga0315274_10838320 | Not Available | 968 | Open in IMG/M |
| 3300031999|Ga0315274_10911654 | Not Available | 913 | Open in IMG/M |
| 3300032050|Ga0315906_10061696 | All Organisms → cellular organisms → Bacteria | 3857 | Open in IMG/M |
| 3300032050|Ga0315906_11284784 | Not Available | 523 | Open in IMG/M |
| 3300032053|Ga0315284_10029688 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 7668 | Open in IMG/M |
| 3300032053|Ga0315284_10108006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 3711 | Open in IMG/M |
| 3300032053|Ga0315284_10108006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 3711 | Open in IMG/M |
| 3300032116|Ga0315903_10273953 | Not Available | 1443 | Open in IMG/M |
| 3300032116|Ga0315903_10887287 | Not Available | 639 | Open in IMG/M |
| 3300032118|Ga0315277_10154613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 2537 | Open in IMG/M |
| 3300032516|Ga0315273_12325500 | Not Available | 624 | Open in IMG/M |
| 3300033978|Ga0334977_0072170 | Not Available | 1880 | Open in IMG/M |
| 3300033984|Ga0334989_0109066 | Not Available | 1537 | Open in IMG/M |
| 3300033984|Ga0334989_0207280 | Not Available | 1075 | Open in IMG/M |
| 3300033984|Ga0334989_0285653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 882 | Open in IMG/M |
| 3300033993|Ga0334994_0000890 | Not Available | 21960 | Open in IMG/M |
| 3300033996|Ga0334979_0248854 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123 | 1028 | Open in IMG/M |
| 3300034018|Ga0334985_0007193 | Not Available | 8961 | Open in IMG/M |
| 3300034022|Ga0335005_0000015 | Not Available | 117174 | Open in IMG/M |
| 3300034060|Ga0334983_0054891 | All Organisms → Viruses → Predicted Viral | 2596 | Open in IMG/M |
| 3300034063|Ga0335000_0411475 | Not Available | 802 | Open in IMG/M |
| 3300034068|Ga0334990_0009194 | Not Available | 5286 | Open in IMG/M |
| 3300034082|Ga0335020_0003362 | Not Available | 10642 | Open in IMG/M |
| 3300034096|Ga0335025_0246727 | Not Available | 981 | Open in IMG/M |
| 3300034104|Ga0335031_0000349 | Not Available | 36817 | Open in IMG/M |
| 3300034105|Ga0335035_0449968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 717 | Open in IMG/M |
| 3300034108|Ga0335050_0051625 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2562 | Open in IMG/M |
| 3300034109|Ga0335051_0008527 | Not Available | 5686 | Open in IMG/M |
| 3300034111|Ga0335063_0315019 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 824 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.20% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 6.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.63% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.63% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.70% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.24% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.85% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.39% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.39% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.93% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.93% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.93% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.93% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.93% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.46% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.46% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.46% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.46% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.46% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.46% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.46% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.46% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.46% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010942 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C3 | Engineered | Open in IMG/M |
| 3300010946 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1 | Engineered | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027705 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes) | Engineered | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200257569 | 2199352005 | Freshwater | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNK |
| FwDRAFT_100528016 | 3300000882 | Freshwater And Marine | MNNFICSECGTKYSSPETTPPPGIKWSDGHVCTPEPVKNKL* |
| FwDRAFT_101412104 | 3300000882 | Freshwater And Marine | MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKPVNK* |
| JGIcombinedJ13530_1064809081 | 3300001213 | Wetland | KFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVE* |
| JGI24768J34885_100384512 | 3300002447 | Freshwater And Sediment | MNKFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSK* |
| JGI24768J34885_100441382 | 3300002447 | Freshwater And Sediment | MNKFICSECGTIYGSPETTPPPGIKWSDGHICTPKPVNNG* |
| B570J40625_10001991323 | 3300002835 | Freshwater | MNKFECSECGTIYRSPETTPPPGIKWSDGHTCNPKPVNNEK* |
| B570J40625_1001380434 | 3300002835 | Freshwater | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNK* |
| B570J40625_1002460816 | 3300002835 | Freshwater | MNKFICNECGTKYSSPELTPPPGIKWSDGHVCKPKPINHEK* |
| B570J40625_1016028821 | 3300002835 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVDNEK* |
| JGI25908J49247_100058705 | 3300003277 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVNK* |
| JGI25908J49247_100078826 | 3300003277 | Freshwater Lake | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK* |
| JGI25908J49247_101042453 | 3300003277 | Freshwater Lake | MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPLKQTT* |
| JGI25907J50239_10063651 | 3300003394 | Freshwater Lake | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENG |
| JGI25921J50272_100245253 | 3300003430 | Freshwater Lake | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVDNGK* |
| Ga0031658_10105286 | 3300003860 | Freshwater Lake Sediment | MNRFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK* |
| Ga0031658_10507803 | 3300003860 | Freshwater Lake Sediment | MNKFICSECGTKXXSPXLTPPPGIKWSDGHVCTPKPVNNGK* |
| Ga0066177_104519151 | 3300004096 | Freshwater Lake | MNKFECSECGTRYSSPEKTPPPGIKWSDGHVCTPKPINKQ* |
| Ga0070374_102841121 | 3300005517 | Freshwater Lake | MNKFECSECGTRYSSPEKTPPPGIKWSDGHVCTPK |
| Ga0068876_104635403 | 3300005527 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKK* |
| Ga0049083_101032772 | 3300005580 | Freshwater Lentic | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVTS* |
| Ga0049080_101157243 | 3300005582 | Freshwater Lentic | MNNFVCSECGTKYSSPETTPPPGIKWSDGHVCTPQPVKK* |
| Ga0073902_102325501 | 3300005656 | Activated Sludge | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVEKV* |
| Ga0078894_100026584 | 3300005662 | Freshwater Lake | MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK* |
| Ga0078894_106181574 | 3300005662 | Freshwater Lake | MNKFECSECGTSYSSPETTPPPGIKWSDGHVCTPKPVNK* |
| Ga0078117_10426023 | 3300005758 | Lake Water | MYKFICKECGTRFTSAHKEPPPGIKWDDGHVCTPVPVKQ* |
| Ga0079957_10511001 | 3300005805 | Lake | MNEFICNVCGTKYRSPKTTPPPGIKWSDGHICTPKPIKTK* |
| Ga0074469_100150602 | 3300005832 | Sediment (Intertidal) | MNNTMMKPLNQNKAMNKFICSECGTKYSSPETTPPPGIKWSDGHICTPKAVN* |
| Ga0075465_100269843 | 3300006037 | Aqueous | MNKFVCSECGTKYSSPETTPPPGIKWSDGHVCTPQPVSK* |
| Ga0075163_1000035213 | 3300006056 | Wastewater Effluent | MNKFVCSECGTKYQSPELTPPPGIKWSDGHVCTPKPVEKCQEMQ* |
| Ga0070744_101773121 | 3300006484 | Estuarine | MNKFECSECGTKYNSPETTPPPGIKWSDGHTCNPKPVNNEK* |
| Ga0070744_101963812 | 3300006484 | Estuarine | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKLVKQ* |
| Ga0070744_101986031 | 3300006484 | Estuarine | MNNFICDECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEQAN* |
| Ga0070744_102060382 | 3300006484 | Estuarine | MNNFECSECGTKYSSQETTPPPGIKWSDGHICNPKPVDNG* |
| Ga0075464_107127562 | 3300006805 | Aqueous | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK* |
| Ga0070748_11298413 | 3300006920 | Aqueous | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNKQHGNIHP* |
| Ga0070748_12610221 | 3300006920 | Aqueous | NKFICSECGTKYSSPEKTPPPGIKWSDGHVCTPKSVNK* |
| Ga0102863_12548752 | 3300007622 | Estuarine | MNKFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVKQ* |
| Ga0114341_1000114025 | 3300008108 | Freshwater, Plankton | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK* |
| Ga0114346_100916215 | 3300008113 | Freshwater, Plankton | MNKFKCSECGTIYSSPETTPPPGIKWSDGHVCTPKPLKQ* |
| Ga0114841_102195716 | 3300008259 | Freshwater, Plankton | MNNFICSGCGTKYTSPETTPPPGIKWSDGHVCTPVPVKP* |
| Ga0114841_10428004 | 3300008259 | Freshwater, Plankton | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK* |
| Ga0114336_100068530 | 3300008261 | Freshwater, Plankton | MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVNNGK* |
| Ga0114336_101255511 | 3300008261 | Freshwater, Plankton | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK* |
| Ga0114364_10473912 | 3300008267 | Freshwater, Plankton | MNKFVCSECGTKYSSPETTPPPGIKWSDGHVCTPVPVKP* |
| Ga0114364_10606791 | 3300008267 | Freshwater, Plankton | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKP |
| Ga0114876_11370084 | 3300008448 | Freshwater Lake | SECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK* |
| Ga0114880_100299012 | 3300008450 | Freshwater Lake | MNKFVCNECGTKYSSPETTPPPGIKWSDGHTCNPKPVKK* |
| Ga0114865_11274404 | 3300008459 | Freshwater Lake | NFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK* |
| Ga0102814_104766151 | 3300009079 | Estuarine | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVK* |
| Ga0105099_102920193 | 3300009082 | Freshwater Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVDNGR* |
| Ga0105099_106558602 | 3300009082 | Freshwater Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHICTPKPVK* |
| Ga0105103_100024333 | 3300009085 | Freshwater Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKLVKE* |
| Ga0105103_101518884 | 3300009085 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCNPKPLKTK* |
| Ga0105103_108356621 | 3300009085 | Freshwater Sediment | ICSECGTKYSSPETTPPPGIKWSDGHVCTPKSVKE* |
| Ga0105103_108991952 | 3300009085 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWSDGHTCKPKLVKE* |
| Ga0114981_103521393 | 3300009160 | Freshwater Lake | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTLKPVDNGK* |
| Ga0114966_1002151114 | 3300009161 | Freshwater Lake | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK* |
| Ga0105102_101665243 | 3300009165 | Freshwater Sediment | MNKFICNECGTKYSSPETTPPPGIKWSDGHTCNPKLVNNGK* |
| Ga0105102_102447042 | 3300009165 | Freshwater Sediment | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPEPVKTK* |
| Ga0105102_106905712 | 3300009165 | Freshwater Sediment | MNKFICNECGTKYSSPETTPPPGIKWSDGHVCTPKPVNNGR* |
| Ga0105104_100828044 | 3300009168 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKLVDNGK* |
| Ga0105097_100028579 | 3300009169 | Freshwater Sediment | MNKFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVKR* |
| Ga0105097_100904734 | 3300009169 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWNDGHVCTPKLVKE* |
| Ga0105097_107826322 | 3300009169 | Freshwater Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKKSL* |
| Ga0105097_109321571 | 3300009169 | Freshwater Sediment | TMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK* |
| Ga0105096_107668181 | 3300009170 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK* |
| Ga0114969_102398604 | 3300009181 | Freshwater Lake | MNKFICSKCGTKYSSPELTPPPGIKWSDGHVCTPKLVENGK* |
| Ga0114982_10169672 | 3300009419 | Deep Subsurface | MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKTLN* |
| Ga0118657_114751072 | 3300009506 | Mangrove Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKS* |
| Ga0116174_105676621 | 3300009681 | Anaerobic Digestor Sludge | MNKFKCSECGTKYQSPESTPPPGIKWSDGHVCTPKPVKNEQKS* |
| Ga0129333_101731938 | 3300010354 | Freshwater To Marine Saline Gradient | FICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVSSEQSK* |
| Ga0129333_107157911 | 3300010354 | Freshwater To Marine Saline Gradient | MNEFICSECGTKYRSPETTPPPGIKWSDGHVCTPKPVNNEK* |
| Ga0129333_112381872 | 3300010354 | Freshwater To Marine Saline Gradient | MNEFICSECGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK* |
| Ga0129324_101438501 | 3300010368 | Freshwater To Marine Saline Gradient | KKKKMNKFECSECGTKYSSPETTPPPGIKWSDGHICTPKSVNK* |
| Ga0133913_102017462 | 3300010885 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKLVKE* |
| Ga0133913_128535633 | 3300010885 | Freshwater Lake | MNKFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSKQS* |
| Ga0139176_1129401 | 3300010942 | Wastewater | CGTKYSSPETTPPPGIKWSDGHVCTPKPVKNEQERRN* |
| Ga0139175_1077296 | 3300010946 | Wastewater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNEQERRN* |
| Ga0137675_10002063 | 3300010966 | Pond Fresh Water | MNKFVCSECGTKYSSPETTPPPGIKWSDGHVCTPKPLNK* |
| Ga0153799_100001196 | 3300012012 | Freshwater | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK* |
| Ga0157208_1000008766 | 3300012667 | Freshwater | MNNFICSECGTKYSSPELTSPPGIKWSDGHVCTLKPVENENNKNQIY* |
| Ga0181338_10070395 | 3300015050 | Freshwater Lake | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK* |
| Ga0181338_10301424 | 3300015050 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIRWIDGHVCTPKPIKE* |
| Ga0181338_10448941 | 3300015050 | Freshwater Lake | TEMNKFICSECGTIYGSPETTPPPGIKWSDGHTCTPKPVNNG* |
| Ga0181338_10662551 | 3300015050 | Freshwater Lake | SECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK* |
| Ga0181339_10252382 | 3300017700 | Freshwater Lake | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK |
| Ga0181339_10377042 | 3300017700 | Freshwater Lake | MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKSVNK |
| Ga0181350_100196514 | 3300017716 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIRWSDGHVCTPKPVTS |
| Ga0181350_10556393 | 3300017716 | Freshwater Lake | MNKFICSECGTIYGSPETTPPPGIKWSDGHTCNPKPVNNGK |
| Ga0181347_10402504 | 3300017722 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDEHVCTPKPVNK |
| Ga0181352_10710623 | 3300017747 | Freshwater Lake | MNKFICSECGTKYSSPEVTPPPGIKWSDGHVCTPKPIDNGK |
| Ga0181344_11079361 | 3300017754 | Freshwater Lake | IFYMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0181344_11716393 | 3300017754 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHICTPKPVK |
| Ga0181349_10257986 | 3300017778 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPIKE |
| Ga0181346_100459616 | 3300017780 | Freshwater Lake | MNRFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSK |
| Ga0181348_10543731 | 3300017784 | Freshwater Lake | MTKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK |
| Ga0181355_10667032 | 3300017785 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHTCTPKLVNNGK |
| Ga0181553_103602364 | 3300018416 | Salt Marsh | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNEQERRN |
| Ga0181360_1045622 | 3300019781 | Freshwater Lake | MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPLKQTT |
| Ga0207193_100013983 | 3300020048 | Freshwater Lake Sediment | MNNFVCSECGTKYSSPETTPPPGIKWSDGHVCTPQPVSK |
| Ga0211734_109303163 | 3300020159 | Freshwater | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK |
| Ga0194035_100066027 | 3300020167 | Anoxic Zone Freshwater | MNKFICSECGTKYQSPESTPPPGIKWDDGHVCTPKLVENGNN |
| Ga0211731_116144562 | 3300020205 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVSK |
| Ga0207938_10361342 | 3300020525 | Freshwater | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK |
| Ga0208359_10095834 | 3300020541 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNNGK |
| Ga0207934_10593643 | 3300020561 | Freshwater | NKDMNKFECSECGTRYSSSETTPPPGIKWSDGHVCTPKPVNNDK |
| Ga0208597_10650592 | 3300020562 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKKKSL |
| Ga0194063_100823993 | 3300021075 | Anoxic Zone Freshwater | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK |
| Ga0194055_102788773 | 3300021079 | Anoxic Zone Freshwater | KTMNNFICNECGTKYSSPELTPPPGIKWSDGHVCTPKLVDK |
| Ga0214163_10593553 | 3300021141 | Freshwater | MNKFECSECGTIYRSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0194048_101456323 | 3300021519 | Anoxic Zone Freshwater | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTLKPVENGK |
| Ga0194059_11102611 | 3300021600 | Anoxic Zone Freshwater | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGNN |
| Ga0194060_101397953 | 3300021602 | Anoxic Zone Freshwater | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK |
| Ga0181353_10759903 | 3300022179 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKPVNNEK |
| Ga0181351_100187810 | 3300022407 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVTS |
| Ga0181351_11180513 | 3300022407 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0212119_10475353 | 3300022543 | Freshwater | MNKFECSECGTKYSSAETTPPPGIKWSDGHVCTPKPVNK |
| (restricted) Ga0233412_101506282 | 3300023210 | Seawater | MNPLKKIQMNNFICEECGTKYSTSSETPPPSPKWDDGHVCKPIPIKDE |
| Ga0244775_100038114 | 3300024346 | Estuarine | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVK |
| Ga0244775_103990713 | 3300024346 | Estuarine | MNKFECSECGTKYSSSETTPPPGIKWSDGHVCTPKPVTS |
| Ga0244775_104409052 | 3300024346 | Estuarine | MTKTMNKFICSECGSKYSSPETTPPPGIKWSDGHTCNPKPVNNGK |
| Ga0244775_109399851 | 3300024346 | Estuarine | EMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNNGK |
| Ga0244775_111294813 | 3300024346 | Estuarine | FICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEQAN |
| Ga0256308_100000453 | 3300024549 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKS |
| Ga0208022_10828471 | 3300027418 | Estuarine | ETEMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVK |
| Ga0208133_11053041 | 3300027631 | Estuarine | MNKFECSECGTKYNSPETTPPPGIKWSDGHTCNPKPVNNGK |
| Ga0209704_10314173 | 3300027693 | Freshwater Sediment | MNKFICNECGTKYSSPETTPPPGIKWSDGHTCNPKLVNNGK |
| Ga0209063_12475032 | 3300027705 | Activated Sludge | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVEKV |
| Ga0209443_100845412 | 3300027707 | Freshwater Lake | MNKFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSK |
| Ga0209599_100131812 | 3300027710 | Deep Subsurface | MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKTLN |
| Ga0209492_100074313 | 3300027721 | Freshwater Sediment | MNKFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVKR |
| Ga0209492_10791433 | 3300027721 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWNDGHVCTPKLVKE |
| Ga0209442_10756973 | 3300027732 | Freshwater Lake | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVNK |
| Ga0209593_100892394 | 3300027743 | Freshwater Sediment | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKLVDNGK |
| Ga0209596_10380137 | 3300027754 | Freshwater Lake | MNKFICSKCGTKYSSPELTPPPGIKWSDGHVCTPKLVENGK |
| Ga0209134_100053636 | 3300027764 | Freshwater Lake | MNNFVCNECGTKYSSPETTPPPGIKWNDGHVCTPQPISK |
| Ga0209770_100117364 | 3300027769 | Freshwater Lake | MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK |
| Ga0209770_102030143 | 3300027769 | Freshwater Lake | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVDNGK |
| Ga0209086_100081021 | 3300027770 | Freshwater Lake | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK |
| Ga0209230_1000283316 | 3300027836 | Freshwater And Sediment | MNKFICSECGTIYGSPETTPPPGIKWSDGHICTPKPVNNG |
| Ga0209668_1000005642 | 3300027899 | Freshwater Lake Sediment | MNKFICSECGTKYSSPESTPPPGIKWSDGHICTPKPVDNGK |
| Ga0209668_100118975 | 3300027899 | Freshwater Lake Sediment | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVNNGK |
| Ga0209668_100831912 | 3300027899 | Freshwater Lake Sediment | MNRFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0209668_107070411 | 3300027899 | Freshwater Lake Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKE |
| Ga0209253_109807323 | 3300027900 | Freshwater Lake Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKNE |
| Ga0209079_100212307 | 3300027972 | Freshwater Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKLVKE |
| Ga0209299_13206604 | 3300027974 | Freshwater Lake | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNAKXI |
| (restricted) Ga0233413_100160902 | 3300027996 | Seawater | MNNFICEECGTKYSTSSETPPPSPKWDDGHVCKPIPIKDE |
| Ga0307380_101690505 | 3300031539 | Soil | NEFICKECGTKYQSPEETPPPGIKWNDGHVCIPIPVTIKKV |
| Ga0307380_102938662 | 3300031539 | Soil | MNEFICKGCGTKYQSPEITPPPGIKWSDGHVCIPISITIKNN |
| Ga0307380_102973233 | 3300031539 | Soil | MNEFICNECGTKYQSPQETPPPGIKWNDGHVCIPIPVTSTK |
| Ga0307380_102980303 | 3300031539 | Soil | MNKFICSECGTKYSSPEETPPPGIKWSDGHVCTPEPVKDEK |
| Ga0307380_103948025 | 3300031539 | Soil | MNEFICKECGTKYQSPEETPPPGIKWNDGHVCIPILVTIKKV |
| Ga0307380_107028892 | 3300031539 | Soil | MTKLKLNGQMNEFVCSECGTKYRSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0307380_107883922 | 3300031539 | Soil | MNNFICSECGTKYSSPSKEPPPGIKWDDGHVCTPIPVKDEPFDINN |
| Ga0307379_1002379116 | 3300031565 | Soil | MNKFICSECGTNYSSPEETPPPGIKWSDGHVCTPEPVKDEK |
| Ga0307379_102052923 | 3300031565 | Soil | MNEFICNGCGTKYQSPEITPPPGIKWSDGHVCIPISVTIKKV |
| Ga0307379_114462911 | 3300031565 | Soil | MNKFICSECGTNYSSPEETPPPGIKWNDDHVCTPK |
| Ga0307378_100236463 | 3300031566 | Soil | MNNFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNKSKL |
| Ga0307376_101829953 | 3300031578 | Soil | MNEFICSECGTKYSSPEITPPPGIKWSDGHVCTPKPLKETT |
| Ga0307376_102620732 | 3300031578 | Soil | MNKFICEDCGTKYESPETKPPPGIKWSDGHLCTPIPVDKAMGISEKL |
| Ga0307377_100257758 | 3300031673 | Soil | MNEFICSECGTKYSSPEITPPPGIKWSDGHVCTPKPLKQTT |
| Ga0315291_100832418 | 3300031707 | Sediment | MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKPINK |
| Ga0315291_104134603 | 3300031707 | Sediment | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK |
| Ga0315293_101782102 | 3300031746 | Sediment | MNKFICSECGTRYSSPETTPPPGIKWSDGHVCTPKPINK |
| Ga0315293_103328784 | 3300031746 | Sediment | FICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVDNE |
| Ga0315293_103651902 | 3300031746 | Sediment | MNKFICSECGTIYGSPETTPPPGIKWSDGHVCTPKPVTS |
| Ga0315293_104553772 | 3300031746 | Sediment | MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPINNGK |
| Ga0315288_107026561 | 3300031772 | Sediment | MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPK |
| Ga0315899_100263854 | 3300031784 | Freshwater | MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0315899_103236312 | 3300031784 | Freshwater | MNKFKCSECGTIYSSPETTPPPGIKWSDGHVCTPKPLKQ |
| Ga0315899_109438332 | 3300031784 | Freshwater | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK |
| Ga0315908_103615452 | 3300031786 | Freshwater | MNKFVCNECGTKYSSPETTPPPGIKWSDGHTCNPKPVKK |
| Ga0315909_100238049 | 3300031857 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKK |
| Ga0315909_101323964 | 3300031857 | Freshwater | MNKFKCSECGTIYRSPETTPPPGIKWSDGHVCTPKLVDNEPISKN |
| Ga0315909_103562203 | 3300031857 | Freshwater | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNAK |
| Ga0315294_1000971717 | 3300031952 | Sediment | MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVNK |
| Ga0315294_101609943 | 3300031952 | Sediment | MNKFECSECGTIYRSPETTPPPPIKWSDGHVCTPKLVDNEK |
| Ga0315294_108571233 | 3300031952 | Sediment | KTMNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGKR |
| Ga0315294_109849651 | 3300031952 | Sediment | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVEN |
| Ga0315294_114488981 | 3300031952 | Sediment | SECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK |
| Ga0315901_104551454 | 3300031963 | Freshwater | YTMNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK |
| Ga0315901_105554002 | 3300031963 | Freshwater | MNNFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKDEKEKED |
| Ga0315901_106692991 | 3300031963 | Freshwater | MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNN |
| Ga0315274_100204232 | 3300031999 | Sediment | MNNFICSDCGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGKR |
| Ga0315274_105057534 | 3300031999 | Sediment | MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTLKPIKQ |
| Ga0315274_108383201 | 3300031999 | Sediment | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPK |
| Ga0315274_109116542 | 3300031999 | Sediment | NKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0315906_100616964 | 3300032050 | Freshwater | MNNFICSGCGTKYTSPETTPPPGIKWSDGHVCTPVPVKP |
| Ga0315906_112847841 | 3300032050 | Freshwater | MNNFICSECGTKYTSPQSTPPPGIKWSDGHVCTPVPVK |
| Ga0315284_100296883 | 3300032053 | Sediment | MNEFVCSECGTKYRSPETTPPPGINWSDGHVCTPKPVNK |
| Ga0315284_101080067 | 3300032053 | Sediment | MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVDNGK |
| Ga0315284_101080069 | 3300032053 | Sediment | MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVDNE |
| Ga0315903_102739535 | 3300032116 | Freshwater | KHLNQNKTMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKK |
| Ga0315903_108872872 | 3300032116 | Freshwater | MNKFECSECGTIYRSPETTPPPGIKWSDGHVCTPKLVKE |
| Ga0315277_101546131 | 3300032118 | Sediment | MNEFVCSECGTKYRSPETTPPPGIKWSDGHVCTPKPVNK |
| Ga0315273_123255002 | 3300032516 | Sediment | MNNFICNECGTKYSSPQTTPPPGIKWDDGHVCKPEPVKKSPFKSE |
| Ga0334977_0072170_1772_1879 | 3300033978 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKP |
| Ga0334989_0109066_429_554 | 3300033984 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVDNEK |
| Ga0334989_0207280_142_261 | 3300033984 | Freshwater | MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKE |
| Ga0334989_0285653_1_108 | 3300033984 | Freshwater | ICSECGTKYSSPETTPPPGIKWSDGHVCTPKSVNK |
| Ga0334994_0000890_3491_3616 | 3300033993 | Freshwater | MNKFECSECGTIYRSPETTPPPGIKWSDGHTCNPKPVNNEK |
| Ga0334979_0248854_1_111 | 3300033996 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPV |
| Ga0334985_0007193_7032_7151 | 3300034018 | Freshwater | MNKFECSECGTKYSSPKTTPPPGIKWSDGHVCTPKPINK |
| Ga0335005_0000015_22861_22980 | 3300034022 | Freshwater | MNKFICSECGTTYSSPETTPPPGIKWSDGHVCTPKLVKE |
| Ga0334983_0054891_1774_1911 | 3300034060 | Freshwater | MNKFECSECGTIYRSPETTPPPGIKWSDGHTCTLKPVDNELISKD |
| Ga0335000_0411475_571_690 | 3300034063 | Freshwater | MNKFECSECGTIYRSPETTPPPPIKWSDGHVCTPKPVKE |
| Ga0334990_0009194_1171_1290 | 3300034068 | Freshwater | MNKFECSECGTRYSSSETTPPPGIKWSDGHVCTPKSVNK |
| Ga0335020_0003362_7660_7785 | 3300034082 | Freshwater | MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKKSL |
| Ga0335025_0246727_569_694 | 3300034096 | Freshwater | MNKFECSECGTKYSSPEITPPPGIKWSDGHVCTPKPVNNGK |
| Ga0335031_0000349_34623_34742 | 3300034104 | Freshwater | MNKFECSECGTKYSSPELTPPPGIKWSDGHVCTPKPVKS |
| Ga0335035_0449968_562_717 | 3300034105 | Freshwater | TIIHQLKNKTMNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK |
| Ga0335050_0051625_2238_2357 | 3300034108 | Freshwater | MNKFECSECGTKYSSPELTPPPGIKWSDGHVCTPKLINK |
| Ga0335051_0008527_261_386 | 3300034109 | Freshwater | MNKFICNECGTKYSSPELTPPPGIKWSDGHVCKPKPINHEK |
| Ga0335063_0315019_289_444 | 3300034111 | Freshwater | MLKIFLNKKTMNEFICSECGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK |
| ⦗Top⦘ |