


| Basic Information | |
|---|---|
| Family ID | F021437 |
| Family Type | Metagenome |
| Number of Sequences | 219 |
| Average Sequence Length | 50 residues |
| Representative Sequence | RRELVTSEPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 219 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.65 % |
| % of genes near scaffold ends (potentially truncated) | 94.06 % |
| % of genes from short scaffolds (< 2000 bps) | 87.67 % |
| Associated GOLD sequencing projects | 179 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.132 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.790 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.54% β-sheet: 0.00% Coil/Unstructured: 59.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 219 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 33.79 |
| PF01799 | Fer2_2 | 7.76 |
| PF09084 | NMT1 | 5.94 |
| PF13883 | Pyrid_oxidase_2 | 3.65 |
| PF00111 | Fer2 | 2.74 |
| PF16868 | NMT1_3 | 2.28 |
| PF02738 | MoCoBD_1 | 2.28 |
| PF00903 | Glyoxalase | 1.37 |
| PF13620 | CarboxypepD_reg | 1.37 |
| PF12681 | Glyoxalase_2 | 1.37 |
| PF01243 | Putative_PNPOx | 0.91 |
| PF00011 | HSP20 | 0.91 |
| PF01797 | Y1_Tnp | 0.91 |
| PF02604 | PhdYeFM_antitox | 0.46 |
| PF04392 | ABC_sub_bind | 0.46 |
| PF03795 | YCII | 0.46 |
| PF04055 | Radical_SAM | 0.46 |
| PF05977 | MFS_3 | 0.46 |
| PF05598 | DUF772 | 0.46 |
| PF04542 | Sigma70_r2 | 0.46 |
| PF04480 | DUF559 | 0.46 |
| PF00890 | FAD_binding_2 | 0.46 |
| PF01471 | PG_binding_1 | 0.46 |
| PF03235 | DUF262 | 0.46 |
| PF01408 | GFO_IDH_MocA | 0.46 |
| PF00701 | DHDPS | 0.46 |
| PF01053 | Cys_Met_Meta_PP | 0.46 |
| PF01613 | Flavin_Reduct | 0.46 |
| PF13531 | SBP_bac_11 | 0.46 |
| PF00171 | Aldedh | 0.46 |
| PF03928 | HbpS-like | 0.46 |
| PF02899 | Phage_int_SAM_1 | 0.46 |
| PF03466 | LysR_substrate | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 219 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.94 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.94 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.91 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.46 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.46 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.46 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.46 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.46 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.46 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.46 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.46 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.46 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.46 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.46 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.46 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.46 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.46 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.46 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.46 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.46 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.46 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.46 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.46 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.46 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.46 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.46 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.46 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.80 % |
| Unclassified | root | N/A | 3.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102659622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-8 | 864 | Open in IMG/M |
| 3300000574|JGI1357J11328_10164632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10053288 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10134280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300000890|JGI11643J12802_10598927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300000953|JGI11615J12901_10393959 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300001139|JGI10220J13317_11883588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300001431|F14TB_106112781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300002124|C687J26631_10028487 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300003996|Ga0055467_10084755 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300003998|Ga0055472_10131682 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300004114|Ga0062593_101122721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 818 | Open in IMG/M |
| 3300004267|Ga0066396_10003963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1522 | Open in IMG/M |
| 3300004633|Ga0066395_10618937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300004778|Ga0062383_10749114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300004808|Ga0062381_10049321 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300005168|Ga0066809_10087114 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005169|Ga0066810_10122852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005179|Ga0066684_10890145 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300005181|Ga0066678_10626222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300005332|Ga0066388_100681168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1638 | Open in IMG/M |
| 3300005347|Ga0070668_100186235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1698 | Open in IMG/M |
| 3300005355|Ga0070671_100236813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1549 | Open in IMG/M |
| 3300005366|Ga0070659_101001636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
| 3300005435|Ga0070714_101815182 | Not Available | 595 | Open in IMG/M |
| 3300005444|Ga0070694_101171221 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005446|Ga0066686_10239525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1223 | Open in IMG/M |
| 3300005446|Ga0066686_10806337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300005451|Ga0066681_10321565 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005518|Ga0070699_100531427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300005545|Ga0070695_101801792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300005552|Ga0066701_10715016 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005561|Ga0066699_10955122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005578|Ga0068854_100861626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300005586|Ga0066691_10153019 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300005713|Ga0066905_101609300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300005764|Ga0066903_105216859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300005764|Ga0066903_107746739 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005895|Ga0075277_1005983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300005895|Ga0075277_1061352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300005981|Ga0081538_10024736 | All Organisms → cellular organisms → Bacteria | 4267 | Open in IMG/M |
| 3300006058|Ga0075432_10611342 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006794|Ga0066658_10906047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300006794|Ga0066658_10915999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300006845|Ga0075421_100135508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3084 | Open in IMG/M |
| 3300006846|Ga0075430_100672057 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006847|Ga0075431_100705191 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300006847|Ga0075431_101799184 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006852|Ga0075433_10223619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1672 | Open in IMG/M |
| 3300006852|Ga0075433_10979610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300006853|Ga0075420_101142026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300006854|Ga0075425_100049142 | All Organisms → cellular organisms → Bacteria | 4723 | Open in IMG/M |
| 3300006871|Ga0075434_100142234 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300006871|Ga0075434_100187341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2090 | Open in IMG/M |
| 3300006954|Ga0079219_11379525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300006969|Ga0075419_10749952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300007076|Ga0075435_100926128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300009012|Ga0066710_102809694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300009053|Ga0105095_10227446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300009094|Ga0111539_10703662 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300009111|Ga0115026_10766389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300009137|Ga0066709_100820217 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300009157|Ga0105092_10957639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300009162|Ga0075423_10138900 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300009162|Ga0075423_12569985 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009167|Ga0113563_13575145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300009174|Ga0105241_10054319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3066 | Open in IMG/M |
| 3300009174|Ga0105241_10120810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2110 | Open in IMG/M |
| 3300009597|Ga0105259_1093559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300009609|Ga0105347_1026632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2005 | Open in IMG/M |
| 3300009609|Ga0105347_1212448 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009610|Ga0105340_1246381 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009818|Ga0105072_1002195 | All Organisms → cellular organisms → Bacteria | 3048 | Open in IMG/M |
| 3300009837|Ga0105058_1023780 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300010043|Ga0126380_11488443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300010047|Ga0126382_10020160 | All Organisms → cellular organisms → Bacteria | 3452 | Open in IMG/M |
| 3300010048|Ga0126373_11270236 | Not Available | 802 | Open in IMG/M |
| 3300010329|Ga0134111_10024064 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300010360|Ga0126372_10009780 | All Organisms → cellular organisms → Bacteria | 5037 | Open in IMG/M |
| 3300010360|Ga0126372_10038438 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
| 3300010360|Ga0126372_10934498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300010371|Ga0134125_12024929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300010398|Ga0126383_10497254 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300010400|Ga0134122_11741042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300010400|Ga0134122_11927834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300010401|Ga0134121_12362366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300010403|Ga0134123_11494281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
| 3300011398|Ga0137348_1052995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300011423|Ga0137436_1100362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300011429|Ga0137455_1234989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300011434|Ga0137464_1168086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300012038|Ga0137431_1136433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300012041|Ga0137430_1040650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1245 | Open in IMG/M |
| 3300012041|Ga0137430_1052290 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300012143|Ga0137354_1075326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300012168|Ga0137357_1092793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300012202|Ga0137363_10950223 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012208|Ga0137376_11203314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300012208|Ga0137376_11243996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300012231|Ga0137465_1260306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300012349|Ga0137387_10735704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300012354|Ga0137366_10228667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1383 | Open in IMG/M |
| 3300012360|Ga0137375_10899566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas kerstersii | 703 | Open in IMG/M |
| 3300012469|Ga0150984_107443402 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300012582|Ga0137358_10717642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300012906|Ga0157295_10328082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012911|Ga0157301_10464661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300012918|Ga0137396_10190875 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300012922|Ga0137394_10712487 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300012930|Ga0137407_10712775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 945 | Open in IMG/M |
| 3300012951|Ga0164300_10122646 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300012960|Ga0164301_10489164 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012972|Ga0134077_10054451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1482 | Open in IMG/M |
| 3300012985|Ga0164308_11221725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300013306|Ga0163162_10993960 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300013308|Ga0157375_12515744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300013308|Ga0157375_13037834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300014270|Ga0075325_1030510 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300014270|Ga0075325_1069074 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300014295|Ga0075305_1082823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300014298|Ga0075341_1132142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300014307|Ga0075304_1131124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 591 | Open in IMG/M |
| 3300014324|Ga0075352_1210256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300014745|Ga0157377_11157120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300014882|Ga0180069_1009191 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300014884|Ga0180104_1182077 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300015200|Ga0173480_10684301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300015258|Ga0180093_1068961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300015371|Ga0132258_11016850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2095 | Open in IMG/M |
| 3300015372|Ga0132256_101199555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 872 | Open in IMG/M |
| 3300015372|Ga0132256_102514456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
| 3300015373|Ga0132257_101920218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
| 3300015373|Ga0132257_102223899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
| 3300015374|Ga0132255_100894469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1327 | Open in IMG/M |
| 3300015374|Ga0132255_102455174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
| 3300015374|Ga0132255_103789576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300017966|Ga0187776_10546894 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300018000|Ga0184604_10336651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300018053|Ga0184626_10199649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300018068|Ga0184636_1286004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300018074|Ga0184640_10064189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1543 | Open in IMG/M |
| 3300018075|Ga0184632_10099204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
| 3300018075|Ga0184632_10283011 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018078|Ga0184612_10025019 | All Organisms → cellular organisms → Bacteria | 3074 | Open in IMG/M |
| 3300018079|Ga0184627_10279125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300018082|Ga0184639_10043368 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300018082|Ga0184639_10153709 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300018422|Ga0190265_10446666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1399 | Open in IMG/M |
| 3300018429|Ga0190272_11697112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300018469|Ga0190270_10389463 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300018476|Ga0190274_11542783 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 756 | Open in IMG/M |
| 3300018481|Ga0190271_12209080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300018481|Ga0190271_12768524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300018481|Ga0190271_13800068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300019789|Ga0137408_1485888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4852 | Open in IMG/M |
| 3300020003|Ga0193739_1056782 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300020004|Ga0193755_1175115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300020010|Ga0193749_1015141 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300020200|Ga0194121_10090386 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300021073|Ga0210378_10216819 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300021080|Ga0210382_10140973 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300022208|Ga0224495_10225601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300025310|Ga0209172_10460024 | Not Available | 593 | Open in IMG/M |
| 3300025791|Ga0210115_1034683 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300025916|Ga0207663_11065240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300025926|Ga0207659_11140577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300025930|Ga0207701_10005740 | All Organisms → cellular organisms → Bacteria | 12431 | Open in IMG/M |
| 3300025930|Ga0207701_10055959 | All Organisms → cellular organisms → Bacteria | 3612 | Open in IMG/M |
| 3300025932|Ga0207690_11578015 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025933|Ga0207706_11055776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300025961|Ga0207712_11373310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300026005|Ga0208285_1016341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300026035|Ga0207703_12078128 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300026121|Ga0207683_11080446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300026296|Ga0209235_1229115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300026313|Ga0209761_1191612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 912 | Open in IMG/M |
| 3300026320|Ga0209131_1377561 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300027056|Ga0209879_1015994 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300027364|Ga0209967_1047054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300027513|Ga0208685_1108658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300027654|Ga0209799_1154211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300027695|Ga0209966_1046602 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300027775|Ga0209177_10062260 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300027818|Ga0209706_10302919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300027831|Ga0209797_10014061 | All Organisms → cellular organisms → Bacteria | 3711 | Open in IMG/M |
| 3300027843|Ga0209798_10151655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300027843|Ga0209798_10214688 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300027873|Ga0209814_10009529 | All Organisms → cellular organisms → Bacteria | 3803 | Open in IMG/M |
| 3300027873|Ga0209814_10295174 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027907|Ga0207428_10023543 | All Organisms → cellular organisms → Bacteria | 5178 | Open in IMG/M |
| 3300027907|Ga0207428_10561942 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300028379|Ga0268266_10363502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1362 | Open in IMG/M |
| 3300030006|Ga0299907_10336005 | Not Available | 1226 | Open in IMG/M |
| 3300030606|Ga0299906_10351783 | Not Available | 1145 | Open in IMG/M |
| 3300030619|Ga0268386_10196638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1513 | Open in IMG/M |
| 3300030619|Ga0268386_10503189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300031820|Ga0307473_10605493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300031824|Ga0307413_12113866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031847|Ga0310907_10877675 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031890|Ga0306925_11554960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
| 3300031903|Ga0307407_10809190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300031908|Ga0310900_10683869 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031995|Ga0307409_100838666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300032003|Ga0310897_10599545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300032013|Ga0310906_10447043 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300032059|Ga0318533_10789382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300032122|Ga0310895_10276790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300032163|Ga0315281_10133620 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300032174|Ga0307470_11820180 | Not Available | 516 | Open in IMG/M |
| 3300032179|Ga0310889_10291657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300032180|Ga0307471_100175928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2103 | Open in IMG/M |
| 3300032180|Ga0307471_101848134 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300032205|Ga0307472_101115700 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300033004|Ga0335084_10184731 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300033289|Ga0310914_10315408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1411 | Open in IMG/M |
| 3300033813|Ga0364928_0199435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300034148|Ga0364927_0016937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1676 | Open in IMG/M |
| 3300034177|Ga0364932_0191050 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300034417|Ga0364941_063214 | Not Available | 848 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.13% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.13% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.02% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.74% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.74% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.28% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.28% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.37% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.37% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.46% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.46% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.46% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.46% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012143 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2 | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1026596221 | 3300000559 | Soil | KAGFRRELTISEPGVQGILNFLSDTVPEAKNAVPSQFFDDRFVRQLNSGR* |
| JGI1357J11328_101646322 | 3300000574 | Groundwater | GFRRELVTSEPGLQGILDFLGDSIPEAKTAKPSQFFDDRIVRQMNAGK* |
| AF_2010_repII_A001DRAFT_100532883 | 3300000793 | Forest Soil | ELVTSNPGIQGMLDFLSESIPEAKKATPAQFFDDRFVRQVNNAR* |
| AF_2010_repII_A001DRAFT_101342802 | 3300000793 | Forest Soil | GMQGILDFLSETIPEAKKATPAQFFDDRFVHQLNSAR* |
| JGI11643J12802_105989271 | 3300000890 | Soil | SREMVTSEPGLQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSAK* |
| JGI11615J12901_103939592 | 3300000953 | Soil | SGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNARDR* |
| JGI10220J13317_118835882 | 3300001139 | Soil | QGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSAK* |
| F14TB_1061127812 | 3300001431 | Soil | MISEPGMRGMLNFLSESVPEAKKAEPAQFFDDRFVRQLNSGK* |
| C687J26631_100284871 | 3300002124 | Soil | GVQGILDFLSDTVPEAKKATPAQFFDDRFVRQLNSAR* |
| Ga0055467_100847551 | 3300003996 | Natural And Restored Wetlands | KKAGFRREMVTSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK* |
| Ga0055472_101316821 | 3300003998 | Natural And Restored Wetlands | KAGFRREMVTSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK* |
| Ga0062593_1011227212 | 3300004114 | Soil | GFKRELMISEPGMQGILDFLSETMPETKRATPAQFFDDRFVRQLNSAK* |
| Ga0066396_100039632 | 3300004267 | Tropical Forest Soil | DRTYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEVKTAKPSQFFDDRFVRAVNAAK* |
| Ga0066395_106189372 | 3300004633 | Tropical Forest Soil | YEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEAKTAKPSQFFDDRFVRAVNAAK* |
| Ga0062383_107491141 | 3300004778 | Wetland Sediment | IAKYNKETDPDALDRSYEFYRRAGFRRELLISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKLLDASK* |
| Ga0062381_100493211 | 3300004808 | Wetland Sediment | ESDPDVLDRSYEFFKKAGFRRELVTSEAGLQGVLDFLSESISEAKTAKPAQFFDDRILRQVNAAK* |
| Ga0066809_100871142 | 3300005168 | Soil | FRRELIISEPGVQGILNFLSETIPEAKNAVPSQFFDDRFVRQLNSGR* |
| Ga0066810_101228521 | 3300005169 | Soil | ISEPGIQGILDFLSETMPETKKAIPAQFFDDRFVRQLNSGK* |
| Ga0066684_108901451 | 3300005179 | Soil | SEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSVK* |
| Ga0066678_106262222 | 3300005181 | Soil | SYEFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK* |
| Ga0066388_1006811682 | 3300005332 | Tropical Forest Soil | PFFFSPHDFLDRTYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEAKTAKPSQFFDDRFVRAVNAAK* |
| Ga0070668_1001862353 | 3300005347 | Switchgrass Rhizosphere | VLDRSYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK |
| Ga0070671_1002368131 | 3300005355 | Switchgrass Rhizosphere | EPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRRVNSGK* |
| Ga0070659_1010016361 | 3300005366 | Corn Rhizosphere | DLMISASGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNVRDR* |
| Ga0070714_1018151822 | 3300005435 | Agricultural Soil | SDPGIQGMLDFLSESIPEAKKATPSQFFDDRFVRQVNSAR* |
| Ga0070694_1011712212 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DQEVLDRSYEFYKKAGFRREMVTSEPGLQGMLDFLAESIPEAKSVKPSQFFDDRFVRQVNAGK* |
| Ga0066686_102395251 | 3300005446 | Soil | YTKESDQDVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK* |
| Ga0066686_108063371 | 3300005446 | Soil | DVLDRSYEFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK* |
| Ga0066681_103215652 | 3300005451 | Soil | DLMISEPGVQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP* |
| Ga0070699_1005314273 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ISESGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSVK* |
| Ga0070695_1018017922 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | YKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0066701_107150161 | 3300005552 | Soil | ISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDSGR* |
| Ga0066699_109551222 | 3300005561 | Soil | KKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPSQFFDDRFVRQVNSGK* |
| Ga0068854_1008616262 | 3300005578 | Corn Rhizosphere | VLDRSYEFYKKAGFRRELLTSEPGVQGILDFLSESIPEAKTAKPAQFFDDRFVRRVNSGK |
| Ga0066691_101530192 | 3300005586 | Soil | TRENDPEVLDKTYEFYAKAGFRRDLMISEPGVRGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP* |
| Ga0066905_1016093002 | 3300005713 | Tropical Forest Soil | RRELMISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGGR* |
| Ga0066903_1052168591 | 3300005764 | Tropical Forest Soil | LQGILDFLSESIPEAKTAKPAQFFDDRFVRQLNSGK* |
| Ga0066903_1077467391 | 3300005764 | Tropical Forest Soil | KAGFRRELMISEPGMRGILDFLSETLPEAKKATPSQFFDDRFVRQINSAR* |
| Ga0075277_10059831 | 3300005895 | Rice Paddy Soil | GKYTKENDQEVLDRSYEFYKRAGFRRELVTSEPGIQGILDFLSDSIPEAKHAKPSQFFDDRFVRQVNGGK* |
| Ga0075277_10613522 | 3300005895 | Rice Paddy Soil | SEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK* |
| Ga0081538_100247364 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ISEPGVQGILDFLSETTPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0075432_106113422 | 3300006058 | Populus Rhizosphere | SGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNVRDR* |
| Ga0066658_109060471 | 3300006794 | Soil | YEFYGKAGFRRDLMISEPGVQGILNFLQETIPEAKNAKPSRFYDDRLVRQMDSGR* |
| Ga0066658_109159991 | 3300006794 | Soil | YEFYGKAGFRRDLMISEPGVQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP* |
| Ga0075421_1001355084 | 3300006845 | Populus Rhizosphere | DRSYEFYKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSAK* |
| Ga0075430_1006720571 | 3300006846 | Populus Rhizosphere | PGVQGILDFLSETIPEANKAKPSQFFDDRLVKQVDGGR* |
| Ga0075431_1007051912 | 3300006847 | Populus Rhizosphere | GVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK* |
| Ga0075431_1017991842 | 3300006847 | Populus Rhizosphere | LQGMLDFLTETIPEAKSAKPSQFFDDRFVRQVNAGK* |
| Ga0075433_102236194 | 3300006852 | Populus Rhizosphere | LDKTYEFYRKAGFRRELVTSDPGIQGMLDFLSESIPEAKKATPSQFFDDRFVRQVNSGK* |
| Ga0075433_109796101 | 3300006852 | Populus Rhizosphere | TSGIQGILDFLSETFPEAKKATPAQFFDDRLLRQVNARDH* |
| Ga0075420_1011420261 | 3300006853 | Populus Rhizosphere | ISEPGVQGILNFLSETIPEAKNAVPSQFFDDRFVRQLNSGR* |
| Ga0075425_1000491421 | 3300006854 | Populus Rhizosphere | RRELVTSEPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK* |
| Ga0075434_1001422345 | 3300006871 | Populus Rhizosphere | SYEFYKRAGFRRELLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0075434_1001873411 | 3300006871 | Populus Rhizosphere | TYEFYRKAGFRRELIISEPGVQGILNFLSDTVPEAKNAVPAQFFDDRFVRQLNSGR* |
| Ga0079219_113795252 | 3300006954 | Agricultural Soil | AGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSSR* |
| Ga0075419_107499521 | 3300006969 | Populus Rhizosphere | KSYEFYRKAGFRRELVTSEPGVQGILDFLTESIPQAKNAKPSQFFDDRFVRQVNSAK* |
| Ga0075435_1009261282 | 3300007076 | Populus Rhizosphere | SYEFYKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0066710_1028096942 | 3300009012 | Grasslands Soil | VLDRSYEFFKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPSQFFDDRFVRQVNTGK |
| Ga0105095_102274462 | 3300009053 | Freshwater Sediment | YRRAGFRRELMISEPGVQGILDFLSETVPETKKAPPAQFFDDRFVRQLNSGK* |
| Ga0111539_107036623 | 3300009094 | Populus Rhizosphere | FRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK* |
| Ga0115026_107663892 | 3300009111 | Wetland | AGFRRELVTSEPGLQGILDFLSESIPEAKSAKPTQFFDDRILRQVNAGK* |
| Ga0066709_1008202171 | 3300009137 | Grasslands Soil | GFRRDLMISEPGVQGILNCLSDTVPEAKNAVPAQFFDDRFVRQLNSGR* |
| Ga0105092_109576391 | 3300009157 | Freshwater Sediment | TDHEILERTYEFYKRAGFRREMVTSEPGLQGMLDFLSETIPEAKNAKPAQFFDDRFVRQLNSGK* |
| Ga0075423_101389004 | 3300009162 | Populus Rhizosphere | GIQGILDFLSETVPEAKKATPAQFFDDRLLRQLNTVDR* |
| Ga0075423_125699851 | 3300009162 | Populus Rhizosphere | RDLMISTSGIQGILHFLSETLPEAKKATPAQFFDDRLLRQVNARDH* |
| Ga0113563_135751451 | 3300009167 | Freshwater Wetlands | PGIQGILDFLSETMPETKKATPAQFFDDRFVRQLNSAK* |
| Ga0105241_100543191 | 3300009174 | Corn Rhizosphere | LLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVLRVNSGK* |
| Ga0105241_101208101 | 3300009174 | Corn Rhizosphere | ASGIQGILDFLSETVPEAKRAAPAQFFDDRLLRQLNARDR* |
| Ga0105259_10935591 | 3300009597 | Soil | AGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPTQFFDDRILRQVNAGK* |
| Ga0105347_10266322 | 3300009609 | Soil | LKVIPKYTRDTDADIIERTYEFYRKAGFKRELMISEPGMQGVLDFMAETMPETKKATPAQFFDDRFVRQLNSGR* |
| Ga0105347_12124481 | 3300009609 | Soil | TSEPGLQGMLDFLAESIPEAKSAKPSQFFDDRFVRQVNAGK* |
| Ga0105340_12463812 | 3300009610 | Soil | DPDALDRSYEFYRRAGFRRELTISEPGVQGMLDFLSETIPEAKKAKPAHFFDDRLVKQLDGGK* |
| Ga0105072_10021951 | 3300009818 | Groundwater Sand | LMISEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0105058_10237802 | 3300009837 | Groundwater Sand | FRRELMISEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0126380_114884432 | 3300010043 | Tropical Forest Soil | VLERSYEFYKKAGFRRELVTSEPGLQGIMDFLSETIPEAKTAKPSQFFDDRFVRQVNSGK |
| Ga0126382_100201601 | 3300010047 | Tropical Forest Soil | ELMISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVRQMDGGR* |
| Ga0126373_112702361 | 3300010048 | Tropical Forest Soil | AEVLDKTYEFYRKAGFRRELVTSDPGIQGMLDFLSESIPEARKATPSQFFDDRFVRQVNNAR* |
| Ga0134111_100240641 | 3300010329 | Grasslands Soil | QGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP* |
| Ga0126372_100097805 | 3300010360 | Tropical Forest Soil | VTSEQGLQGVLDFLSESIPEVKTAKPSQFFDDRFVRAVNAAK* |
| Ga0126372_100384381 | 3300010360 | Tropical Forest Soil | PGMQGILDFLSETVPEAKKAAPAQFFDDRFVRQLNSGR* |
| Ga0126372_109344982 | 3300010360 | Tropical Forest Soil | MISEPGIQGILDFLSETIPEAKKAAPAQFFDDRFVRQLNSAR* |
| Ga0134125_120249291 | 3300010371 | Terrestrial Soil | KKAGFRRELLTSDPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0126383_104972541 | 3300010398 | Tropical Forest Soil | TYEFYRKAGFRRELMISEPGMRGILDFLSETLPEAKKATPAQFFDDRFVRQINSAR* |
| Ga0134122_117410422 | 3300010400 | Terrestrial Soil | GIQGILDYLTETIPEAKKATPAQFFDDRFVRQLNSAK* |
| Ga0134122_119278342 | 3300010400 | Terrestrial Soil | VLDRSYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRRVNSGK |
| Ga0134121_123623662 | 3300010401 | Terrestrial Soil | LQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0134123_114942811 | 3300010403 | Terrestrial Soil | RELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRQLNSAK* |
| Ga0137348_10529951 | 3300011398 | Soil | RELVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK* |
| Ga0137436_11003622 | 3300011423 | Soil | SDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK* |
| Ga0137455_12349892 | 3300011429 | Soil | AGFRRELVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK* |
| Ga0137464_11680862 | 3300011434 | Soil | EFFKKAGFRRELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQVNAGK* |
| Ga0137431_11364331 | 3300012038 | Soil | ALETNPEVLDRSYEFYKKAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAGK* |
| Ga0137430_10406503 | 3300012041 | Soil | MISEPGMQGILDFLSETMPETKKATPAQFFDDRFVRQLNSGK* |
| Ga0137430_10522901 | 3300012041 | Soil | PFSMKVIGKYAIETNPEVLDRSYEFYKKAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAGK* |
| Ga0137354_10753262 | 3300012143 | Soil | LVTSEPGLQGMLDFLAESIPEAKSAKPSQFFDDRFVRQVNAGK* |
| Ga0137357_10927932 | 3300012168 | Soil | RRELMVSEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGGR* |
| Ga0137363_109502231 | 3300012202 | Vadose Zone Soil | RRDLMISEPGVQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP* |
| Ga0137376_112033142 | 3300012208 | Vadose Zone Soil | FYRKAGFRRDLMISEPGVQGILNFLSDTVPEAKNAVPAQFFDDRFVRQLNSGR* |
| Ga0137376_112439962 | 3300012208 | Vadose Zone Soil | LDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK* |
| Ga0137465_12603061 | 3300012231 | Soil | YNRETDPDALNRSYEFYRRAGFRRELTISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKQLDGGK* |
| Ga0137387_107357041 | 3300012349 | Vadose Zone Soil | QGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0137366_102286671 | 3300012354 | Vadose Zone Soil | LMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0137375_108995662 | 3300012360 | Vadose Zone Soil | RRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRLLNSAK* |
| Ga0150984_1074434022 | 3300012469 | Avena Fatua Rhizosphere | VSEPGIQGILDFLSETVPEAKKASPGQFFDDRLLRQLNSGK* |
| Ga0137358_107176422 | 3300012582 | Vadose Zone Soil | VTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNTGK* |
| Ga0157295_103280822 | 3300012906 | Soil | VDRSYEFYKKAGFRRELITSEPGLQGVLDFLSESIPEAKAAKPTQFFDDRILRQVNAAK* |
| Ga0157301_104646611 | 3300012911 | Soil | RSYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK* |
| Ga0137396_101908751 | 3300012918 | Vadose Zone Soil | VLDRSYEFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK |
| Ga0137394_107124871 | 3300012922 | Vadose Zone Soil | RDLMISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVNDSK* |
| Ga0137407_107127753 | 3300012930 | Vadose Zone Soil | EPGVQGILNFLSETIPEAKNAVPSQFFDDRFVRQLNSGR* |
| Ga0164300_101226463 | 3300012951 | Soil | QGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0164301_104891641 | 3300012960 | Soil | LDRSYEFYKKAGFRRELLTSDPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0134077_100544513 | 3300012972 | Grasslands Soil | FRRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0164308_112217252 | 3300012985 | Soil | TSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0163162_109939602 | 3300013306 | Switchgrass Rhizosphere | YEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK* |
| Ga0157375_125157442 | 3300013308 | Miscanthus Rhizosphere | TSESGVQGILDFLSDSIPEAKSAKPSQFFDDRFVRQVNSSK* |
| Ga0157375_130378341 | 3300013308 | Miscanthus Rhizosphere | KAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK* |
| Ga0075325_10305101 | 3300014270 | Natural And Restored Wetlands | GFRRELVTSEPGIQGILDFLSDSIPEAKHAKPGQFFDERFVRQVNAAK* |
| Ga0075325_10690741 | 3300014270 | Natural And Restored Wetlands | MISEPGMRGILNFLSETTVPEAKKAEPSQFFDDRFVRQLNSGK* |
| Ga0075305_10828231 | 3300014295 | Natural And Restored Wetlands | SETGVQGILDFLGETIPEARKAKLGQFFDDRLVKQVDAGR* |
| Ga0075341_11321421 | 3300014298 | Natural And Restored Wetlands | PGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAGK* |
| Ga0075304_11311242 | 3300014307 | Natural And Restored Wetlands | RRELMISEPGVQGILDFLSETVPETKKAVPGQFFDDRFVRQLNSAK* |
| Ga0075352_12102561 | 3300014324 | Natural And Restored Wetlands | IGKYTHETDQDVLERSYEFYKKAGFRRELVTSEPGLRGILDFLFESIPEAKAAKPTQFFDDRILRQVNAAK* |
| Ga0157377_111571202 | 3300014745 | Miscanthus Rhizosphere | QGILDFLSETIPEAKRATPAQFFDDRLLRQLNARER* |
| Ga0180069_10091913 | 3300014882 | Soil | QGILDFLSETIPEAKKAKPSQFFDDRLVKQMDGAK* |
| Ga0180104_11820772 | 3300014884 | Soil | FRRELVISESGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGAR* |
| Ga0173480_106843011 | 3300015200 | Soil | KAGFRRELLTSDPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0180093_10689611 | 3300015258 | Soil | YEFYRKAGFRRELLISEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR* |
| Ga0132258_110168501 | 3300015371 | Arabidopsis Rhizosphere | YEFYKRAGFRRELLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK* |
| Ga0132256_1011995551 | 3300015372 | Arabidopsis Rhizosphere | KAGFRRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRQLNSAK* |
| Ga0132256_1025144562 | 3300015372 | Arabidopsis Rhizosphere | ELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFMRQLNSAK* |
| Ga0132257_1019202181 | 3300015373 | Arabidopsis Rhizosphere | LMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRHLNSAK* |
| Ga0132257_1022238992 | 3300015373 | Arabidopsis Rhizosphere | GFRRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFMRQLNSAK* |
| Ga0132255_1008944692 | 3300015374 | Arabidopsis Rhizosphere | AGFRRELLTSDPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK* |
| Ga0132255_1024551741 | 3300015374 | Arabidopsis Rhizosphere | QGILDFLTETIPEAKKATPAQFFDDRFMRQLNSAK* |
| Ga0132255_1037895762 | 3300015374 | Arabidopsis Rhizosphere | VLDRSYEFYKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQYFDDRFVRHVNSGK |
| Ga0187776_105468942 | 3300017966 | Tropical Peatland | VQGILDFLSETTPEAKKAAPAQFFDDRFVRQLNSGR |
| Ga0184604_103366511 | 3300018000 | Groundwater Sediment | KKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK |
| Ga0184626_101996492 | 3300018053 | Groundwater Sediment | FAMKVIGKYTKENDQEILDRTYEFYKKAGFRRDMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK |
| Ga0184636_12860042 | 3300018068 | Groundwater Sediment | ELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQINATK |
| Ga0184640_100641892 | 3300018074 | Groundwater Sediment | MKVIGKYAKETDQEVLDRSYEFYKEAGFRRELVASELGLQGILDLLSESMPEAKSAKPAQFFDDLIVRQVHATK |
| Ga0184632_100992041 | 3300018075 | Groundwater Sediment | RTYEFYRKAGFRRELTISEPGVQGILNFLSDTVPEAKNAVPSQFFDDRFVRQLNSGR |
| Ga0184632_102830112 | 3300018075 | Groundwater Sediment | QGILDFLSETIPEAKKAKPSQFFDERLVKQVNDSK |
| Ga0184612_100250193 | 3300018078 | Groundwater Sediment | YEFYKKAGFRREMVTSEPGLQGMLDFLTETIPEAKSAKPSQFFDDRFVRQINAGK |
| Ga0184627_102791252 | 3300018079 | Groundwater Sediment | KAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK |
| Ga0184639_100433681 | 3300018082 | Groundwater Sediment | PGLQGMLDFLTETIPEAKSAKPSQFFDDRFVRQVNAGK |
| Ga0184639_101537091 | 3300018082 | Groundwater Sediment | FRREMVTSEPGLQGMLDFLSETIPEAKSAKPAQFFDDRFVRQVNSGK |
| Ga0190265_104466661 | 3300018422 | Soil | AYKEPGVQDILDFLSETVPEAKKAQAAQFFDNRFVRQLNGAK |
| Ga0190272_116971122 | 3300018429 | Soil | FFKKAGFRRELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQVNATK |
| Ga0190270_103894631 | 3300018469 | Soil | KAGFRRELVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK |
| Ga0190274_115427832 | 3300018476 | Soil | RELMISEPGIQGILDFLTETTPEAKKATPAQFFDDRFVRQLNSGK |
| Ga0190271_122090801 | 3300018481 | Soil | LVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK |
| Ga0190271_127685242 | 3300018481 | Soil | EVLDRSYEFYKKAGFRRELVTSEPGLQGMLDFLAESIPEAKSAKPSQFFDDRFVRQVNAG |
| Ga0190271_138000681 | 3300018481 | Soil | ETDPEVLARSYEFFKKAGFRRELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQVNATK |
| Ga0137408_14858888 | 3300019789 | Vadose Zone Soil | VIGKYTKESDQDVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK |
| Ga0193739_10567821 | 3300020003 | Soil | TKESDQEVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK |
| Ga0193755_11751151 | 3300020004 | Soil | RRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSVK |
| Ga0193749_10151411 | 3300020010 | Soil | FFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK |
| Ga0194121_100903864 | 3300020200 | Freshwater Lake | TRESENDIVDRSYEFYKKAGFRRELVTSEPGLQGMLDFLSESMPEAKTAKPAQFFDDRFVRQVNK |
| Ga0210378_102168192 | 3300021073 | Groundwater Sediment | YRKAGFRRELMISETGVRGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSAK |
| Ga0210382_101409731 | 3300021080 | Groundwater Sediment | VIGKYTKESDQDVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSAK |
| Ga0224495_102256012 | 3300022208 | Sediment | VTSEAGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAAK |
| Ga0209172_104600242 | 3300025310 | Hot Spring Sediment | FRRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGK |
| Ga0210115_10346831 | 3300025791 | Natural And Restored Wetlands | TYEFYRKAGFRRELMISEPGMRGILNFLSETTVPEAKKAEPMQFFDDRFVRQLNSGK |
| Ga0207663_110652402 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK |
| Ga0207659_111405772 | 3300025926 | Miscanthus Rhizosphere | YKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK |
| Ga0207701_1000574017 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK |
| Ga0207701_100559591 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK |
| Ga0207690_115780151 | 3300025932 | Corn Rhizosphere | DLMISASGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNVRDR |
| Ga0207706_110557762 | 3300025933 | Corn Rhizosphere | FKKAGFRRELVTSEPGVQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSNK |
| Ga0207712_113733103 | 3300025961 | Switchgrass Rhizosphere | EPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK |
| Ga0208285_10163411 | 3300026005 | Rice Paddy Soil | KKAGFRREMVTSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK |
| Ga0207703_120781281 | 3300026035 | Switchgrass Rhizosphere | ELVTSEPGLHGMLEFLSESIPEAKTAKPSQFFDDRFVRQVNAGK |
| Ga0207683_110804461 | 3300026121 | Miscanthus Rhizosphere | GLQGILDLLSESIPEAKTAKTAQFFDDRFVRQVNSGK |
| Ga0209235_12291151 | 3300026296 | Grasslands Soil | RNPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK |
| Ga0209761_11916121 | 3300026313 | Grasslands Soil | MISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR |
| Ga0209131_13775612 | 3300026320 | Grasslands Soil | SEPGVQGILDFLSETVPEAKKATPAQFFDDRLVRQLNSGK |
| Ga0209879_10159941 | 3300027056 | Groundwater Sand | EPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR |
| Ga0209967_10470541 | 3300027364 | Arabidopsis Thaliana Rhizosphere | GLQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSGK |
| Ga0208685_11086582 | 3300027513 | Soil | KRELMISEPGIQGILDFLSETMPETKKATPAQFFDDRFVRQLNSAK |
| Ga0209799_11542112 | 3300027654 | Tropical Forest Soil | FFSPHDFLDRTYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEAKTAKPSQFFDDRFVRAVNAAK |
| Ga0209966_10466022 | 3300027695 | Arabidopsis Thaliana Rhizosphere | YKKAGFRREMVTSEPGLQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSGK |
| Ga0209177_100622602 | 3300027775 | Agricultural Soil | EPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK |
| Ga0209706_103029192 | 3300027818 | Freshwater Sediment | DPNVLDRTYEFYKKAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNATK |
| Ga0209797_100140615 | 3300027831 | Wetland Sediment | DRSYEFYRRAGFRRELLISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKLLDASK |
| Ga0209798_101516551 | 3300027843 | Wetland Sediment | AGFKRELTISETGMQGILDFMAETMPEAKKATPAQFFDDRFVRQLNRAN |
| Ga0209798_102146881 | 3300027843 | Wetland Sediment | KVIAKYNKETDPDALDRSYEFYRRAGFRRELLISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKLLDASK |
| Ga0209814_100095295 | 3300027873 | Populus Rhizosphere | PGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVNDSK |
| Ga0209814_102951742 | 3300027873 | Populus Rhizosphere | LVTSEPGVQGILDFLSESIPEAKKALPSQFFDDRFVRQVNVGK |
| Ga0207428_100235431 | 3300027907 | Populus Rhizosphere | AGFRRELVTSEPGLQGILDFLSESIPEAKSAKPAQFFDDRFVRQLNSGK |
| Ga0207428_105619421 | 3300027907 | Populus Rhizosphere | ELVVSEPGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK |
| Ga0268266_103635023 | 3300028379 | Switchgrass Rhizosphere | LLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK |
| Ga0299907_103360051 | 3300030006 | Soil | MAADIIERTYEFYRKAGFRRELMISEPGMRGILNFLSETTVPEAKKAEPAQFVDDRFVRQLNSGK |
| Ga0299906_103517833 | 3300030606 | Soil | MAADIIERTYEFYRKAGFRRELMISEPGMGGILNFLSETTVPEAKKAEPAQFFDDRFVRQLNSGK |
| Ga0268386_101966381 | 3300030619 | Soil | TYEFYRRAGFRRDLTISEPGMRGILNFLSETVPEAKKAVPAQLFDDRFLRQLNSGK |
| Ga0268386_105031892 | 3300030619 | Soil | MAADIIERTYEFYRKAGFRRELMISEPGMRGILNFLSETTVPEAKKAEPAQFFDDRFVRQLNSGK |
| Ga0307473_106054932 | 3300031820 | Hardwood Forest Soil | RELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK |
| Ga0307413_121138662 | 3300031824 | Rhizosphere | PEVLDRTYEFFKKAGFRRELVTSEPGLQGVLDFLSESIPEAKAAKPTQFFDDRILRQVNAGK |
| Ga0310907_108776752 | 3300031847 | Soil | KETDPEVLDRSYEFYKKAGFRREMVTSEPGLKGMLEFFAESIPEAKSAKPAQFFDDRFVRQVNSGK |
| Ga0306925_115549602 | 3300031890 | Soil | MRGILDFLSETLPEAKKATPAQFFDDRFVRQVNSAR |
| Ga0307407_108091902 | 3300031903 | Rhizosphere | VIPKYTRDSDADIIDRTYEFYRKAGFKRELMTSEAGMQGVLDFMSATMPEAKKATPAQFFDDRFVRQLNSGK |
| Ga0310900_106838692 | 3300031908 | Soil | RRELVVSEPGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK |
| Ga0307409_1008386662 | 3300031995 | Rhizosphere | IDRTYEFYRKAGFKRELMTSEAGMQGVLDFMSATMPEAKKATPAQFFDDRFVRQLNSGK |
| Ga0310897_105995451 | 3300032003 | Soil | THETDQDVLDRSYEFYKKAGFRRELVTSEPGLRGILDFLSESIPEAKTAKPTQFFDDRILRQVNAAK |
| Ga0310906_104470432 | 3300032013 | Soil | LVVSEPGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK |
| Ga0318533_107893822 | 3300032059 | Soil | LVTSDPGLQGILDFLSESIPEAKTAKPTQFFDDRFVRQVNSGK |
| Ga0310895_102767902 | 3300032122 | Soil | RTYEFYRKAGFRRELMISEPGMRGILNFLSESVPEAKKAEPAQFFDDRFVRQLNSGK |
| Ga0315281_101336201 | 3300032163 | Sediment | SEPGLQGILDFLSDSIPEAKTAKPSQFFDERIVRQVNSGK |
| Ga0307470_118201801 | 3300032174 | Hardwood Forest Soil | FRRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRHLNSAK |
| Ga0310889_102916571 | 3300032179 | Soil | LDRTYEFYKKAGFRRELVTSEPGLQGILDFLSESIPEAKSAKPAQFFDDRFVRQLNSGK |
| Ga0307471_1001759281 | 3300032180 | Hardwood Forest Soil | FRRELIISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGK |
| Ga0307471_1018481342 | 3300032180 | Hardwood Forest Soil | GVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVNDSK |
| Ga0307472_1011157001 | 3300032205 | Hardwood Forest Soil | DRTYEFYKRAGFRRELVTSEPGLQGILDFLSESMPEAKTAKPAQFFDDRIVRQVNATK |
| Ga0335084_101847313 | 3300033004 | Soil | TYEFYRKAGFRRELVTSEPGLQGMLDFLSESIPEAKKASPGQFFDDRFVRQVNSAR |
| Ga0310914_103154081 | 3300033289 | Soil | RRELVTSDPGLQGILDFLSESIPEAKTAKPTQFFDDRFVRQVNSGK |
| Ga0364928_0199435_20_244 | 3300033813 | Sediment | MKVIGKYAKETEQEVLDRSYEFYKKAGFRRELVTSEPGLQGMLDFLSESIPEAKSAKPSQFFDDRFVRQVNAGK |
| Ga0364927_0016937_1319_1447 | 3300034148 | Sediment | MVSEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGGR |
| Ga0364932_0191050_1_168 | 3300034177 | Sediment | YEFYRRAGFRRELMISEPGVQGMLDFLSETIPEAKRAKPSQFFDDRLVKQLDGAR |
| Ga0364941_063214_1_117 | 3300034417 | Sediment | AGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK |
| ⦗Top⦘ |