


| Basic Information | |
|---|---|
| Family ID | F021551 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 218 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 218 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.62 % |
| % of genes from short scaffolds (< 2000 bps) | 91.28 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (69.725 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.147 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.404 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.95% β-sheet: 0.00% Coil/Unstructured: 78.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 218 Family Scaffolds |
|---|---|---|
| PF12236 | Head-tail_con | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.90 % |
| Unclassified | root | N/A | 21.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10108499 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1128 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10174688 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 753 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10274270 | Not Available | 517 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10279639 | Not Available | 509 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10013038 | All Organisms → cellular organisms → Bacteria | 4268 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10077207 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1172 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10214382 | Not Available | 529 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10221444 | Not Available | 516 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10226236 | Not Available | 508 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10130786 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 890 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10133097 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 878 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10168762 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 730 | Open in IMG/M |
| 3300001450|JGI24006J15134_10006181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 6173 | Open in IMG/M |
| 3300001472|JGI24004J15324_10040755 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1436 | Open in IMG/M |
| 3300001472|JGI24004J15324_10150150 | Not Available | 539 | Open in IMG/M |
| 3300001472|JGI24004J15324_10154305 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 527 | Open in IMG/M |
| 3300001589|JGI24005J15628_10221756 | Not Available | 516 | Open in IMG/M |
| 3300001969|GOS2233_1060065 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2002 | Open in IMG/M |
| 3300001973|GOS2217_10157377 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 864 | Open in IMG/M |
| 3300002482|JGI25127J35165_1012041 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2189 | Open in IMG/M |
| 3300002482|JGI25127J35165_1022486 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1504 | Open in IMG/M |
| 3300002482|JGI25127J35165_1079312 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 677 | Open in IMG/M |
| 3300002488|JGI25128J35275_1119136 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 526 | Open in IMG/M |
| 3300005057|Ga0068511_1105448 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 505 | Open in IMG/M |
| 3300006025|Ga0075474_10115719 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 858 | Open in IMG/M |
| 3300006026|Ga0075478_10186405 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 637 | Open in IMG/M |
| 3300006029|Ga0075466_1055404 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1158 | Open in IMG/M |
| 3300006029|Ga0075466_1106114 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 757 | Open in IMG/M |
| 3300006029|Ga0075466_1194707 | Not Available | 504 | Open in IMG/M |
| 3300006332|Ga0068500_1391187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 2290 | Open in IMG/M |
| 3300006401|Ga0075506_1044988 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 522 | Open in IMG/M |
| 3300006405|Ga0075510_10003043 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1290 | Open in IMG/M |
| 3300006735|Ga0098038_1126154 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 867 | Open in IMG/M |
| 3300006737|Ga0098037_1188336 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 679 | Open in IMG/M |
| 3300006737|Ga0098037_1244438 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 577 | Open in IMG/M |
| 3300006793|Ga0098055_1145089 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 915 | Open in IMG/M |
| 3300006810|Ga0070754_10215577 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 889 | Open in IMG/M |
| 3300006916|Ga0070750_10195612 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 898 | Open in IMG/M |
| 3300006916|Ga0070750_10295169 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 694 | Open in IMG/M |
| 3300006916|Ga0070750_10360729 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 612 | Open in IMG/M |
| 3300006916|Ga0070750_10441462 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 539 | Open in IMG/M |
| 3300006919|Ga0070746_10284218 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 764 | Open in IMG/M |
| 3300006921|Ga0098060_1200670 | Not Available | 545 | Open in IMG/M |
| 3300006921|Ga0098060_1214287 | Not Available | 524 | Open in IMG/M |
| 3300006928|Ga0098041_1097017 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 952 | Open in IMG/M |
| 3300006928|Ga0098041_1300379 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 510 | Open in IMG/M |
| 3300006929|Ga0098036_1107747 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 856 | Open in IMG/M |
| 3300006929|Ga0098036_1169886 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 664 | Open in IMG/M |
| 3300006947|Ga0075444_10278305 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 651 | Open in IMG/M |
| 3300006990|Ga0098046_1046943 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1017 | Open in IMG/M |
| 3300007229|Ga0075468_10190224 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 603 | Open in IMG/M |
| 3300007276|Ga0070747_1031403 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300007276|Ga0070747_1291582 | Not Available | 562 | Open in IMG/M |
| 3300007276|Ga0070747_1336348 | Not Available | 516 | Open in IMG/M |
| 3300007337|Ga0079244_1250969 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 815 | Open in IMG/M |
| 3300007345|Ga0070752_1402188 | Not Available | 505 | Open in IMG/M |
| 3300007538|Ga0099851_1017102 | All Organisms → Viruses → Predicted Viral | 2943 | Open in IMG/M |
| 3300007540|Ga0099847_1199678 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 584 | Open in IMG/M |
| 3300007960|Ga0099850_1343952 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 559 | Open in IMG/M |
| 3300007963|Ga0110931_1073519 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1032 | Open in IMG/M |
| 3300008012|Ga0075480_10064938 | All Organisms → Viruses → Predicted Viral | 2104 | Open in IMG/M |
| 3300008219|Ga0114905_1109924 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 948 | Open in IMG/M |
| 3300008221|Ga0114916_1123244 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 604 | Open in IMG/M |
| 3300009071|Ga0115566_10603999 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 614 | Open in IMG/M |
| 3300009077|Ga0115552_1249268 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 717 | Open in IMG/M |
| 3300009418|Ga0114908_1068543 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1234 | Open in IMG/M |
| 3300009418|Ga0114908_1164203 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 706 | Open in IMG/M |
| 3300009420|Ga0114994_10728894 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 646 | Open in IMG/M |
| 3300009425|Ga0114997_10228261 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1058 | Open in IMG/M |
| 3300009433|Ga0115545_1297372 | Not Available | 537 | Open in IMG/M |
| 3300009434|Ga0115562_1066645 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1526 | Open in IMG/M |
| 3300009435|Ga0115546_1006848 | Not Available | 5646 | Open in IMG/M |
| 3300009449|Ga0115558_1094645 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1313 | Open in IMG/M |
| 3300009481|Ga0114932_10166482 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1350 | Open in IMG/M |
| 3300009481|Ga0114932_10228825 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1126 | Open in IMG/M |
| 3300009481|Ga0114932_10403149 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 810 | Open in IMG/M |
| 3300009481|Ga0114932_10403356 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 810 | Open in IMG/M |
| 3300009481|Ga0114932_10819733 | Not Available | 539 | Open in IMG/M |
| 3300009495|Ga0115571_1241795 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 727 | Open in IMG/M |
| 3300009498|Ga0115568_10093160 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1504 | Open in IMG/M |
| 3300009498|Ga0115568_10206300 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 904 | Open in IMG/M |
| 3300009508|Ga0115567_10377528 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 876 | Open in IMG/M |
| 3300009512|Ga0115003_10472356 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 735 | Open in IMG/M |
| 3300009526|Ga0115004_10038523 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300009601|Ga0114914_1072200 | Not Available | 529 | Open in IMG/M |
| 3300009604|Ga0114901_1222908 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 537 | Open in IMG/M |
| 3300009604|Ga0114901_1234526 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 517 | Open in IMG/M |
| 3300009679|Ga0115105_10522258 | Not Available | 581 | Open in IMG/M |
| 3300009703|Ga0114933_10132645 | Not Available | 1728 | Open in IMG/M |
| 3300009703|Ga0114933_10482763 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 806 | Open in IMG/M |
| 3300009703|Ga0114933_10935702 | Not Available | 550 | Open in IMG/M |
| 3300009703|Ga0114933_11076569 | Not Available | 507 | Open in IMG/M |
| 3300009786|Ga0114999_10098093 | Not Available | 2557 | Open in IMG/M |
| 3300010148|Ga0098043_1135329 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 704 | Open in IMG/M |
| 3300010148|Ga0098043_1165188 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 622 | Open in IMG/M |
| 3300011013|Ga0114934_10176591 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 998 | Open in IMG/M |
| 3300011128|Ga0151669_106136 | Not Available | 681 | Open in IMG/M |
| 3300012524|Ga0129331_1242967 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 965 | Open in IMG/M |
| 3300012919|Ga0160422_11001935 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 540 | Open in IMG/M |
| 3300012920|Ga0160423_10585158 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 757 | Open in IMG/M |
| 3300012952|Ga0163180_11350139 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 589 | Open in IMG/M |
| 3300012952|Ga0163180_11896230 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 507 | Open in IMG/M |
| 3300012953|Ga0163179_10507004 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 999 | Open in IMG/M |
| 3300012953|Ga0163179_10760108 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 828 | Open in IMG/M |
| 3300017697|Ga0180120_10373307 | Not Available | 562 | Open in IMG/M |
| 3300017717|Ga0181404_1086327 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 774 | Open in IMG/M |
| 3300017720|Ga0181383_1162107 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 599 | Open in IMG/M |
| 3300017727|Ga0181401_1107218 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 706 | Open in IMG/M |
| 3300017732|Ga0181415_1045949 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 997 | Open in IMG/M |
| 3300017734|Ga0187222_1100389 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 655 | Open in IMG/M |
| 3300017734|Ga0187222_1151546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 515 | Open in IMG/M |
| 3300017739|Ga0181433_1127780 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 606 | Open in IMG/M |
| 3300017740|Ga0181418_1116818 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 645 | Open in IMG/M |
| 3300017743|Ga0181402_1063157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 985 | Open in IMG/M |
| 3300017743|Ga0181402_1129150 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 645 | Open in IMG/M |
| 3300017744|Ga0181397_1150957 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 594 | Open in IMG/M |
| 3300017746|Ga0181389_1121144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 709 | Open in IMG/M |
| 3300017751|Ga0187219_1089794 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 948 | Open in IMG/M |
| 3300017753|Ga0181407_1158176 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 558 | Open in IMG/M |
| 3300017759|Ga0181414_1081656 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 855 | Open in IMG/M |
| 3300017765|Ga0181413_1243685 | Not Available | 530 | Open in IMG/M |
| 3300017771|Ga0181425_1219325 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 593 | Open in IMG/M |
| 3300017773|Ga0181386_1238104 | Not Available | 540 | Open in IMG/M |
| 3300017776|Ga0181394_1219017 | Not Available | 576 | Open in IMG/M |
| 3300017782|Ga0181380_1164321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 753 | Open in IMG/M |
| 3300017951|Ga0181577_10165978 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1494 | Open in IMG/M |
| 3300018416|Ga0181553_10037431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3347 | Open in IMG/M |
| 3300018426|Ga0181566_10021734 | All Organisms → cellular organisms → Bacteria | 5061 | Open in IMG/M |
| 3300020055|Ga0181575_10143909 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1441 | Open in IMG/M |
| 3300020258|Ga0211529_1063332 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 630 | Open in IMG/M |
| 3300020281|Ga0211483_10138807 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 805 | Open in IMG/M |
| 3300020381|Ga0211476_10126944 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 939 | Open in IMG/M |
| 3300020381|Ga0211476_10334122 | Not Available | 508 | Open in IMG/M |
| 3300020395|Ga0211705_10320102 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 575 | Open in IMG/M |
| 3300020403|Ga0211532_10164526 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 903 | Open in IMG/M |
| 3300020413|Ga0211516_10159142 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1051 | Open in IMG/M |
| 3300020439|Ga0211558_10060219 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300020439|Ga0211558_10113210 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1320 | Open in IMG/M |
| 3300020442|Ga0211559_10410954 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 624 | Open in IMG/M |
| 3300020466|Ga0211714_10143104 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1167 | Open in IMG/M |
| 3300020468|Ga0211475_10279746 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 823 | Open in IMG/M |
| 3300020469|Ga0211577_10800296 | Not Available | 543 | Open in IMG/M |
| 3300021365|Ga0206123_10379030 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 586 | Open in IMG/M |
| 3300021371|Ga0213863_10028366 | All Organisms → Viruses → Predicted Viral | 3111 | Open in IMG/M |
| 3300022053|Ga0212030_1060957 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 537 | Open in IMG/M |
| 3300022071|Ga0212028_1029323 | Not Available | 996 | Open in IMG/M |
| 3300022074|Ga0224906_1068169 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1100 | Open in IMG/M |
| 3300022074|Ga0224906_1075319 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1031 | Open in IMG/M |
| 3300022200|Ga0196901_1187728 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 669 | Open in IMG/M |
| 3300022839|Ga0222649_1040255 | Not Available | 530 | Open in IMG/M |
| 3300022853|Ga0222652_1048907 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 600 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10427067 | Not Available | 529 | Open in IMG/M |
| 3300023108|Ga0255784_10392530 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 662 | Open in IMG/M |
| 3300023235|Ga0222634_1052533 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 588 | Open in IMG/M |
| 3300024344|Ga0209992_10063568 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1724 | Open in IMG/M |
| 3300024344|Ga0209992_10073362 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1576 | Open in IMG/M |
| 3300024344|Ga0209992_10281915 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 682 | Open in IMG/M |
| 3300025071|Ga0207896_1038861 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 797 | Open in IMG/M |
| 3300025071|Ga0207896_1042505 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 756 | Open in IMG/M |
| 3300025079|Ga0207890_1071334 | Not Available | 552 | Open in IMG/M |
| 3300025102|Ga0208666_1070654 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 921 | Open in IMG/M |
| 3300025120|Ga0209535_1209689 | Not Available | 537 | Open in IMG/M |
| 3300025127|Ga0209348_1027089 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300025127|Ga0209348_1038072 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1682 | Open in IMG/M |
| 3300025127|Ga0209348_1053308 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1357 | Open in IMG/M |
| 3300025127|Ga0209348_1099313 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 906 | Open in IMG/M |
| 3300025127|Ga0209348_1107064 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 862 | Open in IMG/M |
| 3300025127|Ga0209348_1140734 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 716 | Open in IMG/M |
| 3300025127|Ga0209348_1164666 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 643 | Open in IMG/M |
| 3300025132|Ga0209232_1058962 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1380 | Open in IMG/M |
| 3300025132|Ga0209232_1079584 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1137 | Open in IMG/M |
| 3300025132|Ga0209232_1237663 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 533 | Open in IMG/M |
| 3300025137|Ga0209336_10175019 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 547 | Open in IMG/M |
| 3300025138|Ga0209634_1115148 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1159 | Open in IMG/M |
| 3300025138|Ga0209634_1260680 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 621 | Open in IMG/M |
| 3300025141|Ga0209756_1280176 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 598 | Open in IMG/M |
| 3300025168|Ga0209337_1323580 | Not Available | 544 | Open in IMG/M |
| 3300025168|Ga0209337_1353716 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 502 | Open in IMG/M |
| 3300025280|Ga0208449_1017744 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300025282|Ga0208030_1143687 | Not Available | 565 | Open in IMG/M |
| 3300025282|Ga0208030_1146413 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 557 | Open in IMG/M |
| 3300025286|Ga0208315_1087606 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 756 | Open in IMG/M |
| 3300025610|Ga0208149_1057358 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 994 | Open in IMG/M |
| 3300025652|Ga0208134_1046186 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1412 | Open in IMG/M |
| 3300025652|Ga0208134_1178101 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 512 | Open in IMG/M |
| 3300025653|Ga0208428_1156708 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 607 | Open in IMG/M |
| 3300025759|Ga0208899_1258258 | Not Available | 513 | Open in IMG/M |
| 3300025806|Ga0208545_1163925 | Not Available | 520 | Open in IMG/M |
| 3300025816|Ga0209193_1058115 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1051 | Open in IMG/M |
| 3300025830|Ga0209832_1131113 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 757 | Open in IMG/M |
| 3300025853|Ga0208645_1257138 | Not Available | 577 | Open in IMG/M |
| 3300025853|Ga0208645_1276076 | Not Available | 542 | Open in IMG/M |
| 3300025892|Ga0209630_10229291 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 885 | Open in IMG/M |
| 3300026465|Ga0247588_1015028 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1430 | Open in IMG/M |
| 3300027686|Ga0209071_1084123 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 940 | Open in IMG/M |
| 3300027704|Ga0209816_1029064 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
| 3300027704|Ga0209816_1285687 | Not Available | 505 | Open in IMG/M |
| 3300027771|Ga0209279_10022617 | Not Available | 1912 | Open in IMG/M |
| 3300027788|Ga0209711_10352258 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 619 | Open in IMG/M |
| 3300027844|Ga0209501_10523732 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 675 | Open in IMG/M |
| 3300027859|Ga0209503_10322276 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 755 | Open in IMG/M |
| 3300028022|Ga0256382_1043610 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1033 | Open in IMG/M |
| 3300028022|Ga0256382_1097693 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 704 | Open in IMG/M |
| 3300028022|Ga0256382_1116183 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 642 | Open in IMG/M |
| 3300028197|Ga0257110_1192633 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 794 | Open in IMG/M |
| 3300028233|Ga0256417_1056090 | Not Available | 1066 | Open in IMG/M |
| 3300028671|Ga0257132_1094472 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 640 | Open in IMG/M |
| 3300029448|Ga0183755_1034209 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1452 | Open in IMG/M |
| 3300029787|Ga0183757_1007783 | Not Available | 3295 | Open in IMG/M |
| 3300029787|Ga0183757_1051528 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 707 | Open in IMG/M |
| 3300029787|Ga0183757_1072644 | Not Available | 502 | Open in IMG/M |
| 3300031519|Ga0307488_10779463 | Not Available | 531 | Open in IMG/M |
| 3300031599|Ga0308007_10132320 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 900 | Open in IMG/M |
| 3300031626|Ga0302121_10105693 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 825 | Open in IMG/M |
| 3300031695|Ga0308016_10001918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 10146 | Open in IMG/M |
| 3300031785|Ga0310343_11409595 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 526 | Open in IMG/M |
| 3300032277|Ga0316202_10183847 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 970 | Open in IMG/M |
| 3300033742|Ga0314858_083282 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 804 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.15% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.60% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.55% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.09% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 5.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.50% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.50% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 5.05% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.29% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.38% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.38% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.46% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.46% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.46% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.46% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.46% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.46% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.46% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.46% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.46% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.46% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300001973 | Marine microbial communities from Bermuda, Atlantic Ocean - GS001 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007337 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022839 | Saline water microbial communities from Ace Lake, Antarctica - #337 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026465 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028671 | Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101084993 | 3300000101 | Marine | NEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEEKDY* |
| DelMOSum2010_101746882 | 3300000101 | Marine | KAKNEKLAIDPNAKVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY* |
| DelMOSum2010_102742701 | 3300000101 | Marine | KNEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| DelMOSum2010_102796391 | 3300000101 | Marine | VKNEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDASIFRMAEERDY* |
| DelMOSum2011_100130381 | 3300000115 | Marine | AKAKNEKLAIDPNAKVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY* |
| DelMOSum2011_100772073 | 3300000115 | Marine | MVNFLDVAKVKNEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDASIFRMAEERDY* |
| DelMOSum2011_102143821 | 3300000115 | Marine | AIDPNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| DelMOSum2011_102214443 | 3300000115 | Marine | KVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| DelMOSum2011_102262363 | 3300000115 | Marine | EKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| DelMOSpr2010_101307864 | 3300000116 | Marine | DPNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| DelMOSpr2010_101330973 | 3300000116 | Marine | KNEKLAIDPNSKVTHGATAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| DelMOSpr2010_101687621 | 3300000116 | Marine | EKLAIDPNSKVTQGATAGDSNDKPGAKSKVDASIFRMAEERDY* |
| JGI24006J15134_100061818 | 3300001450 | Marine | KVNQGAISGDGNDKKGKSKSKVDPAIFRMAEERDY* |
| JGI24004J15324_100407552 | 3300001472 | Marine | NEKLAIDPNAKVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY* |
| JGI24004J15324_101501501 | 3300001472 | Marine | EKLAIDPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| JGI24004J15324_101543051 | 3300001472 | Marine | DPNAKVKQGAMSGDGNDKPGAKSKVDPSIFKMAEERDY* |
| JGI24005J15628_102217563 | 3300001589 | Marine | VKNEKLAIDPNSKVTKGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| GOS2233_10600654 | 3300001969 | Marine | PNDPMQIDPSSKIVQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| GOS2217_101573771 | 3300001973 | Marine | KMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| JGI25127J35165_10120414 | 3300002482 | Marine | PMQIDPSSKIVQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| JGI25127J35165_10224861 | 3300002482 | Marine | PNDPMQIDPNSKVTQGSMTGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| JGI25127J35165_10793123 | 3300002482 | Marine | EPMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| JGI25128J35275_11191361 | 3300002488 | Marine | AIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0068511_11054482 | 3300005057 | Marine Water | PNEPLAIDANSKVTQGSMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0075474_101157191 | 3300006025 | Aqueous | LMRGKLEIDPNAKVKHGSVAGDGKDKKGKSKSKVDPAIFKMADQKDY* |
| Ga0075478_101864051 | 3300006026 | Aqueous | MKIKQGDMAGDGKDKKGKSKSKVDPSIFRMADQKDY* |
| Ga0075466_10554041 | 3300006029 | Aqueous | PNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0075466_11061141 | 3300006029 | Aqueous | DPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0075466_11947071 | 3300006029 | Aqueous | KLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEEKDY* |
| Ga0068500_13911871 | 3300006332 | Marine | KVKNEKLAIDPNSKVKHGSTAGDGNDKPGAKSKVDPAIFRMAEERDY* |
| Ga0075506_10449881 | 3300006401 | Aqueous | MKIKQGDMAGDGKDKKGKSKSKVDPSIFRMAEEKDY* |
| Ga0075510_100030431 | 3300006405 | Aqueous | SMKIKQGDMAGDGKDKKGKSKSKVDPSIFRMAEEKDY* |
| Ga0098038_11261541 | 3300006735 | Marine | NSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098037_11883361 | 3300006737 | Marine | NSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098037_12444381 | 3300006737 | Marine | DPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098055_11450891 | 3300006793 | Marine | KVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0070754_102155771 | 3300006810 | Aqueous | NSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0070750_101956121 | 3300006916 | Aqueous | KVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0070750_102951691 | 3300006916 | Aqueous | IDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0070750_103607291 | 3300006916 | Aqueous | SKVTQGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0070750_104414622 | 3300006916 | Aqueous | EPMAIDPNAKVMQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0070746_102842181 | 3300006919 | Aqueous | KVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098060_12006701 | 3300006921 | Marine | IDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0098060_12142873 | 3300006921 | Marine | LAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098041_10970171 | 3300006928 | Marine | VKNEKLAIDPNSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098041_13003791 | 3300006928 | Marine | MKIKQGDLSTAADKPGKKDKVDPSIFKMAEQRDY* |
| Ga0098036_11077471 | 3300006929 | Marine | KLAIDPNSKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0098036_11698861 | 3300006929 | Marine | KRPNDAMEIDPNSKVNQGDMAGDQNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0075444_102783051 | 3300006947 | Marine | SKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY* |
| Ga0098046_10469432 | 3300006990 | Marine | DPNAKVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY* |
| Ga0075468_101902241 | 3300007229 | Aqueous | NSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0070747_10314031 | 3300007276 | Aqueous | RPNDKLAIDPNSKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0070747_12915821 | 3300007276 | Aqueous | EKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0070747_13363481 | 3300007276 | Aqueous | EKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEEKDY* |
| Ga0079244_12509691 | 3300007337 | Marine | MAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0070752_14021883 | 3300007345 | Aqueous | PNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0099851_10171021 | 3300007538 | Aqueous | LAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0099847_11996783 | 3300007540 | Aqueous | SKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0099850_13439521 | 3300007960 | Aqueous | PNAKVKQGAMSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0110931_10735191 | 3300007963 | Marine | KAPNAPLAIDPNSKVNQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0075480_100649381 | 3300008012 | Aqueous | KEPMAIDPNSKVNQGAMSGDANDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0114905_11099242 | 3300008219 | Deep Ocean | PKEPMAIDPNSKVNQGAMSGDANDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0114916_11232443 | 3300008221 | Deep Ocean | AIDPNSKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY* |
| Ga0115566_106039993 | 3300009071 | Pelagic Marine | ADVAKAKNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0115552_12492681 | 3300009077 | Pelagic Marine | AKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114908_10685433 | 3300009418 | Deep Ocean | DPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0114908_11642031 | 3300009418 | Deep Ocean | AIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114994_107288943 | 3300009420 | Marine | DVAKVKNEKLAIDPNSKVTKGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114997_102282611 | 3300009425 | Marine | NSKVTQGATAGDSNDKPGKKDKVDASIFKAAEQRDY* |
| Ga0115545_12973721 | 3300009433 | Pelagic Marine | DVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0115562_10666453 | 3300009434 | Pelagic Marine | ADVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0115546_10068481 | 3300009435 | Pelagic Marine | VNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0115558_10946451 | 3300009449 | Pelagic Marine | DVAKVKNEKLAIDPNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114932_101664821 | 3300009481 | Deep Subsurface | DPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0114932_102288252 | 3300009481 | Deep Subsurface | PMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0114932_104031491 | 3300009481 | Deep Subsurface | VKNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114932_104033563 | 3300009481 | Deep Subsurface | PNSKVMQGATSGDGNDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0114932_108197333 | 3300009481 | Deep Subsurface | MAIDPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0115571_12417952 | 3300009495 | Pelagic Marine | IDPNSKVNQGAMSGDANDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0115568_100931603 | 3300009498 | Pelagic Marine | DVAKAKNEKLAIDPNSKVTHGATAGDSNDKPGAKLKVDPSIFRMAEERDY* |
| Ga0115568_102063001 | 3300009498 | Pelagic Marine | PKAAKEPMAIDPNSKVNQGAVSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0115567_103775283 | 3300009508 | Pelagic Marine | SKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0115003_104723562 | 3300009512 | Marine | KVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY* |
| Ga0115004_100385231 | 3300009526 | Marine | KLAIDPNAKVKHGAVAGDGNDKPGKKDKVDPAIFKMAEQRDY* |
| Ga0114914_10722001 | 3300009601 | Deep Ocean | AKVKNEKLAIDPNSKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY* |
| Ga0114901_12229081 | 3300009604 | Deep Ocean | PNSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114901_12345261 | 3300009604 | Deep Ocean | SKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0115105_105222583 | 3300009679 | Marine | AIDPNSKVKHGSTAGDGNDKPGAKSKVDPAIFRMAEERDY* |
| Ga0114933_101326452 | 3300009703 | Deep Subsurface | PNSKVNQGATSGDGNDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0114933_104827633 | 3300009703 | Deep Subsurface | MAIDPNSKVNQGATSGDGNDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0114933_109357021 | 3300009703 | Deep Subsurface | IEPMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEQRDY* |
| Ga0114933_110765691 | 3300009703 | Deep Subsurface | KVNQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0114999_100980934 | 3300009786 | Marine | DPNAKVKQGAVAGDGNDKPGKKDKVDSSIFAMAEKRDY* |
| Ga0098043_11353291 | 3300010148 | Marine | DVAKVKNEKLAIDPNSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0098043_11651881 | 3300010148 | Marine | PDVAKVKNEKLAIDPNSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0114934_101765911 | 3300011013 | Deep Subsurface | KEPMAIDPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0151669_1061362 | 3300011128 | Marine | VAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0129331_12429673 | 3300012524 | Aqueous | DVAKAKNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY* |
| Ga0160422_110019352 | 3300012919 | Seawater | SKVTQGSMSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0160423_105851581 | 3300012920 | Surface Seawater | AIDPNSKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0163180_113501392 | 3300012952 | Seawater | VMQGATSGDGNDKKGKSKSKVDPAIFRMAEERDY* |
| Ga0163180_118962302 | 3300012952 | Seawater | AIDPNSKVNQGARSGDGNDAKGKSKSKVDPAIFRMAEERDY* |
| Ga0163179_105070041 | 3300012953 | Seawater | APLAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIYRMAEERDY* |
| Ga0163179_107601081 | 3300012953 | Seawater | PNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDYY* |
| Ga0180120_103733071 | 3300017697 | Freshwater To Marine Saline Gradient | EKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181404_10863271 | 3300017717 | Seawater | AIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181383_11621073 | 3300017720 | Seawater | NSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181401_11072181 | 3300017727 | Seawater | DVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFKMAEERDY |
| Ga0181415_10459491 | 3300017732 | Seawater | KEPMAIDPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0187222_11003893 | 3300017734 | Seawater | EKLAIDPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0187222_11515461 | 3300017734 | Seawater | NEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181433_11277801 | 3300017739 | Seawater | KNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181418_11168181 | 3300017740 | Seawater | PKAGKEPMAIDPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0181402_10631573 | 3300017743 | Seawater | ADVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181402_11291503 | 3300017743 | Seawater | ADVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFKMAEERDY |
| Ga0181397_11509571 | 3300017744 | Seawater | IDPNSKVTHGPTAGDGNDKPGAKSKVDPSIFRMAAERDY |
| Ga0181389_11211443 | 3300017746 | Seawater | EKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0187219_10897941 | 3300017751 | Seawater | IDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181407_11581761 | 3300017753 | Seawater | NEKLAIDPNAKVKHGAMSGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181414_10816561 | 3300017759 | Seawater | KPKSKVKQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0181413_12436853 | 3300017765 | Seawater | VKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFKMAEERDY |
| Ga0181425_12193251 | 3300017771 | Seawater | NEKLAIDPNSKGTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181386_12381041 | 3300017773 | Seawater | PKRPNEPMAIDPNSKVNQGDMTGDGNDKKGKSKSKVDPSIFRMAEQRDY |
| Ga0181394_12190171 | 3300017776 | Seawater | DVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGARSKVDPSIFKMAEERDY |
| Ga0181380_11643213 | 3300017782 | Seawater | PNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0181577_101659781 | 3300017951 | Salt Marsh | PMQIDPNSKVTQGSMAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0181553_100374313 | 3300018416 | Salt Marsh | DVAKRPNDKLAIDPNSKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0181566_100217341 | 3300018426 | Salt Marsh | QIDPNSKVTQGSMAGDGNDAKGKSKSKVDPAIFRMAEEKDY |
| Ga0181575_101439092 | 3300020055 | Salt Marsh | IDPNSKVTQGSMAGDGNDAKGKSKSKVDPAIFRMAEEKDY |
| Ga0211529_10633322 | 3300020258 | Marine | PMAIDPNAKVQQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211483_101388073 | 3300020281 | Marine | PKRPNDPMAIDPNSKVKQGDMTGDGNDKKGKSKSKVDPAIFRMAEERDY |
| Ga0211476_101269443 | 3300020381 | Marine | SPKAPIEKMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEQRDY |
| Ga0211476_103341221 | 3300020381 | Marine | MAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211705_103201022 | 3300020395 | Marine | MAIDPNSKIKQGATSGDGNDKKGKSKSKVDPSIFRMAEERDY |
| Ga0211532_101645262 | 3300020403 | Marine | SKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211516_101591421 | 3300020413 | Marine | KAPNAPLAIDPNSKVNQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211558_100602192 | 3300020439 | Marine | PLAIDANSKVTQGSMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211558_101132102 | 3300020439 | Marine | DKLAIDPNSKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211559_104109542 | 3300020442 | Marine | MAIDPNAKVKQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211714_101431041 | 3300020466 | Marine | PNSKVNQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211475_102797461 | 3300020468 | Marine | DPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0211577_108002961 | 3300020469 | Marine | KLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0206123_103790301 | 3300021365 | Seawater | TPKAAKEPMAIDPNSKVNQGAVSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0213863_100283661 | 3300021371 | Seawater | SKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0212030_10609571 | 3300022053 | Aqueous | LAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0212028_10293232 | 3300022071 | Aqueous | DKLEINPNMKIKQGDMAGDGKDKKGKSKSKVDPSIFRMAEEKDY |
| Ga0224906_10681691 | 3300022074 | Seawater | EPMAIDPNSKVNQGDMTGDGNDKKGKSKSKVDPAIFRMAEERDY |
| Ga0224906_10753191 | 3300022074 | Seawater | PKAPIEPMAIDPNSKITQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0196901_11877282 | 3300022200 | Aqueous | KLEINPNMKIKQGDMAGDGKDKKGKSKSKVDPSIFRMAEEKDY |
| Ga0222649_10402551 | 3300022839 | Saline Water | RNEKLAIDPNSKVTKGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0222652_10489071 | 3300022853 | Saline Water | LAIDPNSKVTKGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| (restricted) Ga0233427_104270673 | 3300022933 | Seawater | IDPNSKVTQGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0255784_103925302 | 3300023108 | Salt Marsh | NSKVTQGSTASDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0222634_10525333 | 3300023235 | Saline Water | PNSKVTQGSTAGDSNDKQGAKSKVDPSIFRMAEERDY |
| Ga0209992_100635683 | 3300024344 | Deep Subsurface | AIDPNSKVNQGATSGDGNDKKGKSKSKVDPAIFRMAEERDY |
| Ga0209992_100733623 | 3300024344 | Deep Subsurface | LAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209992_102819153 | 3300024344 | Deep Subsurface | KNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0207896_10388613 | 3300025071 | Marine | ADVAKVKNEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDASIFRMAEERDY |
| Ga0207896_10425051 | 3300025071 | Marine | AKNEKLAIDPNAKVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY |
| Ga0207890_10713343 | 3300025079 | Marine | VKNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208666_10706542 | 3300025102 | Marine | LAIDPNSKVNQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209535_12096891 | 3300025120 | Marine | SADVAKVKNEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209348_10270891 | 3300025127 | Marine | KVNQGDMAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209348_10380721 | 3300025127 | Marine | PNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209348_10533082 | 3300025127 | Marine | APKAPNEPMAIDPNSKVNQGDMAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209348_10993131 | 3300025127 | Marine | KVTQGTMAGDASDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209348_11070641 | 3300025127 | Marine | SKVNQGDMAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209348_11407341 | 3300025127 | Marine | IDPNAKVQQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209348_11646663 | 3300025127 | Marine | AIDPNAKVQQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209232_10589622 | 3300025132 | Marine | NEPMAIDPNSKVNQGDMAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209232_10795842 | 3300025132 | Marine | KVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209232_12376631 | 3300025132 | Marine | KKPNEPLAIDANSKVTQGSMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209336_101750191 | 3300025137 | Marine | AIDPNAKVKQGAMSGDGNDKPGAKSKVDPSIFKMAEERDY |
| Ga0209634_11151481 | 3300025138 | Marine | KNEKLAIDPNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209634_12606803 | 3300025138 | Marine | PNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209756_12801761 | 3300025141 | Marine | TPKAPNEPMAIDPNAKVQQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0209337_13235801 | 3300025168 | Marine | PNSKVTQGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209337_13537161 | 3300025168 | Marine | KAKNEKLAIDPNAKVKHGAMSGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208449_10177443 | 3300025280 | Deep Ocean | SKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0208030_11436873 | 3300025282 | Deep Ocean | AKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208030_11464132 | 3300025282 | Deep Ocean | DTPKAPKEPMAIDPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0208315_10876061 | 3300025286 | Deep Ocean | EPMAIDPNSKVNQGAMSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0208149_10573582 | 3300025610 | Aqueous | NMKIKQGDMAGDGKDKKGKSKSKVDPSIFRMADQKDY |
| Ga0208134_10461861 | 3300025652 | Aqueous | KRPNDKLAIDPNSKVTQGSTAGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0208134_11781011 | 3300025652 | Aqueous | EKLAIDPNAKVKQGAMSGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208428_11567081 | 3300025653 | Aqueous | LEINPNMKINQGDMAGDGKDKKGKSKSKVDPSIFRMADQKDY |
| Ga0208899_12582581 | 3300025759 | Aqueous | KNEKLAIDPNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208545_11639253 | 3300025806 | Aqueous | NEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEEKDY |
| Ga0209193_10581152 | 3300025816 | Pelagic Marine | DVAKAKNEKLAIDPNAKVKHGAVAGDGNDKPGKKDKVDPSIFRMAEERDY |
| Ga0209832_11311133 | 3300025830 | Pelagic Marine | ADVAKAKNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208645_12571381 | 3300025853 | Aqueous | VAKVKNEKLAIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0208645_12760761 | 3300025853 | Aqueous | AIDPNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209630_102292913 | 3300025892 | Pelagic Marine | SKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0247588_10150281 | 3300026465 | Seawater | DVAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209071_10841231 | 3300027686 | Marine | IDPNAKIKQGSVAGDSNDKPGKKDKVNPAIFKMAEQRDY |
| Ga0209816_10290641 | 3300027704 | Marine | SKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY |
| Ga0209816_12856873 | 3300027704 | Marine | KLAIDPNSKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY |
| Ga0209279_100226173 | 3300027771 | Marine | NEKLAIDPNSKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY |
| Ga0209711_103522583 | 3300027788 | Marine | KLAIDPNSKVTKGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0209501_105237323 | 3300027844 | Marine | EKLAIDVNSKVLHGATAGDSNDKPGKKDKVDASIFKAAEQRDY |
| Ga0209503_103222763 | 3300027859 | Marine | SADVAKVKNEKLAIDPNSKVTQGATSGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0256382_10436103 | 3300028022 | Seawater | IDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0256382_10976931 | 3300028022 | Seawater | PMAIDPNSKVNQGDMTGDGNDKKGKSKSKVDPAIFRMAEERDY |
| Ga0256382_11161831 | 3300028022 | Seawater | MAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEQRDY |
| Ga0257110_11926331 | 3300028197 | Marine | AIDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0256417_10560903 | 3300028233 | Seawater | VAKVKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0257132_10944721 | 3300028671 | Marine | VKNEKLAIDPNSKVTHGSTAGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0183755_10342094 | 3300029448 | Marine | APLAIDPNSKVNQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0183757_10077834 | 3300029787 | Marine | RPNEPMAIDPNSKVNQGDMTGDGNDKKGKSKSKVDPAIFRMAEERDY |
| Ga0183757_10515282 | 3300029787 | Marine | EPMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0183757_10726443 | 3300029787 | Marine | APKAPIEPMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0307488_107794632 | 3300031519 | Sackhole Brine | DVAKVKNEKLAIDPNSKVTHGSTAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0308007_101323201 | 3300031599 | Marine | VKNEKLAIDPNSKVLQGATSGDSNDKPGAKEKVDASIFKMAEERDY |
| Ga0302121_101056932 | 3300031626 | Marine | KVKNEKLAIDPNAKVKHGAMSGDGNDKPGAKSKVDPSIFRMAEERDY |
| Ga0308016_1000191813 | 3300031695 | Marine | IDPNSKVIQGATSGDSNDKPGAKEKVDASIFKMAEERDY |
| Ga0310343_114095951 | 3300031785 | Seawater | RPNDAMEIDPNSKVNQGDMAGDQNDAKGKSKSKVDPAIFRMAEERDY |
| Ga0316202_101838473 | 3300032277 | Microbial Mat | KLALDPNSKVTHGATAGDSNDKPGAKSKVDPSIFRMAEERDY |
| Ga0314858_083282_668_802 | 3300033742 | Sea-Ice Brine | NEKLAIDPNSKVTQGATAGDSNDKPGKKDKVDASIFKAAEQRDY |
| ⦗Top⦘ |