


| Basic Information | |
|---|---|
| Family ID | F021863 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 217 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAKKKKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 217 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 57.60 % |
| % of genes near scaffold ends (potentially truncated) | 27.19 % |
| % of genes from short scaffolds (< 2000 bps) | 81.57 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.124 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (48.848 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.567 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 11.11% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 217 Family Scaffolds |
|---|---|---|
| PF01327 | Pep_deformylase | 36.87 |
| PF00313 | CSD | 6.91 |
| PF02810 | SEC-C | 3.23 |
| PF06941 | NT5C | 1.38 |
| PF00011 | HSP20 | 1.38 |
| PF07659 | DUF1599 | 1.38 |
| PF01583 | APS_kinase | 1.38 |
| PF13578 | Methyltransf_24 | 0.92 |
| PF13715 | CarbopepD_reg_2 | 0.92 |
| PF00478 | IMPDH | 0.46 |
| PF00730 | HhH-GPD | 0.46 |
| PF00096 | zf-C2H2 | 0.46 |
| PF00856 | SET | 0.46 |
| PF00118 | Cpn60_TCP1 | 0.46 |
| PF07432 | Hc1 | 0.46 |
| PF03819 | MazG | 0.46 |
| PF01227 | GTP_cyclohydroI | 0.46 |
| PF00593 | TonB_dep_Rec | 0.46 |
| PF00166 | Cpn10 | 0.46 |
| PF08406 | CbbQ_C | 0.46 |
| PF03013 | Pyr_excise | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 36.87 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.38 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 1.38 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 1.38 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.46 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.46 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 0.46 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.46 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.46 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.12 % |
| All Organisms | root | All Organisms | 30.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 48.85% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.52% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.15% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 4.15% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.69% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.30% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.30% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.30% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.30% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.77% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.38% |
| Water Column | Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column | 1.38% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.92% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.46% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.46% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.46% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.46% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.46% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.46% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.46% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.46% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.46% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.46% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000137 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300002776 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003495 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
| 3300003600 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003618 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004638 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_135m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005401 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006093 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300007504 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007511 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300008625 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020262 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556100-ERR599172) | Environmental | Open in IMG/M |
| 3300020332 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX555956-ERR598975) | Environmental | Open in IMG/M |
| 3300020357 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555950-ERR598956) | Environmental | Open in IMG/M |
| 3300020359 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555921-ERR599117) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022888 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MG | Environmental | Open in IMG/M |
| 3300022916 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028274 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_200m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_102104701 | 3300000115 | Marine | MAKKTENAFHIKNKLKQFELKDGTKFWAKHKEDAKLYRKHVGEK* |
| LP_F_10_SI03_10DRAFT_10459222 | 3300000137 | Marine | MAKKKKSLHEKNMKQFELKDGTKFWAKDEXDAKLYRKHVGEK* |
| BBAY92_101031241 | 3300000947 | Macroalgal Surface | KVNMAKNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| BBAY94_100686442 | 3300000949 | Macroalgal Surface | MAKKKNQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| JGI24006J15134_100398165 | 3300001450 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| JGI24006J15134_100729474 | 3300001450 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK* |
| JGI24006J15134_101229882 | 3300001450 | Marine | MTKKKKMFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK* |
| GBIDBA_1000983710 | 3300001683 | Hydrothermal Vent Plume | MANKKKKVVPFHIAHNYKQYELKEGTKFWAKDDTDADLYRKKLNNK* |
| KVWGV2_1001685410 | 3300002242 | Marine Sediment | MAKKKNEPFHIKHNLKQFEXKDGTKFWAKDEEDAKLYRKKVGEK* |
| JGI25130J35507_10164164 | 3300002519 | Marine | MAKKKQPFHIKNNMKQFELKAGTKFWAKDEDDAKLYKKKVGEK* |
| Ga0005234J37281_10451602 | 3300002776 | Marine | MARKKKKDTPFHIAHNYKQYELKDGTKFWAKDDPDAELYRKKMGEIK* |
| JGI26244J51143_10116994 | 3300003495 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYRKHVGEK* |
| JGI26239J51126_10615753 | 3300003498 | Marine | IKMAKKNKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYRKHVGEK* |
| JGI26272J51733_10107916 | 3300003600 | Marine | INRGNKIMARKKKKDTPFHIAHNYKQYELKDGTKFWAKDDPDAELYRKKMGEIK* |
| JGI26381J51731_10516681 | 3300003618 | Marine | KNKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYRKHVGEK* |
| Ga0065861_11752251 | 3300004448 | Marine | MTKKKKQAFHIVNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0066621_11342263 | 3300004638 | Marine | MAKKKKSLHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0066867_100803843 | 3300005400 | Marine | MARKKKSVPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHVGEK* |
| Ga0066857_103237112 | 3300005401 | Marine | MARKKKSVPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHLGEK* |
| Ga0066851_100406464 | 3300005427 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLFRKKVGEK* |
| Ga0066851_100991551 | 3300005427 | Marine | MAKKKNQPFHIKHNLKQFELKDGSKFWAKDEDDAKLYRKKVGEK* |
| Ga0066849_100719514 | 3300005430 | Marine | MAKKKNQPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKHVRDK* |
| Ga0066849_101219742 | 3300005430 | Marine | MAKNKKQPFHIEKKLKQFELKDGTKFFAKDEEDAKLYRKHVGEK* |
| Ga0066849_103212301 | 3300005430 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKNEEDAKLYRKHVGEK* |
| Ga0066862_102517201 | 3300005521 | Marine | QPFHIKNNMKQFELKAGTKFWAKDEDDAKLYKKKVGEK* |
| Ga0008649_100269743 | 3300005838 | Marine | MLKKKNKKIPFHIAHNYKEFELKDGTKFWAKDESDANMYIKHVDG* |
| Ga0082019_100529910 | 3300006093 | Marine | MAKKKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYKKKVGEK* |
| Ga0075441_102447202 | 3300006164 | Marine | MTKKKTSLHEKNMKQFELKDGTKFWAKNEEDAKLYIKHVGKK* |
| Ga0075443_100795983 | 3300006165 | Marine | MAKKKTSLHEKNMKQFELKDGTKFWAKNEEDAKLYIKHVGKK* |
| Ga0066836_101004073 | 3300006166 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVRDK* |
| Ga0068487_10432213 | 3300006315 | Marine | KNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0068475_10599423 | 3300006318 | Marine | MAKNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0068475_11958173 | 3300006318 | Marine | MAKKKKQPFHIKHKLKQFELKDGTKFWAKDESDAKLYRKKVGEK* |
| Ga0068500_11216255 | 3300006332 | Marine | MAKNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYKKHVGEK* |
| Ga0100228_103305010 | 3300006565 | Marine | MAKKKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYKKHVGEK* |
| Ga0100228_10716772 | 3300006565 | Marine | MAKKKKQPFHITNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0100228_10797391 | 3300006565 | Marine | MAKKKKQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0100228_11138292 | 3300006565 | Marine | MAKKKKLAFHEKHNYQQFELKDGTKFWAKDEEDAKLYKKHVGEK* |
| Ga0098033_100773011 | 3300006736 | Marine | MAKKKQPFHIKNNMKQFELKDGTKFWVKDEDDAKLYKKKVGEK* |
| Ga0098040_10540214 | 3300006751 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHVGEK* |
| Ga0098048_10820204 | 3300006752 | Marine | MAKNKKQPFHIEKKLKQFELKDGTKFFAKDEEDATLYRKHVGEK* |
| Ga0098048_11815222 | 3300006752 | Marine | MAKKKKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0098044_11507083 | 3300006754 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHLGEK* |
| Ga0098054_11591471 | 3300006789 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0098054_12565202 | 3300006789 | Marine | MAKKNKQPFHIKNKLKEFKLKDGTKFWAKDVEDAKLYRKHVGEK* |
| Ga0098055_11593811 | 3300006793 | Marine | SLMAKNKKQPFHIEKKLKQFELKDGTKFFAKDEEDAKLYRKHVGEK* |
| Ga0066372_102788494 | 3300006902 | Marine | MAKKKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0066372_106726712 | 3300006902 | Marine | MAKKKQPFHIKNKLKQFELKDGSKFWAKDDIDAELYRKKVEGK* |
| Ga0066372_107338972 | 3300006902 | Marine | MAKKKQPLHIKHNMKQFELKDGTKFWAKDEEDAKLYRKKVGEK* |
| Ga0066372_108844942 | 3300006902 | Marine | MAKKNKQPFHIKNKLKQFELKDGSKFWAKDEVDAKLYRKHVGEK* |
| Ga0098060_10751762 | 3300006921 | Marine | MAKKNKQPIHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0098051_10102692 | 3300006924 | Marine | MAKKKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYKKKVGEIILVVVH* |
| Ga0098034_11344812 | 3300006927 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFCAKDESDAKLFRKKVGEK* |
| Ga0104999_10045118 | 3300007504 | Water Column | MAKKKKNIPFHIAHNYKMFELKDGTKFWARDKQAAKLYKDKIEVK* |
| Ga0104999_10135328 | 3300007504 | Water Column | MAKKKKQPFHIVHNFNKYKLSDGTVFWAKDEEDAKLYRKHVGEK* |
| Ga0104999_11336921 | 3300007504 | Water Column | MAKKKKQPFHIVHNFNKYKLSDGTVFWAKDEEDAKLYKKKVGEK* |
| Ga0105000_10578539 | 3300007511 | Marine | MAKKKKKDIPFHIAHNYKEFELKDGTKFWARDDEAAKLYRKKAENYKL* |
| Ga0105020_11628936 | 3300007514 | Marine | MAKKKNQPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKKVGEK* |
| Ga0115653_10310711 | 3300008625 | Marine | MAKKKKQPFHIVHNFNKYKLSDGTVFWAKDEEDAKLYKK |
| Ga0115653_11945521 | 3300008625 | Marine | KKKKQPFHIVHNFNKYKLSDGTVFWAKDEEDAKLYKKKVGEK* |
| Ga0115566_101472182 | 3300009071 | Pelagic Marine | MAKKKKQSFHIVNKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK* |
| Ga0114995_103675573 | 3300009172 | Marine | MAKKKTPLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK* |
| Ga0114995_104498632 | 3300009172 | Marine | MAKKKTPLHEKNMKQFELKDGTKFWAKDEKDAKLYKKHVGEK* |
| Ga0114995_106371431 | 3300009172 | Marine | MTKKKKMFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGEK* |
| Ga0114996_100616112 | 3300009173 | Marine | MTKKKKQPFHIANNLKQYQLKDDTKFWAKDDEDAKLYRKHVGEK* |
| Ga0114996_100918876 | 3300009173 | Marine | MAKKNKEKVPFHIAHKFKQFELSDGTTFWAEHNANAKLYIKKVEGK* |
| Ga0114996_103921312 | 3300009173 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKHKEDAKLYIKKVEGK* |
| Ga0114996_106091302 | 3300009173 | Marine | MAKKKKSLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK* |
| Ga0114996_106476711 | 3300009173 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAKLYRKHVGEK* |
| Ga0114993_100026741 | 3300009409 | Marine | MTKKKKQPFHIANNLKQYQLKDDTKFWAKDDEDAKL |
| Ga0114993_102257005 | 3300009409 | Marine | MAKKKQPLHIKHKLTQFELKDGTKFWAKDEENALLY |
| Ga0114994_107002502 | 3300009420 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK* |
| Ga0114997_100963503 | 3300009425 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEVDAKLYRKHVGEK* |
| Ga0114997_104938163 | 3300009425 | Marine | IMAKKKTPLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK* |
| Ga0114915_11539921 | 3300009428 | Deep Ocean | FHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK* |
| Ga0114915_11806684 | 3300009428 | Deep Ocean | MAKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGEK* |
| Ga0115545_11745691 | 3300009433 | Pelagic Marine | MGKKKQPFHIENKLKQFELKDGTKFWAKDEEDAKLYKKHVGKK* |
| Ga0115008_103715583 | 3300009436 | Marine | MAKKKKQSFHIVNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0114932_100269846 | 3300009481 | Deep Subsurface | MAKKKNEPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKKVGEK* |
| Ga0114932_100320248 | 3300009481 | Deep Subsurface | MAKKKKQPFHIAKKLKQFELKDGTKFYAKDEEDAKLYRKHVGEK* |
| Ga0114932_102461793 | 3300009481 | Deep Subsurface | MAKKKNQPFHIANKLKQFELKDGTKFWAKDEEDAKLYKKHVGEK* |
| Ga0115571_12565903 | 3300009495 | Pelagic Marine | MAKNKKQAFHIVNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0115570_101938021 | 3300009496 | Pelagic Marine | MAKNKKQAFHIVNKLKQFELKDGTKFWAKDEEDAKLYKKHVGKK* |
| Ga0115568_104461171 | 3300009498 | Pelagic Marine | KKKQPFHIENKLKQFELKDGTKFWAKDEEDAKLYKKHVGKK* |
| Ga0115003_107151731 | 3300009512 | Marine | IMAKKKTPLHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK* |
| Ga0115011_101406673 | 3300009593 | Marine | MAKKKKQPFHIKHKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK* |
| Ga0115011_101952742 | 3300009593 | Marine | MAKKKKQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKKVGEK* |
| Ga0115011_105033213 | 3300009593 | Marine | MAKKNKQPFHIAKKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK* |
| Ga0115011_107053964 | 3300009593 | Marine | QPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKKVGEK* |
| Ga0115000_102649344 | 3300009705 | Marine | FHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0115000_105407662 | 3300009705 | Marine | MTKKKTPLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK* |
| Ga0115002_105374574 | 3300009706 | Marine | MAKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK* |
| Ga0115001_102661214 | 3300009785 | Marine | MDKKKKTFHEKNMKQFELKDGTKFWAKNEEDAKLYRKHVGEK* |
| Ga0115001_103746821 | 3300009785 | Marine | KKKTPLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK* |
| Ga0114999_101945743 | 3300009786 | Marine | MAKKKTPLHEKNMKQFELKDGTKFWAKDEKDAKLYRKRVGENSV* |
| Ga0114999_103072953 | 3300009786 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKHKEDAKLYRKHVGEK* |
| Ga0114999_105359861 | 3300009786 | Marine | TKKKKTFHEKNMKQFELKDGTKFWAKHKEDAKLYIKKVEGK* |
| Ga0114999_106464713 | 3300009786 | Marine | MAKKKQPFHIKHKLKQFELKDGTNFWAKDESDAKLYIKKVEGKE* |
| Ga0115012_111864851 | 3300009790 | Marine | KQPFHIAKKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK* |
| Ga0098049_10345932 | 3300010149 | Marine | MAKNKKQPFHIEKKLKQFELKDGTKFFAKDEVDAKLYRKHVGEK* |
| Ga0098049_12180784 | 3300010149 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKNEEDAKLY |
| Ga0098056_11387951 | 3300010150 | Marine | KNKQPFHIKNNMKQFELKDGKKFWAKNEEDAKLYRKHVGEK* |
| Ga0098059_11808203 | 3300010153 | Marine | AKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHLGEK* |
| Ga0133547_115347061 | 3300010883 | Marine | LMTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK* |
| Ga0114934_101203255 | 3300011013 | Deep Subsurface | MAKKKKQPFHIAKKLKQFELKDGTKFYAKDEEDAKLYRKHV |
| Ga0114934_102545994 | 3300011013 | Deep Subsurface | IANKLKQFELKDGTKFWAKDESDAKLYRKKVGEK* |
| Ga0151677_11307063 | 3300011258 | Marine | VNMAKNKKQPFHIKNKLKQFELKDGTKFWAKDEEDAELYRKHVGEK* |
| Ga0163180_101596173 | 3300012952 | Seawater | MAKKKKQPFHIAKKLKQFELKDGTKFYAKDKEDAKLYRKHVGEK* |
| Ga0163111_116027492 | 3300012954 | Surface Seawater | MAKNKNQPFHIKNKLKQFELKDGTKFWAKNEEDAKLYRKHVGEK* |
| Ga0181383_11477643 | 3300017720 | Seawater | MAKKTENAFHIKNKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0181417_10851971 | 3300017730 | Seawater | RTKYMAKKTENAFHIKNKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0181417_11741152 | 3300017730 | Seawater | MAKKKKQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGKK |
| Ga0181389_11642353 | 3300017746 | Seawater | VGKKKQNAFHIKNKLKQFELKDGSKFWAKDEEDAKLYRKHVG |
| Ga0181407_11195953 | 3300017753 | Seawater | MGKKKQPFHIENKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0181408_10235655 | 3300017760 | Seawater | MAKKKNQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGKK |
| Ga0181410_11966982 | 3300017763 | Seawater | MAKNKKQAFHIVNKLKQFELKDGTKFWAKHKEDAKLYRKHVGEK |
| Ga0187220_12634951 | 3300017768 | Seawater | MAKKTENAFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0181395_12573933 | 3300017779 | Seawater | AKKTENAFHIKNNLKQFELKDGTKFWAKHKEDAKLYRKHVGEK |
| Ga0206125_100240682 | 3300020165 | Seawater | MAKKKKQSFHIVNKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0206125_100279008 | 3300020165 | Seawater | VGKKKQNAFHIKNKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0206125_103747603 | 3300020165 | Seawater | MGKKKQPFHIENKLKQFELKDGTKFWAKDEEDAKLYKKHVGKK |
| Ga0211537_10175533 | 3300020262 | Marine | MAKKKQPFHIKNNMKQFELKAGTKFWAKDEEDAKLYKKKVGEK |
| Ga0211502_10467013 | 3300020332 | Marine | MAKKKNQPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKKVGEK |
| Ga0211611_11167721 | 3300020357 | Marine | MAKKKNQPFHIANKLKQFELKDGTKFWAKDEEDAKLYKKHVGEK |
| Ga0211610_10545373 | 3300020359 | Marine | MAKNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211682_100166201 | 3300020376 | Marine | MAKKKTSLHEKNMKQFELKDGTKFWAKDEEDAKLYKKHVGKK |
| Ga0211652_101128723 | 3300020379 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKNEEDAKLYRKHVGEK |
| Ga0211680_101201653 | 3300020389 | Marine | MAKKKQPFHIENKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211680_101596012 | 3300020389 | Marine | MAKNKQPLHIKNKLIQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211687_101663182 | 3300020396 | Marine | MTKKKKMFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGEK |
| Ga0211557_102200081 | 3300020418 | Marine | MAKKKKQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKKVGEK |
| Ga0211695_101183742 | 3300020441 | Marine | MAKNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYKKHVGEK |
| Ga0211695_101387994 | 3300020441 | Marine | MAKKKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211564_101100483 | 3300020445 | Marine | MAKNKKQPFHIEKKLKQFELKDGTKFFAKDEEDAKLYRKHVGEK |
| Ga0211564_102049562 | 3300020445 | Marine | MAKKKNQPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKHVRDK |
| Ga0211473_102314521 | 3300020451 | Marine | MAKKKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHV |
| Ga0211545_100114516 | 3300020452 | Marine | MAKKKKQPFHIAKKLKQFELKDGTKFYAKDEEDAKLYRKHVGEK |
| Ga0211545_101102244 | 3300020452 | Marine | MAKKKNQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211548_100455581 | 3300020454 | Marine | FHITNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211640_107102883 | 3300020465 | Marine | PFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0211577_103582032 | 3300020469 | Marine | MAKNKKQAFHIVNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0206126_100906821 | 3300020595 | Seawater | MGKKKQNAFHIKNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0206682_100192186 | 3300021185 | Seawater | MAKKKKSLHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0206682_100869854 | 3300021185 | Seawater | MAKKTENAFHIKNKLKQFELKDGTKFWAKHKEDAKLYRKHVGEK |
| Ga0206123_101895833 | 3300021365 | Seawater | MGKKKQPFHIENKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0206685_101871922 | 3300021442 | Seawater | MAKNKQPLHIKNKLKQFELKDGTKFWAKDEKDAKLYRKHVGEK |
| Ga0226832_101082343 | 3300021791 | Hydrothermal Vent Fluids | MAKNKNQPFHIKNKLKQFELKDGTKFWAKDEEDAKLYR |
| Ga0187833_100159783 | 3300022225 | Seawater | MAKKKQPFHIKNNMKQFELKAGTKFWAKDEDDAKLYKKKVGEK |
| (restricted) Ga0233428_100233717 | 3300022888 | Seawater | MARKKKKDTPFHIAHNYKQYELKDGTKFWAKDDPDAELYRKKMGEIK |
| (restricted) Ga0233431_11517271 | 3300022916 | Seawater | MAKKKKSLHEKNMKQFELKDGTKFWAKDEEDAKLYRKHV |
| (restricted) Ga0233427_104108541 | 3300022933 | Seawater | MTKKKKQPFHIANNLKQYQLKDDTKFWAKDDEDAKLYRKHVGEK |
| (restricted) Ga0233438_101933802 | 3300024255 | Seawater | MSKKKKSLHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| (restricted) Ga0233441_10069341 | 3300024260 | Seawater | MARKKKKDTPFHIAHNYKQYELKDGTKFWAKDDPDAELYRKKMGE |
| (restricted) Ga0233439_101943712 | 3300024261 | Seawater | MLKKKNKKIPFHIAHNYKEFELKDGTKFWAKDESDANMYIKHVDG |
| Ga0209992_1000065622 | 3300024344 | Deep Subsurface | MAKKKNEPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKKVGEK |
| Ga0209992_1000825116 | 3300024344 | Deep Subsurface | MAKKKKQPFHITNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0209992_100962781 | 3300024344 | Deep Subsurface | MAKKKKQPFHIKHKLKQFELKDGTKFWAKDESDAKLYRKKVGEK |
| Ga0209992_104503512 | 3300024344 | Deep Subsurface | MAKKKNQPFHIANKLKQFELKDGTKFWAKNEEDAKLYKKHVGEK |
| Ga0244775_100546741 | 3300024346 | Estuarine | FHIKNKLKQFELKDGTKFWAKHKEDAKLYRKHVGEK |
| Ga0208012_100087013 | 3300025066 | Marine | MAKKKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYKKKVGEK |
| Ga0208298_10317292 | 3300025084 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLFRKKVGEK |
| Ga0208298_10547543 | 3300025084 | Marine | MAKKKKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0208011_10336713 | 3300025096 | Marine | MARKKKSVPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHVGEK |
| Ga0208669_11019033 | 3300025099 | Marine | MAKKNKQPIHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0208013_10613051 | 3300025103 | Marine | KQPFHIKNNMKQFELKDGTKFWAKDESDAKLFRKKVGEK |
| Ga0208013_10635774 | 3300025103 | Marine | NKQPFHIKNNMKQFELKDGTKFWAKNEEDAKLYRKHVGEK |
| Ga0208793_11009051 | 3300025108 | Marine | SLMAKNKKQPFHIEKKLKQFELKDGTKFFAKDEEDAKLYRKHVGEK |
| Ga0209535_11186324 | 3300025120 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAKLYRKHVGEK |
| Ga0209644_10722403 | 3300025125 | Marine | MAKKKKTPFHIKHNFKQYVLCGGIKFWAKNDEDALLYQKKMLKLRGGFEA |
| Ga0208299_10847063 | 3300025133 | Marine | FHIKNNMKQFELKDGTKFWAKDESDAKLYRKHLGEK |
| Ga0209336_100367033 | 3300025137 | Marine | MAKKKTPLHEKNMKQFELKDGTKFWAKDEKDAKLYRKRVGEK |
| Ga0209336_100539814 | 3300025137 | Marine | HIVNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0209634_10336804 | 3300025138 | Marine | MTKKKKQAFHIVNKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0209634_10646604 | 3300025138 | Marine | ILMTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK |
| Ga0209634_10698781 | 3300025138 | Marine | MAKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0209634_11905783 | 3300025138 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHV |
| Ga0209634_12148091 | 3300025138 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK |
| Ga0209634_12288171 | 3300025138 | Marine | KKKTPLHEKNMKQFELKDGTKFWAKDEKDAKLYKKHVGEK |
| Ga0209634_12554111 | 3300025138 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEVDAKLYRKHVGEK |
| Ga0209337_10556142 | 3300025168 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK |
| Ga0209337_11036161 | 3300025168 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEVDAKLYR |
| Ga0209337_11487573 | 3300025168 | Marine | MTKKKKMFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK |
| Ga0209337_11626441 | 3300025168 | Marine | MTKKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKHV |
| Ga0209556_10130957 | 3300025547 | Marine | KQPFHIKNNMKQFELKDGTKFWAKDEDDAKLYRKHVGEK |
| Ga0209630_103027163 | 3300025892 | Pelagic Marine | MAKNKKQAFHIVNKLKQFELRDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0207989_10165673 | 3300026209 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHLGEK |
| Ga0207989_10253639 | 3300026209 | Marine | MAKKKQPFHIKNNMKQFELKDGTKFWAKDEDDAKLY |
| Ga0207989_10387771 | 3300026209 | Marine | NKQPFHIKNNMKQFELKDGTKFWAKDESDAKLFRKKVGEK |
| Ga0208407_10440873 | 3300026257 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDESDAKLYRKHVGEK |
| Ga0208766_11114132 | 3300026269 | Marine | MARKKKSVPFHIKNNMKQFELKDGTKFWAKDEDDAKLYKKKVGEK |
| Ga0208411_101509810 | 3300026279 | Marine | MARKKKSVPFHIKNNMKQFELKDGTKFWAKDESDAKLYRK |
| Ga0209384_10356924 | 3300027522 | Marine | MAKKKTSLHEKNMKQFELKDGTKFWAKNEEDAKLYIKHVGKK |
| Ga0209815_10611504 | 3300027714 | Marine | MTKKKTSLHEKNMKQFELKDGTKFWAKNEEDAKLYIKHVGKK |
| Ga0209709_100736973 | 3300027779 | Marine | MAKKKKSLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK |
| Ga0209709_102729323 | 3300027779 | Marine | MTKKKTPLHEKNMKQFELKDGTKFWAKDEEDAKLYRKRVGEK |
| Ga0209091_105080602 | 3300027801 | Marine | MAKKKTPLHEKNMKQFELKDGTKFWAKDEKDAKLYKKHVGEK |
| Ga0209090_101115334 | 3300027813 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGEK |
| Ga0209403_102064834 | 3300027839 | Marine | VIMAKKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0209404_101490664 | 3300027906 | Marine | MAKKNKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0209404_101680545 | 3300027906 | Marine | MAKKKKQPFHIKHKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0209404_104641881 | 3300027906 | Marine | KKNKQPFHIAKKLKQFELKDGSKFWAKDEEDAKLYRKHVGEK |
| Ga0209404_109243293 | 3300027906 | Marine | KNQPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKKVGEK |
| Ga0257106_13102422 | 3300028194 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0257119_100332514 | 3300028274 | Marine | MARKKKKDTPFHIAHNYKQYELKDGTKFWAKDDPDAELYRKK |
| Ga0257111_10328622 | 3300028535 | Marine | MAKNKQPLHIKNKLKQFELKDGTKFWAKHKEDAKLYIKKVEGK |
| Ga0183755_10002873 | 3300029448 | Marine | MAKKKKQPFHIANKLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0308010_11180443 | 3300031510 | Marine | MVKKKTPLHEKNMKQFELKDGTKFWAKDEEDAKLYKKHVGKK |
| Ga0302134_101209013 | 3300031596 | Marine | MTKKKTLLHEKNMKQFELKDGTKFWAKDEEDAKLYKKLVGKK |
| Ga0302132_102741031 | 3300031605 | Marine | MAKKKKTFHEKNMKQFELKDGTKFWAKNEEDAELYRKHVGKK |
| Ga0315326_109045771 | 3300031775 | Seawater | KKNKQPFHIKNNMKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0310122_100346293 | 3300031800 | Marine | MAKKKKDIPFHIAHNYKQYELKDGTKFWAKDEENAKLYRKKVEGK |
| Ga0315318_100473607 | 3300031886 | Seawater | MAKKKQPLHIKNKLKQFELKDGSKFWAKDEVDAKLYRKHVGEK |
| Ga0310344_103331492 | 3300032006 | Seawater | MAKKKKQPFHIKHNLKQFELKDGTKFWAKDEEDAKLYRKHVGEK |
| Ga0310344_103846195 | 3300032006 | Seawater | MAKKKKQPFHIKHNLKQFELKDGTKFWAKDESDAKLYRKKVGEK |
| Ga0315329_106760593 | 3300032048 | Seawater | MAKKKQPLHIKNKLKQFELKDGSKFWAKDEVDAKLYRK |
| Ga0310345_111004632 | 3300032278 | Seawater | MAKKKKVKPFHITHNLKQYQLKDDTKFWAKGDIDAELYRKKVEGK |
| Ga0310342_1021175381 | 3300032820 | Seawater | MAKKKQPFHIKNKLKQFELKDGSKFWAKDDIDAELYRKKVEGK |
| ⦗Top⦘ |