


| Basic Information | |
|---|---|
| Family ID | F021731 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 217 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Number of Associated Samples | 172 |
| Number of Associated Scaffolds | 217 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 64.06 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (41.014 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (13.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.562 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (55.760 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 217 Family Scaffolds |
|---|---|---|
| PF03104 | DNA_pol_B_exo1 | 7.37 |
| PF13589 | HATPase_c_3 | 4.61 |
| PF03235 | DUF262 | 4.61 |
| PF14236 | DUF4338 | 1.38 |
| PF14279 | HNH_5 | 0.92 |
| PF00004 | AAA | 0.46 |
| PF13395 | HNH_4 | 0.46 |
| PF02195 | ParBc | 0.46 |
| PF02945 | Endonuclease_7 | 0.46 |
| PF01844 | HNH | 0.46 |
| PF12705 | PDDEXK_1 | 0.46 |
| PF02518 | HATPase_c | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 7.37 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 4.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.99 % |
| Unclassified | root | N/A | 41.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02IL81W | Not Available | 548 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10025697 | All Organisms → Viruses → Predicted Viral | 3329 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10032532 | All Organisms → Viruses → Predicted Viral | 2843 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10048589 | Not Available | 2140 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10232340 | Not Available | 593 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1004902 | All Organisms → Viruses → Predicted Viral | 2014 | Open in IMG/M |
| 3300000928|OpTDRAFT_10002138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5407 | Open in IMG/M |
| 3300000928|OpTDRAFT_10253793 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300001352|JGI20157J14317_10022969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3504 | Open in IMG/M |
| 3300001352|JGI20157J14317_10084133 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300001778|ACM18_1000532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4404 | Open in IMG/M |
| 3300002363|B570J29624_105268 | Not Available | 791 | Open in IMG/M |
| 3300002408|B570J29032_109085711 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 589 | Open in IMG/M |
| 3300002408|B570J29032_109880228 | Not Available | 1918 | Open in IMG/M |
| 3300002835|B570J40625_100085237 | Not Available | 4041 | Open in IMG/M |
| 3300002835|B570J40625_100090415 | Not Available | 3866 | Open in IMG/M |
| 3300002835|B570J40625_100674169 | Not Available | 931 | Open in IMG/M |
| 3300003427|JGI26084J50262_1104093 | Not Available | 578 | Open in IMG/M |
| 3300003617|JGI26082J51739_10041235 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300003620|JGI26273J51734_10093080 | Not Available | 849 | Open in IMG/M |
| 3300003620|JGI26273J51734_10110356 | Not Available | 754 | Open in IMG/M |
| 3300004112|Ga0065166_10002579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4182 | Open in IMG/M |
| 3300004128|Ga0066180_10086906 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300004240|Ga0007787_10013268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3338 | Open in IMG/M |
| 3300004240|Ga0007787_10158912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300004240|Ga0007787_10235090 | Not Available | 898 | Open in IMG/M |
| 3300004240|Ga0007787_10679529 | Not Available | 515 | Open in IMG/M |
| 3300005517|Ga0070374_10089669 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300005582|Ga0049080_10025322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2070 | Open in IMG/M |
| 3300005662|Ga0078894_10151727 | Not Available | 2082 | Open in IMG/M |
| 3300005662|Ga0078894_10435193 | Not Available | 1182 | Open in IMG/M |
| 3300005934|Ga0066377_10032549 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300006802|Ga0070749_10148277 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300006802|Ga0070749_10591382 | Not Available | 599 | Open in IMG/M |
| 3300006802|Ga0070749_10662707 | Not Available | 559 | Open in IMG/M |
| 3300006922|Ga0098045_1018759 | All Organisms → Viruses → Predicted Viral | 1864 | Open in IMG/M |
| 3300006924|Ga0098051_1035914 | Not Available | 1394 | Open in IMG/M |
| 3300007231|Ga0075469_10194266 | Not Available | 543 | Open in IMG/M |
| 3300007516|Ga0105050_10076374 | All Organisms → Viruses → Predicted Viral | 2283 | Open in IMG/M |
| 3300007538|Ga0099851_1127412 | Not Available | 958 | Open in IMG/M |
| 3300007547|Ga0102875_1114308 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 857 | Open in IMG/M |
| 3300007551|Ga0102881_1086618 | Not Available | 870 | Open in IMG/M |
| 3300007606|Ga0102923_1076001 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300007640|Ga0070751_1002307 | Not Available | 10940 | Open in IMG/M |
| 3300007644|Ga0102902_1145625 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 704 | Open in IMG/M |
| 3300007716|Ga0102867_1145558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300007722|Ga0105051_10098660 | All Organisms → Viruses → Predicted Viral | 2288 | Open in IMG/M |
| 3300007725|Ga0102951_1053335 | Not Available | 1186 | Open in IMG/M |
| 3300007960|Ga0099850_1247880 | Not Available | 687 | Open in IMG/M |
| 3300007962|Ga0102907_1173028 | Not Available | 554 | Open in IMG/M |
| 3300008113|Ga0114346_1020164 | Not Available | 3601 | Open in IMG/M |
| 3300008962|Ga0104242_1053323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300008962|Ga0104242_1077974 | Not Available | 551 | Open in IMG/M |
| 3300008996|Ga0102831_1018058 | All Organisms → Viruses → Predicted Viral | 2425 | Open in IMG/M |
| 3300008996|Ga0102831_1286191 | Not Available | 544 | Open in IMG/M |
| 3300009000|Ga0102960_1011866 | All Organisms → Viruses → Predicted Viral | 3293 | Open in IMG/M |
| 3300009000|Ga0102960_1023818 | All Organisms → Viruses → Predicted Viral | 2291 | Open in IMG/M |
| 3300009001|Ga0102963_1007543 | All Organisms → Viruses → Predicted Viral | 4703 | Open in IMG/M |
| 3300009024|Ga0102811_1077996 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
| 3300009052|Ga0102886_1026022 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300009080|Ga0102815_10201667 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300009152|Ga0114980_10711450 | Not Available | 562 | Open in IMG/M |
| 3300009160|Ga0114981_10427707 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 712 | Open in IMG/M |
| 3300009172|Ga0114995_10061645 | Not Available | 2126 | Open in IMG/M |
| 3300009180|Ga0114979_10139321 | All Organisms → Viruses → Predicted Viral | 1488 | Open in IMG/M |
| 3300009185|Ga0114971_10194917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
| 3300009185|Ga0114971_10521962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 662 | Open in IMG/M |
| 3300009419|Ga0114982_1117002 | Not Available | 823 | Open in IMG/M |
| 3300009496|Ga0115570_10134618 | Not Available | 1171 | Open in IMG/M |
| 3300009505|Ga0115564_10027018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3720 | Open in IMG/M |
| 3300009505|Ga0115564_10059193 | All Organisms → Viruses → Predicted Viral | 2251 | Open in IMG/M |
| 3300009507|Ga0115572_10028498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3757 | Open in IMG/M |
| 3300009507|Ga0115572_10077595 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
| 3300009507|Ga0115572_10217117 | Not Available | 1101 | Open in IMG/M |
| 3300010150|Ga0098056_1195689 | Not Available | 676 | Open in IMG/M |
| 3300011268|Ga0151620_1096266 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 937 | Open in IMG/M |
| 3300012665|Ga0157210_1009470 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300012936|Ga0163109_10269967 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300013010|Ga0129327_10027818 | All Organisms → Viruses → Predicted Viral | 2930 | Open in IMG/M |
| 3300013372|Ga0177922_10546757 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 858 | Open in IMG/M |
| 3300017713|Ga0181391_1019950 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1673 | Open in IMG/M |
| 3300017719|Ga0181390_1006701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4232 | Open in IMG/M |
| 3300017727|Ga0181401_1065512 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 968 | Open in IMG/M |
| 3300017730|Ga0181417_1090782 | Not Available | 739 | Open in IMG/M |
| 3300017742|Ga0181399_1156302 | Not Available | 546 | Open in IMG/M |
| 3300017743|Ga0181402_1119837 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 674 | Open in IMG/M |
| 3300017744|Ga0181397_1113028 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 708 | Open in IMG/M |
| 3300017752|Ga0181400_1040764 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300017752|Ga0181400_1061389 | Not Available | 1147 | Open in IMG/M |
| 3300017761|Ga0181356_1078866 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300017763|Ga0181410_1085481 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 927 | Open in IMG/M |
| 3300017782|Ga0181380_1283592 | Not Available | 544 | Open in IMG/M |
| 3300017824|Ga0181552_10293425 | Not Available | 804 | Open in IMG/M |
| 3300017950|Ga0181607_10081892 | All Organisms → Viruses → Predicted Viral | 2081 | Open in IMG/M |
| 3300017950|Ga0181607_10087245 | All Organisms → Viruses → Predicted Viral | 1999 | Open in IMG/M |
| 3300017950|Ga0181607_10460222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 685 | Open in IMG/M |
| 3300017956|Ga0181580_10034883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3874 | Open in IMG/M |
| 3300017985|Ga0181576_10062697 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
| 3300017985|Ga0181576_10653055 | Not Available | 632 | Open in IMG/M |
| 3300017986|Ga0181569_10026900 | All Organisms → Viruses → Predicted Viral | 4164 | Open in IMG/M |
| 3300018041|Ga0181601_10040045 | Not Available | 3390 | Open in IMG/M |
| 3300018048|Ga0181606_10138540 | Not Available | 1479 | Open in IMG/M |
| 3300018416|Ga0181553_10047093 | All Organisms → Viruses → Predicted Viral | 2892 | Open in IMG/M |
| 3300018420|Ga0181563_10022668 | All Organisms → Viruses → Predicted Viral | 4853 | Open in IMG/M |
| 3300018420|Ga0181563_10135309 | All Organisms → Viruses → Predicted Viral | 1568 | Open in IMG/M |
| 3300018424|Ga0181591_10629597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300018876|Ga0181564_10606001 | Not Available | 580 | Open in IMG/M |
| 3300020141|Ga0211732_1190491 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1019 | Open in IMG/M |
| 3300020159|Ga0211734_10645241 | Not Available | 534 | Open in IMG/M |
| 3300020159|Ga0211734_11098063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2850 | Open in IMG/M |
| 3300020159|Ga0211734_11253694 | Not Available | 632 | Open in IMG/M |
| 3300020160|Ga0211733_10060978 | Not Available | 1129 | Open in IMG/M |
| 3300020160|Ga0211733_10328021 | All Organisms → Viruses → Predicted Viral | 2672 | Open in IMG/M |
| 3300020160|Ga0211733_10576570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300020161|Ga0211726_10822399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4564 | Open in IMG/M |
| 3300020162|Ga0211735_11576496 | Not Available | 714 | Open in IMG/M |
| 3300020172|Ga0211729_10186355 | All Organisms → Viruses → Predicted Viral | 3591 | Open in IMG/M |
| 3300020173|Ga0181602_10020179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4159 | Open in IMG/M |
| 3300020175|Ga0206124_10141647 | Not Available | 973 | Open in IMG/M |
| 3300020178|Ga0181599_1006854 | Not Available | 8403 | Open in IMG/M |
| 3300020178|Ga0181599_1249801 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 681 | Open in IMG/M |
| 3300020185|Ga0206131_10012973 | Not Available | 7493 | Open in IMG/M |
| 3300020191|Ga0181604_10124742 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300020196|Ga0194124_10023160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 4346 | Open in IMG/M |
| 3300020205|Ga0211731_11291709 | Not Available | 734 | Open in IMG/M |
| 3300020205|Ga0211731_11477944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3627 | Open in IMG/M |
| 3300020469|Ga0211577_10228890 | Not Available | 1208 | Open in IMG/M |
| 3300020527|Ga0208232_1002168 | All Organisms → Viruses → Predicted Viral | 3518 | Open in IMG/M |
| 3300020527|Ga0208232_1011706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300020810|Ga0181598_1219781 | Not Available | 716 | Open in IMG/M |
| 3300021092|Ga0194122_10017214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5323 | Open in IMG/M |
| 3300021141|Ga0214163_1019859 | All Organisms → Viruses → Predicted Viral | 2038 | Open in IMG/M |
| 3300021141|Ga0214163_1031398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1509 | Open in IMG/M |
| 3300021185|Ga0206682_10236781 | Not Available | 816 | Open in IMG/M |
| 3300021373|Ga0213865_10010372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5374 | Open in IMG/M |
| 3300021373|Ga0213865_10031173 | All Organisms → Viruses → Predicted Viral | 2991 | Open in IMG/M |
| 3300021424|Ga0194117_10028145 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3554 | Open in IMG/M |
| 3300021958|Ga0222718_10062411 | All Organisms → Viruses → Predicted Viral | 2311 | Open in IMG/M |
| 3300021962|Ga0222713_10400860 | Not Available | 844 | Open in IMG/M |
| 3300021963|Ga0222712_10640250 | Not Available | 608 | Open in IMG/M |
| 3300022068|Ga0212021_1017113 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300022407|Ga0181351_1010802 | All Organisms → Viruses → Predicted Viral | 3699 | Open in IMG/M |
| 3300022921|Ga0255765_1139090 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300022925|Ga0255773_10076272 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
| 3300022927|Ga0255769_10064529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2052 | Open in IMG/M |
| 3300022928|Ga0255758_10114957 | All Organisms → Viruses → Predicted Viral | 1392 | Open in IMG/M |
| 3300022937|Ga0255770_10122179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1435 | Open in IMG/M |
| 3300023105|Ga0255782_10261712 | Not Available | 826 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10012702 | Not Available | 6604 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10246091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Shirahamavirus → Shirahamavirus PTm1 | 858 | Open in IMG/M |
| 3300023175|Ga0255777_10003090 | Not Available | 14370 | Open in IMG/M |
| 3300023178|Ga0255759_10023013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4879 | Open in IMG/M |
| 3300023273|Ga0255763_1249077 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 663 | Open in IMG/M |
| 3300024247|Ga0228675_1070250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Shirahamavirus → Shirahamavirus PTm1 | 695 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10043886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2340 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10026848 | All Organisms → Viruses → Predicted Viral | 3893 | Open in IMG/M |
| 3300024289|Ga0255147_1074179 | Not Available | 640 | Open in IMG/M |
| 3300024294|Ga0228664_1034026 | Not Available | 1332 | Open in IMG/M |
| 3300024326|Ga0228652_1002699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6292 | Open in IMG/M |
| 3300024348|Ga0244776_10064823 | All Organisms → Viruses → Predicted Viral | 2804 | Open in IMG/M |
| 3300024348|Ga0244776_10092153 | Not Available | 2280 | Open in IMG/M |
| 3300024506|Ga0255168_1003821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3376 | Open in IMG/M |
| 3300025070|Ga0208667_1020774 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300025084|Ga0208298_1037220 | Not Available | 991 | Open in IMG/M |
| 3300025636|Ga0209136_1012688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3669 | Open in IMG/M |
| 3300025636|Ga0209136_1059545 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300025684|Ga0209652_1025166 | All Organisms → Viruses → Predicted Viral | 2769 | Open in IMG/M |
| 3300025704|Ga0209602_1079455 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300025704|Ga0209602_1153750 | Not Available | 735 | Open in IMG/M |
| 3300025809|Ga0209199_1195692 | Not Available | 706 | Open in IMG/M |
| 3300025849|Ga0209603_1025534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3583 | Open in IMG/M |
| 3300025849|Ga0209603_1043613 | All Organisms → Viruses → Predicted Viral | 2439 | Open in IMG/M |
| 3300025876|Ga0209223_10298970 | Not Available | 730 | Open in IMG/M |
| 3300025880|Ga0209534_10074868 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
| 3300025889|Ga0208644_1375206 | Not Available | 533 | Open in IMG/M |
| 3300026085|Ga0208880_1025380 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300026138|Ga0209951_1105326 | Not Available | 577 | Open in IMG/M |
| 3300026183|Ga0209932_1000888 | Not Available | 8685 | Open in IMG/M |
| 3300026187|Ga0209929_1001082 | Not Available | 9809 | Open in IMG/M |
| 3300026483|Ga0228620_1018651 | Not Available | 1787 | Open in IMG/M |
| 3300027145|Ga0255114_1007988 | All Organisms → Viruses → Predicted Viral | 2298 | Open in IMG/M |
| 3300027320|Ga0208923_1042806 | Not Available | 807 | Open in IMG/M |
| 3300027413|Ga0208950_1100766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Shirahamavirus → Shirahamavirus PTm1 | 608 | Open in IMG/M |
| 3300027631|Ga0208133_1092030 | Not Available | 710 | Open in IMG/M |
| 3300027732|Ga0209442_1091793 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
| 3300027798|Ga0209353_10069616 | Not Available | 1603 | Open in IMG/M |
| 3300027892|Ga0209550_10020673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 5753 | Open in IMG/M |
| 3300027974|Ga0209299_1115666 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1038 | Open in IMG/M |
| 3300027976|Ga0209702_10029152 | All Organisms → Viruses → Predicted Viral | 3904 | Open in IMG/M |
| 3300028103|Ga0255172_1010020 | Not Available | 1869 | Open in IMG/M |
| 3300028136|Ga0228608_1038641 | Not Available | 1398 | Open in IMG/M |
| 3300028197|Ga0257110_1152482 | Not Available | 928 | Open in IMG/M |
| 3300028233|Ga0256417_1097687 | Not Available | 792 | Open in IMG/M |
| 3300031143|Ga0308025_1023265 | All Organisms → Viruses → Predicted Viral | 2462 | Open in IMG/M |
| 3300031519|Ga0307488_10327951 | Not Available | 974 | Open in IMG/M |
| 3300031629|Ga0307985_10017717 | All Organisms → Viruses → Predicted Viral | 3404 | Open in IMG/M |
| 3300031629|Ga0307985_10029103 | All Organisms → Viruses → Predicted Viral | 2467 | Open in IMG/M |
| 3300031659|Ga0307986_10031063 | All Organisms → Viruses → Predicted Viral | 2955 | Open in IMG/M |
| 3300031659|Ga0307986_10032931 | All Organisms → Viruses → Predicted Viral | 2850 | Open in IMG/M |
| 3300031758|Ga0315907_10523770 | Not Available | 934 | Open in IMG/M |
| 3300031766|Ga0315322_10653841 | Not Available | 666 | Open in IMG/M |
| 3300031784|Ga0315899_11273628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 632 | Open in IMG/M |
| 3300031787|Ga0315900_10705866 | Not Available | 713 | Open in IMG/M |
| 3300031857|Ga0315909_10527287 | Not Available | 808 | Open in IMG/M |
| 3300031963|Ga0315901_10387469 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300032462|Ga0335396_10142155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1582 | Open in IMG/M |
| 3300033992|Ga0334992_0463487 | Not Available | 556 | Open in IMG/M |
| 3300033996|Ga0334979_0676222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 541 | Open in IMG/M |
| 3300034018|Ga0334985_0349049 | Not Available | 906 | Open in IMG/M |
| 3300034018|Ga0334985_0462593 | Not Available | 741 | Open in IMG/M |
| 3300034061|Ga0334987_0803797 | Not Available | 524 | Open in IMG/M |
| 3300034062|Ga0334995_0358260 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 930 | Open in IMG/M |
| 3300034062|Ga0334995_0408180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300034071|Ga0335028_0752363 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 504 | Open in IMG/M |
| 3300034101|Ga0335027_0371523 | Not Available | 938 | Open in IMG/M |
| 3300034102|Ga0335029_0048962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3107 | Open in IMG/M |
| 3300034108|Ga0335050_0257803 | Not Available | 860 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.91% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.45% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.07% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.07% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.07% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.69% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.30% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.77% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.77% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.84% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.84% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.38% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.92% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.92% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.46% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.46% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.46% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.46% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.46% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.46% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.46% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.46% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.46% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001778 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g | Environmental | Open in IMG/M |
| 3300002363 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023273 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_301060 | 2035265000 | Freshwater | MKRLKHEIRPYPKDTASYNTEVVHHLTTYETPEGSENFW |
| DelMOSum2010_100256971 | 3300000101 | Marine | EKKDLLKRLKHEIRPYPKDLNAYNTDIINHTTYAPEESNDINFW* |
| DelMOSum2010_100325325 | 3300000101 | Marine | LATNKKEKKDLLKRLKHEIRPYPKDLNAYNTDIINHTTYAPEESNDINFW* |
| DelMOSum2010_100485893 | 3300000101 | Marine | YIQILATNKKEKKDLMKRLKHPIRDYPKDLNAYNTDVIHHTTYAPEESNEINFW* |
| DelMOSum2010_102323401 | 3300000101 | Marine | TNKKEKKDLMKRLKHPIRDYPKDLNAYNTDVIHHTTYAPEESNEINFW* |
| LPaug08P2610mDRAFT_10049023 | 3300000159 | Marine | YIQILATNKKEKKNLISRLKHEIRPYPKDLNDYNTDVIHHTTYAPEESNEINFW* |
| OpTDRAFT_100021381 | 3300000928 | Freshwater And Marine | KDLMKRLKHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW* |
| OpTDRAFT_102537933 | 3300000928 | Freshwater And Marine | DLHKRLKHPTKPYPKTASDYNTDIIHHTTYAPEESNEINFW* |
| JGI20157J14317_100229695 | 3300001352 | Pelagic Marine | LKHEIRPYPKDLNDYNTDVIHHTTYAPEESNEINFW* |
| JGI20157J14317_100841331 | 3300001352 | Pelagic Marine | LKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW* |
| ACM18_10005324 | 3300001778 | Marine Plankton | DLMKRLKHEIRPYPKELNDYNTEVVHHLTYPPEETNEINFW* |
| B570J29624_1052683 | 3300002363 | Freshwater | VQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAANFW* |
| B570J29032_1090857112 | 3300002408 | Freshwater | AQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| B570J29032_1098802283 | 3300002408 | Freshwater | ILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW* |
| B570J40625_1000852374 | 3300002835 | Freshwater | HRYVQILAQDKKEKKDLMKRLKHEIRTYPKDTASYNTEVVHHLTTYEVPEGTANFW* |
| B570J40625_1000904154 | 3300002835 | Freshwater | QDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW* |
| B570J40625_1006741691 | 3300002835 | Freshwater | DLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW* |
| JGI26084J50262_11040931 | 3300003427 | Marine | YIQILATNKKEKKDLMSRLKHEIRPYPKDLNDYNTDIVHHTTYAPEESNEINFW* |
| JGI26082J51739_100412351 | 3300003617 | Marine | HRYVQILGENKKEKKDLMKRLKHPIQPYPKEASDYNTEVVHHFTYPPEESNEINFW* |
| JGI26273J51734_100930802 | 3300003620 | Marine | ILATNKKEKKDLHKRLKHPTKPYPKTASDYNTDIIHHTTYAPEESNDINFW* |
| JGI26273J51734_101103563 | 3300003620 | Marine | SKKEKKDLHKRLKHETKPYPKTASEYNTDIIHHTTYAPEESNEINFW* |
| Ga0065166_100025795 | 3300004112 | Freshwater Lake | EKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGMANFW* |
| Ga0066180_100869061 | 3300004128 | Freshwater Lake | DLMKRLKHEIRPYPKDTASYNTEVVNHPTTYEAPEGAENFW* |
| Ga0007787_100132685 | 3300004240 | Freshwater Lake | DLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAANFW* |
| Ga0007787_101589121 | 3300004240 | Freshwater Lake | YVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW* |
| Ga0007787_102350902 | 3300004240 | Freshwater Lake | KDLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAEKFW* |
| Ga0007787_106795292 | 3300004240 | Freshwater Lake | MKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| Ga0070374_100896692 | 3300005517 | Freshwater Lake | VQLLAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVNHPTTYEAPEGAENFW* |
| Ga0049080_100253221 | 3300005582 | Freshwater Lentic | QDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHSTTYEAPEGAENFW* |
| Ga0078894_101517271 | 3300005662 | Freshwater Lake | DKKEKKDLMKRLKHEIRPYPKDTSSYNTDVVHHLTTYEVPEGTANFW* |
| Ga0078894_104351932 | 3300005662 | Freshwater Lake | YVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTENFW* |
| Ga0066377_100325491 | 3300005934 | Marine | KKEKKDLMKRLKHEIRPYPKELNDYNTEIVHHLTYPPEETNEINFW* |
| Ga0070749_101482771 | 3300006802 | Aqueous | MKRLKHEIKPYPKSARDYNTDVIRHDAYPPEESNEINFW* |
| Ga0070749_105913822 | 3300006802 | Aqueous | PQNKKEKKDLMKRLKHEIQPYPKSTRDYNTDVIRHDTYPPEESNEINFW* |
| Ga0070749_106627072 | 3300006802 | Aqueous | QNKKEKKDLMKRLKHEIKPYPKSARDYNTDVIRHDAYPPEESNEINFW* |
| Ga0098045_10187591 | 3300006922 | Marine | RLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0098051_10359142 | 3300006924 | Marine | KKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0075469_101942662 | 3300007231 | Aqueous | LKRLKHEIRPYPKDLNAYNTDIINHTTYAPEESNDINFW* |
| Ga0105050_100763741 | 3300007516 | Freshwater | MSRLKHEIQPYPKDLNAYNTEIVHHTTYSPEESNEINFW* |
| Ga0099851_11274121 | 3300007538 | Aqueous | RLKHEIQPYPKSTRDYNTDVIRHDTYPPEESNEINFW* |
| Ga0102875_11143081 | 3300007547 | Estuarine | KKDLLKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| Ga0102881_10866181 | 3300007551 | Estuarine | EKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW* |
| Ga0102923_10760012 | 3300007606 | Estuarine | LMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| Ga0070751_10023071 | 3300007640 | Aqueous | HEIKPYPKSARDYNTDVIRHDAYPPEESNEINFW* |
| Ga0102902_11456251 | 3300007644 | Estuarine | KDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| Ga0102867_11455582 | 3300007716 | Estuarine | LKHEIRPYPKDTSSYNTDVVHHSTTYEAPEGAENFW* |
| Ga0105051_100986606 | 3300007722 | Freshwater | LKHEIQPYPKDLNAYNTEIVHHTTYSPEESNEINFW* |
| Ga0102951_10533351 | 3300007725 | Water | IQILAQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHLTYPPEETNEINFW* |
| Ga0099850_12478801 | 3300007960 | Aqueous | EKKDLMKRLKHEIQPYPKSTRDYNTDVIRHDTYPPEESNEINFW* |
| Ga0102907_11730282 | 3300007962 | Estuarine | EKKNLISRLKHEIRPYPKDLNDYNTDVIHHTTYAPEESNEINFW* |
| Ga0114346_10201641 | 3300008113 | Freshwater, Plankton | VQILAQDKKEKKDLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAANFW* |
| Ga0104242_10533232 | 3300008962 | Freshwater | AQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGTENFW* |
| Ga0104242_10779742 | 3300008962 | Freshwater | AQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAANFW* |
| Ga0102831_10180583 | 3300008996 | Estuarine | NKKEKKDLMKRLKHPILPYPKELNDYNTEIVHHTTYAPEESNEINFW* |
| Ga0102831_12861911 | 3300008996 | Estuarine | VQLLAQDKKEKKDLMKRLKHEIRPYPKDTSSYNTDVVHHLTTYEAPEGAENFW* |
| Ga0102960_10118661 | 3300009000 | Pond Water | RLKHEIKPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0102960_10238181 | 3300009000 | Pond Water | QNKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW* |
| Ga0102963_10075435 | 3300009001 | Pond Water | KKEKKDLMKRLKHEIKPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0102811_10779963 | 3300009024 | Estuarine | LKHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW* |
| Ga0102886_10260221 | 3300009052 | Estuarine | ILATNKKEKKNLISRLKHEIRPYPKDLNDYNTDVIHHTTYAPEESNEINFW* |
| Ga0102815_102016671 | 3300009080 | Estuarine | KNLISRLKHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW* |
| Ga0114980_107114501 | 3300009152 | Freshwater Lake | HEIRPYPKDTASYNTDVVHHLTTYEVPEGTENFW* |
| Ga0114981_104277071 | 3300009160 | Freshwater Lake | QDKKEKKDLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGAENFW* |
| Ga0114995_100616453 | 3300009172 | Marine | EKKDLMKRLKHPIRDYPKDLNAYNTDVIHHTTYAPEESNEINFW* |
| Ga0114979_101393212 | 3300009180 | Freshwater Lake | DLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGAENFW* |
| Ga0114971_101949172 | 3300009185 | Freshwater Lake | LMKRLKHEIRPYPKDTSSYNTDVVHHLTTYEAPEGAENFW* |
| Ga0114971_105219621 | 3300009185 | Freshwater Lake | DLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| Ga0114982_11170021 | 3300009419 | Deep Subsurface | KHEIRPYPKDTASYNTEVVHHLTTYEVPEGTENFW* |
| Ga0115570_101346181 | 3300009496 | Pelagic Marine | KHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0115564_100270181 | 3300009505 | Pelagic Marine | KRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0115564_100591931 | 3300009505 | Pelagic Marine | NKKEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0115572_100284984 | 3300009507 | Pelagic Marine | IQILAQNKKEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0115572_100775951 | 3300009507 | Pelagic Marine | IQILAQNKKEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW* |
| Ga0115572_102171171 | 3300009507 | Pelagic Marine | IQILATNKKEKKDLMKRLKHPIRDYPKDLNAYNTDVIHHTTYAPEESNEINFW* |
| Ga0098056_11956891 | 3300010150 | Marine | KEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW* |
| Ga0151620_10962661 | 3300011268 | Freshwater | LAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTENFW* |
| Ga0157210_10094701 | 3300012665 | Freshwater | HRYVQILAQDKKEKKDLMKRLKHEIKPYPKDTASYNTEVVHHLTTYEAPEGAENFW* |
| Ga0163109_102699672 | 3300012936 | Surface Seawater | HEIKPYPKSARDYNTDVIRHDTYPPEESNEINFW* |
| Ga0129327_100278184 | 3300013010 | Freshwater To Marine Saline Gradient | ATNKKEKKDLLKRLKHEIRPYPKDLNAYNTDIINHTTYAPEESNDINFW* |
| Ga0177922_105467572 | 3300013372 | Freshwater | DLMKRLKHEIRPYPKDTASYNTEVVHHPTTYEAPEGAENFW* |
| Ga0181391_10199501 | 3300017713 | Seawater | RLKHETKPYPKTASDYNTDIVHHTTYAPEESNEINFW |
| Ga0181390_10067014 | 3300017719 | Seawater | LATNKKEKKNLISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0181401_10655121 | 3300017727 | Seawater | IIANSKKEKKDLHKRLKHETKPYPKTASDYNTDIIHHTTYAPEESNEINFW |
| Ga0181417_10907822 | 3300017730 | Seawater | LMKRLKHETKPYPKTASDYNTDIVHHTTYAPEESNEINFW |
| Ga0181399_11563023 | 3300017742 | Seawater | HKRLKHPTKPYPKTASDYNTDIIHHTTYAPEESNEINFW |
| Ga0181402_11198371 | 3300017743 | Seawater | IIANSKKEKKDLHKRLKHETKPYPKTASDYNTDIVHHTTYAPEESNEINFW |
| Ga0181397_11130281 | 3300017744 | Seawater | RYIQIISQNKKEKKDLMKRLKHETKPYPKTASDYNTDIIHHTTYAPEESNEINFW |
| Ga0181400_10407642 | 3300017752 | Seawater | ANSKKEKKDLHKRLKHETKPYPKTASDYNTDIIHHTTYAPEESNEINFW |
| Ga0181400_10613892 | 3300017752 | Seawater | ISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0181356_10788661 | 3300017761 | Freshwater Lake | LLAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVNHPTTYEAPEGAENFW |
| Ga0181410_10854811 | 3300017763 | Seawater | RLKHETKPYPKTASDYNTDIIHHTTYAPEESNEINFW |
| Ga0181380_12835921 | 3300017782 | Seawater | KKNLISRLKHEIRPYPKDLNDYNTDVIHHTTYAPEESNEINFW |
| Ga0181552_102934252 | 3300017824 | Salt Marsh | IIAQNKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0181607_100818921 | 3300017950 | Salt Marsh | YIQILAQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHLTYPPEETNEINFW |
| Ga0181607_100872453 | 3300017950 | Salt Marsh | MKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0181607_104602221 | 3300017950 | Salt Marsh | DLIKRLKHEIKPYPKNTDDFNTEVVNHKTTYVAENTESFW |
| Ga0181580_100348834 | 3300017956 | Salt Marsh | IQILAQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHYTYPPEESNEINFW |
| Ga0181576_100626971 | 3300017985 | Salt Marsh | KKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0181576_106530551 | 3300017985 | Salt Marsh | MKRLKHEIRPYPKELNDYNTEVVHHLTYPPEETNEINFW |
| Ga0181569_100269004 | 3300017986 | Salt Marsh | IAQNKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0181601_100400451 | 3300018041 | Salt Marsh | KEKKDLMKRLKHEIRPYPKELNDYNTEVVHHYTYPPEESNEINFW |
| Ga0181606_101385401 | 3300018048 | Salt Marsh | NKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHYTYPPEESNEINFW |
| Ga0181553_100470931 | 3300018416 | Salt Marsh | RLKHEIRPYPKDLNDYNTDIVHHTTYAPEESNEINFW |
| Ga0181563_100226681 | 3300018420 | Salt Marsh | KRLKHEIKPYPKNTDDFNTEVVNHKTTYVAENTESFW |
| Ga0181563_101353091 | 3300018420 | Salt Marsh | AQNKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0181591_106295971 | 3300018424 | Salt Marsh | QLLPQNKKEKKDLIKRLKHEIKPYPKNTDDFNTEVVNHKTTYVAENTESFW |
| Ga0181564_106060011 | 3300018876 | Salt Marsh | DLMKRLKHEIKPYPKELNDYNTEVVHHTTYAPEESNEINFW |
| Ga0211732_11904911 | 3300020141 | Freshwater | KHEIKAYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0211734_106452412 | 3300020159 | Freshwater | MGLLTISQSYIQILPQNKKERKDLMGRLKHPIQPYPKDLNDYNTEIVHHTTYAP |
| Ga0211734_110980633 | 3300020159 | Freshwater | LAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANYW |
| Ga0211734_112536943 | 3300020159 | Freshwater | GRLKHEIKPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0211733_100609782 | 3300020160 | Freshwater | VQLLAQDKKEKKDLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGSENFW |
| Ga0211733_103280211 | 3300020160 | Freshwater | QIIAQDKREKKDLMGRLKHEIKPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0211733_105765701 | 3300020160 | Freshwater | KKEKKDLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGAENFW |
| Ga0211726_108223996 | 3300020161 | Freshwater | AQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW |
| Ga0211735_115764961 | 3300020162 | Freshwater | KHRYVQIIAQDKREKKDLMGRLKHEIKPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0211729_101863551 | 3300020172 | Freshwater | KREKKDLMGRLKHEIKPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0181602_100201794 | 3300020173 | Salt Marsh | LAQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHYTYPPEESNEINFW |
| Ga0206124_101416472 | 3300020175 | Seawater | TKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0181599_10068548 | 3300020178 | Salt Marsh | YIQILAQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHFTYAPEESNEINFW |
| Ga0181599_12498013 | 3300020178 | Salt Marsh | IKRLKHEIKPYPKNTDDFNTEVVNHKTTYVAENTESFW |
| Ga0206131_100129731 | 3300020185 | Seawater | IQILAQNKKEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0181604_101247422 | 3300020191 | Salt Marsh | KHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0194124_100231601 | 3300020196 | Freshwater Lake | FLAQDKKEKKQLMKALKHEIKPYPKNSVDFNTEVVHHLTTYEAPDGAANFW |
| Ga0211731_112917091 | 3300020205 | Freshwater | KHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW |
| Ga0211731_114779441 | 3300020205 | Freshwater | DKKEKKDLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGSENFW |
| Ga0211577_102288902 | 3300020469 | Marine | KKNLISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0208232_10021685 | 3300020527 | Freshwater | VQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAANFW |
| Ga0208232_10117061 | 3300020527 | Freshwater | MKQLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW |
| Ga0181598_12197811 | 3300020810 | Salt Marsh | KKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0194122_100172146 | 3300021092 | Freshwater Lake | QILAQDKKEKKQLIKALKHEIKPYPKNSVDFNTEVVHHLTTYEAPDGAANFW |
| Ga0214163_10198593 | 3300021141 | Freshwater | KHRYVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYETPEGSENFW |
| Ga0214163_10313981 | 3300021141 | Freshwater | KHRYVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW |
| Ga0206682_102367812 | 3300021185 | Seawater | KEKKNLISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0213865_100103724 | 3300021373 | Seawater | LMKRLKHEIKPYPKELNDYNTEVVHHTTYAPEESNEINFW |
| Ga0213865_100311731 | 3300021373 | Seawater | KRLKHEIKPYPKELNDYNTEVVHHTTYAPEESNEINFW |
| Ga0194117_100281451 | 3300021424 | Freshwater Lake | KKKEKKQLMKALKHEIKPYPKNSVDFNTEVVHHLTTYEAPDGAANFW |
| Ga0222718_100624111 | 3300021958 | Estuarine Water | EKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0222713_104008602 | 3300021962 | Estuarine Water | KKDLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAANFW |
| Ga0222712_106402502 | 3300021963 | Estuarine Water | HRYVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0212021_10171132 | 3300022068 | Aqueous | EKKDLMKRLKHEIKPYPKSARDYNTDVIRHDAYPPEESNEINFW |
| Ga0181351_10108021 | 3300022407 | Freshwater Lake | LAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVNHPTTYEAPEGAENFW |
| Ga0255765_11390901 | 3300022921 | Salt Marsh | AQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHFTYAPEESNEINFW |
| Ga0255773_100762723 | 3300022925 | Salt Marsh | QIIAQNKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0255769_100645293 | 3300022927 | Salt Marsh | LKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| Ga0255758_101149571 | 3300022928 | Salt Marsh | ILSQNKKEKKDLMKRLKHEIKPYPKELNDYNTEVVHHTTYAPEESNEINFW |
| Ga0255770_101221792 | 3300022937 | Salt Marsh | AQNKKEKKDLMKRLKHEIRPYPKELNDYNTEVVHHYTYPPEESNEINFW |
| Ga0255782_102617121 | 3300023105 | Salt Marsh | LMKRLKHEIQSYPKSTRDYNTDVIRHDTYPPEESNEINFW |
| (restricted) Ga0233432_100127027 | 3300023109 | Seawater | LATNKKEKKDLHKRLKHPTKPYPKTASDYNTDIIHHTTYAPEESNDINFW |
| (restricted) Ga0233432_102460911 | 3300023109 | Seawater | ILATNKKEKKDLMKRLKHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW |
| Ga0255777_100030901 | 3300023175 | Salt Marsh | KKEKKDLMKRLKHEIKPYPKELNDYNTEVVHHTTYAPEESNEINFW |
| Ga0255759_100230131 | 3300023178 | Salt Marsh | LMKRLKHEIRPYPKELNDYNTEVVHHLTYPPEETNEINFW |
| Ga0255763_12490773 | 3300023273 | Salt Marsh | KDLIKRLKHEIKPYPKNTDDFNTEVVNHKTTYVAENTESFW |
| Ga0228675_10702502 | 3300024247 | Seawater | KRLKHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW |
| (restricted) Ga0233438_100438863 | 3300024255 | Seawater | ILATNKKEKKDLHKRLKHPTKPYPKTASDYNTDIIHHTTYAPEESNDINFW |
| (restricted) Ga0233444_100268481 | 3300024264 | Seawater | KEKKDLHKRLKHETKPYPKTASEYNTDIIHHTTYAPEESNEINFW |
| Ga0255147_10741792 | 3300024289 | Freshwater | RLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGATNFW |
| Ga0228664_10340261 | 3300024294 | Seawater | KNLISRLKHEIRPYPKDLNDYNTDVIHHTTYAPEESNEINFW |
| Ga0228652_10026991 | 3300024326 | Seawater | SRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0244776_100648231 | 3300024348 | Estuarine | DLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW |
| Ga0244776_100921531 | 3300024348 | Estuarine | IQILATNKKEKKNLISRLKHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW |
| Ga0255168_10038211 | 3300024506 | Freshwater | LMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGATNFW |
| Ga0208667_10207741 | 3300025070 | Marine | RLKHEIKPYPKSARDYNTDIIRHDAYPPEESNEINFW |
| Ga0208298_10372201 | 3300025084 | Marine | KKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0209136_10126884 | 3300025636 | Marine | EKKDLMKRLKHEIRPYPKDLNDYNTDVVHHTTYTPEESNEINFW |
| Ga0209136_10595451 | 3300025636 | Marine | KHEIRPYPKDLNDYNTDVVHHTTYAPEESNEINFW |
| Ga0209652_10251663 | 3300025684 | Marine | QILAQNKKEKKDLMKRLKHEIKPYPKNLNDYNTDIVHHTTYAPEESNEINFW |
| Ga0209602_10794552 | 3300025704 | Pelagic Marine | KEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0209602_11537502 | 3300025704 | Pelagic Marine | LIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0209199_11956921 | 3300025809 | Pelagic Marine | KRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0209603_10255344 | 3300025849 | Pelagic Marine | RLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0209603_10436133 | 3300025849 | Pelagic Marine | KDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0209223_102989701 | 3300025876 | Pelagic Marine | KKEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0209534_100748681 | 3300025880 | Pelagic Marine | ILAQNKKEKKDLIKRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0208644_13752062 | 3300025889 | Aqueous | MKRLKHEIKPYPKSARDYNTDVIRHDAYPPEESNEINFW |
| Ga0208880_10253801 | 3300026085 | Marine | QILAQNKKEKKDLMKRLKHEIRPYPKELNDYNTEIVHHLTYPPEETNEINFW |
| Ga0209951_11053261 | 3300026138 | Pond Water | IQLIPQTKKEKKDLMKRLKHEIQSYPKSTRDYNTDVIRHDTYAPEESNEINFW |
| Ga0209932_10008881 | 3300026183 | Pond Water | EKKDLMKRLKHEIRPYPKELNDYNTEVVHHLTYPPEETNEINFW |
| Ga0209929_10010821 | 3300026187 | Pond Water | NKKEKKDLMKRLKHEIKPYPKDLNDYNTEVVHHTTYPPEESNEINFW |
| Ga0228620_10186512 | 3300026483 | Seawater | KHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0255114_10079881 | 3300027145 | Freshwater | LKHEIRPYPKDTASYNTEVVHHPTTYEAPEGAENFW |
| Ga0208923_10428061 | 3300027320 | Estuarine | KKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANYW |
| Ga0208950_11007661 | 3300027413 | Marine | TNKKEKKDLMKRLKHPIRDYPKDLNAYNTDVIHHTTYAPEESNEINFW |
| Ga0208133_10920301 | 3300027631 | Estuarine | DKKEKKDLMKRLKHEIRPYPKDAASYNTEVVHHPTTYEVPEGTANYW |
| Ga0209442_10917931 | 3300027732 | Freshwater Lake | KKDLMKRLKHEIRPYPKDTASYNTEVVNHPTTYEAPEGAENFW |
| Ga0209353_100696161 | 3300027798 | Freshwater Lake | LAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHPTTYEAPEGAENFW |
| Ga0209550_100206734 | 3300027892 | Freshwater Lake | KHEIRPYPKDTASYNTEVVHHPTTYEAPEGAENFW |
| Ga0209299_11156662 | 3300027974 | Freshwater Lake | QDKKEKKDLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGAENFW |
| Ga0209702_100291527 | 3300027976 | Freshwater | LMSRLKHEIQPYPKDLNAYNTEIVHHTTYSPEESNEINFW |
| Ga0255172_10100201 | 3300028103 | Freshwater | AQDKKEKKDLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAANFW |
| Ga0228608_10386411 | 3300028136 | Seawater | EKKNLISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0257110_11524821 | 3300028197 | Marine | WRREEPPKHRYIQILAQSKKEKRDLVKRLKHETKPYPKEASEYNTDVIHHTTYAPDADREKTFW |
| Ga0256417_10976871 | 3300028233 | Seawater | EEPPKHRYIQILATNKKEKKNLISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINF |
| Ga0308025_10232653 | 3300031143 | Marine | MKSLKHEIRPYPKDASEYNTDVVTHTTYAPEESNSINFW |
| Ga0307488_103279513 | 3300031519 | Sackhole Brine | NKKEKKDLFKRLKHEIRPYPKDLNAYNTDIINHTTYAPEESNDINFW |
| Ga0307985_100177171 | 3300031629 | Marine | KSLKHEIRPYPKDASEYNTDVVTHTTYAPEESNSINFW |
| Ga0307985_100291033 | 3300031629 | Marine | NLMKSLKHEIRPYPKDASEYNTDVVTHTTYAPEESNSINFW |
| Ga0307986_100310631 | 3300031659 | Marine | SKKEKKNLMKSLKHEIRPYPKNLNDYNTDVITHTTHPPEETNEINFW |
| Ga0307986_100329311 | 3300031659 | Marine | KKEKKNLMKSLKHEIRPYPKNLNDYNTDVITHTTHPPEETSEINFW |
| Ga0315907_105237701 | 3300031758 | Freshwater | AQDKKEKKDLMKRLKHEIKPYPKDTASFNTEVVHHLTTYEAPDGAANFW |
| Ga0315322_106538412 | 3300031766 | Seawater | NLISRLKHEIRPYPKDLNDYNTEVVHHTTYAPEESNEINFW |
| Ga0315899_112736282 | 3300031784 | Freshwater | EKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW |
| Ga0315900_107058662 | 3300031787 | Freshwater | DKKEKKDLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAANFW |
| Ga0315909_105272872 | 3300031857 | Freshwater | LAQDKKEKKDLMKRLKHEIKPYPKDTASFNTEVVHHLTTYEAPDGAANFW |
| Ga0315901_103874692 | 3300031963 | Freshwater | VQILAQDKKEKKDLMKRLKHEIKPYPKDTASFNTEIVHHLTTYEAPEGAANFW |
| Ga0335396_101421551 | 3300032462 | Freshwater | WLKHEIQPYPKDLNAYNTEIVHHTTYSPEESNEINFW |
| Ga0334992_0463487_1_153 | 3300033992 | Freshwater | LAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0334979_0676222_391_540 | 3300033996 | Freshwater | AQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYETPEGSENFW |
| Ga0334985_0349049_738_905 | 3300034018 | Freshwater | RYVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0334985_0462593_2_130 | 3300034018 | Freshwater | KDLMSRLKHEIKPYPKDTASYNTEVVHHLTTYEVPEGTENFW |
| Ga0334987_0803797_413_523 | 3300034061 | Freshwater | LKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAANFW |
| Ga0334995_0358260_10_129 | 3300034062 | Freshwater | MKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW |
| Ga0334995_0408180_684_848 | 3300034062 | Freshwater | YVQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEAPEGAENFW |
| Ga0335028_0752363_343_504 | 3300034071 | Freshwater | VQILAQDKKEKKDLMKRLKHEIRPYPKDTASYNTEVVHHLTTYETPEGSENFW |
| Ga0335027_0371523_827_937 | 3300034101 | Freshwater | LKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANFW |
| Ga0335029_0048962_2982_3107 | 3300034102 | Freshwater | DLMKRLKHEIRPYPKDTASYNTEVVHHLTTYEVPEGTANYW |
| Ga0335050_0257803_724_858 | 3300034108 | Freshwater | EKKDLMKRLKHEIRPYPKDTASYNTDVVHHLTTYEAPEGAENFW |
| ⦗Top⦘ |