


| Basic Information | |
|---|---|
| Family ID | F021275 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 219 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LQIAVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPGD |
| Number of Associated Samples | 162 |
| Number of Associated Scaffolds | 219 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.46 % |
| % of genes near scaffold ends (potentially truncated) | 96.80 % |
| % of genes from short scaffolds (< 2000 bps) | 89.50 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.543 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.137 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.050 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.836 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 219 Family Scaffolds |
|---|---|---|
| PF00266 | Aminotran_5 | 21.92 |
| PF00487 | FA_desaturase | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF02652 | Lactate_perm | 0.46 |
| PF13671 | AAA_33 | 0.46 |
| PF12439 | GDE_N | 0.46 |
| PF01433 | Peptidase_M1 | 0.46 |
| PF12255 | TcdB_toxin_midC | 0.46 |
| PF00691 | OmpA | 0.46 |
| PF01058 | Oxidored_q6 | 0.46 |
| PF14534 | DUF4440 | 0.46 |
| PF02653 | BPD_transp_2 | 0.46 |
| PF01610 | DDE_Tnp_ISL3 | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 219 Family Scaffolds |
|---|---|---|---|
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.91 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.91 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.46 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.46 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.46 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.46 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.46 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.46 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.54 % |
| Unclassified | root | N/A | 0.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102FSB38 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 2170459013|GO6OHWN01C0Y2E | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300002560|JGI25383J37093_10197713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 529 | Open in IMG/M |
| 3300002911|JGI25390J43892_10084123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300004092|Ga0062389_101982329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300004092|Ga0062389_104778931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005167|Ga0066672_10770703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 608 | Open in IMG/M |
| 3300005176|Ga0066679_10790934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300005332|Ga0066388_105772753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300005454|Ga0066687_10365017 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005536|Ga0070697_101292707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300005542|Ga0070732_10124827 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300005554|Ga0066661_10059839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2201 | Open in IMG/M |
| 3300005554|Ga0066661_10106745 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300005555|Ga0066692_10004383 | All Organisms → cellular organisms → Bacteria | 6105 | Open in IMG/M |
| 3300005561|Ga0066699_10985071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300005598|Ga0066706_11144160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300005921|Ga0070766_10044170 | All Organisms → cellular organisms → Bacteria | 2481 | Open in IMG/M |
| 3300005944|Ga0066788_10122452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300006028|Ga0070717_10396013 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006034|Ga0066656_11103515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300006162|Ga0075030_100082917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2629 | Open in IMG/M |
| 3300006796|Ga0066665_10399683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300006800|Ga0066660_10815632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300006800|Ga0066660_10846813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300006804|Ga0079221_10744092 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300006806|Ga0079220_11954431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300006903|Ga0075426_10055627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2826 | Open in IMG/M |
| 3300006954|Ga0079219_10784337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300007255|Ga0099791_10113193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300007258|Ga0099793_10258906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300007258|Ga0099793_10264849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300007258|Ga0099793_10721920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300007265|Ga0099794_10239423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300009038|Ga0099829_11451289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300009088|Ga0099830_10962117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300009089|Ga0099828_10563771 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300009089|Ga0099828_11316545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300009089|Ga0099828_11945645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300009137|Ga0066709_104049492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009177|Ga0105248_12561335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300009553|Ga0105249_11449755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300009792|Ga0126374_11104875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300010043|Ga0126380_10966340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300010043|Ga0126380_11124438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010048|Ga0126373_10620986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300010360|Ga0126372_12266014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300010361|Ga0126378_11309454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300010361|Ga0126378_12677886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010362|Ga0126377_13432348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010375|Ga0105239_10445266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300011120|Ga0150983_10680075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300011120|Ga0150983_12207601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300011120|Ga0150983_13642208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300011269|Ga0137392_10005523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7990 | Open in IMG/M |
| 3300011269|Ga0137392_10885271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300011269|Ga0137392_11622307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300011270|Ga0137391_10438841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300011271|Ga0137393_11293939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012096|Ga0137389_10543914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300012096|Ga0137389_11823042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012189|Ga0137388_10261551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
| 3300012189|Ga0137388_11026694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012199|Ga0137383_10026361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4059 | Open in IMG/M |
| 3300012199|Ga0137383_10513806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300012200|Ga0137382_10970565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300012203|Ga0137399_10574211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300012203|Ga0137399_10733126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300012203|Ga0137399_10958283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012205|Ga0137362_10147709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2008 | Open in IMG/M |
| 3300012206|Ga0137380_11393503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300012206|Ga0137380_11399258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300012207|Ga0137381_11453834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300012285|Ga0137370_10266629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300012349|Ga0137387_10157419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1620 | Open in IMG/M |
| 3300012356|Ga0137371_10459784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300012357|Ga0137384_10701842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300012361|Ga0137360_10597049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300012361|Ga0137360_10693469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300012397|Ga0134056_1185758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012685|Ga0137397_10522831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300012918|Ga0137396_11127782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012918|Ga0137396_11191551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300012922|Ga0137394_10001894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15337 | Open in IMG/M |
| 3300012922|Ga0137394_11359145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012923|Ga0137359_10282829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300012923|Ga0137359_11350016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012923|Ga0137359_11624489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012924|Ga0137413_10270872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300012924|Ga0137413_11713891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012927|Ga0137416_10189111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300012929|Ga0137404_10101092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2327 | Open in IMG/M |
| 3300012929|Ga0137404_11285742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300012930|Ga0137407_12070943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012931|Ga0153915_13445493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012944|Ga0137410_10641193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300012948|Ga0126375_10887702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300012960|Ga0164301_10018961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3030 | Open in IMG/M |
| 3300012960|Ga0164301_10168489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1361 | Open in IMG/M |
| 3300012976|Ga0134076_10010587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3132 | Open in IMG/M |
| 3300012989|Ga0164305_11734068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300015053|Ga0137405_1082148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300015053|Ga0137405_1082149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300015053|Ga0137405_1088150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
| 3300015053|Ga0137405_1201889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300015053|Ga0137405_1264061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2384 | Open in IMG/M |
| 3300015054|Ga0137420_1359405 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300015167|Ga0167661_1027284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300015241|Ga0137418_10704215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300015264|Ga0137403_10955540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300015356|Ga0134073_10005011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2781 | Open in IMG/M |
| 3300015357|Ga0134072_10007345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2458 | Open in IMG/M |
| 3300015373|Ga0132257_103308792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300016319|Ga0182033_10000521 | All Organisms → cellular organisms → Bacteria | 18392 | Open in IMG/M |
| 3300016422|Ga0182039_12084845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300017656|Ga0134112_10153903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300017657|Ga0134074_1248518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300017936|Ga0187821_10101424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300018060|Ga0187765_10270772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300018468|Ga0066662_10748957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300018468|Ga0066662_11469704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 708 | Open in IMG/M |
| 3300018468|Ga0066662_12918339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300019789|Ga0137408_1177094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300020170|Ga0179594_10218282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300020170|Ga0179594_10417067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300020579|Ga0210407_10248035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300020579|Ga0210407_10339679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300020579|Ga0210407_10780900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300020580|Ga0210403_10945384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300020580|Ga0210403_11013296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300020580|Ga0210403_11337075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300020582|Ga0210395_10906554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300021088|Ga0210404_10639259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300021168|Ga0210406_10258143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300021170|Ga0210400_10345655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300021401|Ga0210393_11114890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300021404|Ga0210389_11347693 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021405|Ga0210387_11127466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300021407|Ga0210383_11637799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300021420|Ga0210394_11538503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300021475|Ga0210392_10011199 | All Organisms → cellular organisms → Bacteria | 4808 | Open in IMG/M |
| 3300021559|Ga0210409_10003953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16216 | Open in IMG/M |
| 3300021559|Ga0210409_10281340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300021559|Ga0210409_10648942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300022532|Ga0242655_10043072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300022726|Ga0242654_10145549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300022726|Ga0242654_10296503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300024288|Ga0179589_10267744 | Not Available | 762 | Open in IMG/M |
| 3300024331|Ga0247668_1083452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300025933|Ga0207706_10709275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300025939|Ga0207665_11327410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300025942|Ga0207689_10949276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300025961|Ga0207712_10818086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300025972|Ga0207668_12007344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300026215|Ga0209849_1069788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300026310|Ga0209239_1087253 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300026310|Ga0209239_1302870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300026322|Ga0209687_1205560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300026328|Ga0209802_1289039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300026333|Ga0209158_1295327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300026343|Ga0209159_1275536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026475|Ga0257147_1080084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300026514|Ga0257168_1033028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300026548|Ga0209161_10473997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027655|Ga0209388_1050536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300027701|Ga0209447_10001091 | All Organisms → cellular organisms → Bacteria | 7923 | Open in IMG/M |
| 3300027725|Ga0209178_1265917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300027842|Ga0209580_10284990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300027846|Ga0209180_10161930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1290 | Open in IMG/M |
| 3300027855|Ga0209693_10630695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300027862|Ga0209701_10333837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300027882|Ga0209590_10980663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300027889|Ga0209380_10164949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300027894|Ga0209068_10928117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300027910|Ga0209583_10680508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300027911|Ga0209698_10450378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300028673|Ga0257175_1010838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300029636|Ga0222749_10734070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300030520|Ga0311372_10495557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1797 | Open in IMG/M |
| 3300031028|Ga0302180_10282358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300031128|Ga0170823_11910371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300031128|Ga0170823_14671044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300031128|Ga0170823_15129018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300031231|Ga0170824_104924281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031474|Ga0170818_106939827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300031545|Ga0318541_10413277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300031564|Ga0318573_10447326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300031708|Ga0310686_117255745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2322 | Open in IMG/M |
| 3300031715|Ga0307476_10477058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300031718|Ga0307474_10972749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300031720|Ga0307469_11468922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300031720|Ga0307469_11535700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031720|Ga0307469_12105226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031730|Ga0307516_10595224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300031754|Ga0307475_10046819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3232 | Open in IMG/M |
| 3300031754|Ga0307475_10160437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1789 | Open in IMG/M |
| 3300031754|Ga0307475_10339432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300031754|Ga0307475_10990350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300031777|Ga0318543_10404883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300031796|Ga0318576_10348885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300031820|Ga0307473_10323582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300031820|Ga0307473_10953151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300031823|Ga0307478_11610366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300031845|Ga0318511_10305632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300031947|Ga0310909_11112651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300031962|Ga0307479_10116164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2607 | Open in IMG/M |
| 3300031962|Ga0307479_10597731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300031962|Ga0307479_10980661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300031962|Ga0307479_11710202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300031962|Ga0307479_11991202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300032001|Ga0306922_11405564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300032052|Ga0318506_10149953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300032063|Ga0318504_10106802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300032174|Ga0307470_11079555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300032174|Ga0307470_11265165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300032180|Ga0307471_101244851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300032180|Ga0307471_102750891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300032180|Ga0307471_103476958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300032261|Ga0306920_103762778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.28% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.91% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.46% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_03633920 | 2170459002 | Grass Soil | VLVCGGLLMLLVIHFIRRDGLRHPELECFHAEPLPEHLP |
| N57_06605610 | 2170459013 | Grass Soil | RDLQVGLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELECFHAEPLPEHLP |
| JGI25383J37093_101977131 | 3300002560 | Grasslands Soil | VAVAVMVVGALLMFLVMHFIRRDGLHHPHMAAFHAELDH* |
| JGI25390J43892_100841232 | 3300002911 | Grasslands Soil | SDLHDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0062389_1019823292 | 3300004092 | Bog Forest Soil | GLQVAVAVMVFGSLLMFLVIYFVRRDGLHHPRLAAFHAEPCD* |
| Ga0062389_1047789312 | 3300004092 | Bog Forest Soil | LGLQISVAVMVFGALMMLVVIHFIRRDGLRHPSLEVFHAESAD* |
| Ga0066672_107707031 | 3300005167 | Soil | LQVAVAVMVVGALLMFLVMHFIRRDGLHHPHMAAFHAELDH* |
| Ga0066679_107909342 | 3300005176 | Soil | GPHLLGKISDFHDLQFSLEIAVAVMVCGALLLFLVIYFVRRDGIRHPILETFHVEPGD* |
| Ga0066388_1057727531 | 3300005332 | Tropical Forest Soil | LEIAVAVLVCGALLMLLVIHFVKRDGLRHPALETFHAEPQSGSAD* |
| Ga0066687_103650173 | 3300005454 | Soil | GKISDQHDLQVGLQIAVGVMVCGALLMFLVMYFIRRDGIRHPILEAFRAEPGD* |
| Ga0070697_1012927072 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AVMVCGALLMLLVIHFIRRDGIRHPTLDTFHAESGDGLV* |
| Ga0070732_101248271 | 3300005542 | Surface Soil | IAVAVMVCGALLMLLVIHFIRRDGLRHPTLDVFHATENTD* |
| Ga0066661_100598391 | 3300005554 | Soil | GLGPAVVGKISDLHDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD |
| Ga0066661_101067453 | 3300005554 | Soil | LQIAVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPGD* |
| Ga0066692_100043835 | 3300005555 | Soil | VGLQIAVAVMVCGALLMFLVIHFIRRDGIRHPILEAFHAEPGD* |
| Ga0066699_109850711 | 3300005561 | Soil | QIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETPEQI* |
| Ga0066706_111441601 | 3300005598 | Soil | GPHVIGKISDMRDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHSCLDAFHAEADD* |
| Ga0070766_100441701 | 3300005921 | Soil | GLQIAVAVMVCGALLMLLVIHFIRRDGLRHPSLEMFHAESAD* |
| Ga0066788_101224522 | 3300005944 | Soil | ILGLQVAVVVMVGGALLMFLVMYFIRRDGLCHPELDSFRAELGD* |
| Ga0070717_103960131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELESFHVDPVPERLP* |
| Ga0066656_111035152 | 3300006034 | Soil | GKISDMRDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHSTLDAFHAEADD* |
| Ga0075030_1000829175 | 3300006162 | Watersheds | LGPHVVGRISDLHDLQFGLQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0066665_103996833 | 3300006796 | Soil | GVLVCGGLLMLLVIHFIRRDGLRHPQLEGFHAEPLPEQLPLP* |
| Ga0066660_108156323 | 3300006800 | Soil | CGGLLMLLVIHFIRRDGLRHPGLESFHAEPVPEQLP* |
| Ga0066660_108468132 | 3300006800 | Soil | GPHVVGRISEQHDLQVGLQIAVAVMVCGALLMFLVIHFIRRDGIRHPILEAFHAEPGD* |
| Ga0079221_107440923 | 3300006804 | Agricultural Soil | DFHDLQFSLEVAVAVMVCGALLMFLVIHFIRRDGIRHPILEAFRTEPGD* |
| Ga0079220_119544311 | 3300006806 | Agricultural Soil | DFADLILGLQVAVVVMVGGALLMFLVMYFIRRHGLCHPELEAFRVEPGD* |
| Ga0075426_100556271 | 3300006903 | Populus Rhizosphere | GPHLLGEISDFHDLQFSLQIAVGVMVCGALLMFLVIYFVRRDGIRHPILDAFRVEPGD* |
| Ga0079219_107843372 | 3300006954 | Agricultural Soil | LQVGLQIAVAVMVCGGLLMFLVMYFIRRDGIRHRALESFRVEPGD* |
| Ga0099791_101131933 | 3300007255 | Vadose Zone Soil | VMVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD* |
| Ga0099793_102589061 | 3300007258 | Vadose Zone Soil | FGLQIAVAVMVCGGLLMLLVIHFIRRDGLRHQCLASFHVEPGD* |
| Ga0099793_102648491 | 3300007258 | Vadose Zone Soil | QIAVAVMVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD* |
| Ga0099793_107219201 | 3300007258 | Vadose Zone Soil | VAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEAND* |
| Ga0099794_102394233 | 3300007265 | Vadose Zone Soil | AVAVMVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD* |
| Ga0099829_114512892 | 3300009038 | Vadose Zone Soil | PHIVGKISDLRDLQVGLQLAVAVMVCGALLMLLVIHFIRRDGIRHQTLDTFHAESGDGLV |
| Ga0099830_109621171 | 3300009088 | Vadose Zone Soil | LHDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGICHPTLAAFHAEPGD* |
| Ga0099828_105637711 | 3300009089 | Vadose Zone Soil | KIDDLADVGMGLKLAVGVMVAGALSFLLVIHFIRRDGLYHPRLDAFRAEADN* |
| Ga0099828_113165452 | 3300009089 | Vadose Zone Soil | HDMQFALEIAVAVMVLGGLLMFLVIHFIRRDGLHHSCLESFRAETGD* |
| Ga0099828_119456453 | 3300009089 | Vadose Zone Soil | AVGVLVAGALCMFLVIYFIRRDGLHHPSLAAFHAEAHD* |
| Ga0066709_1040494922 | 3300009137 | Grasslands Soil | SDQRDFKVERQFAAGVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETSEQV* |
| Ga0105248_125613351 | 3300009177 | Switchgrass Rhizosphere | GALLMLLVIHFVKRDGLRHPALESFHAEPQSESAD* |
| Ga0105249_114497553 | 3300009553 | Switchgrass Rhizosphere | SDQHDLQLGLEIAVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPQSESAD* |
| Ga0126374_111048752 | 3300009792 | Tropical Forest Soil | VAVMVCGALLMLLVIHFIRRDGLRHPALEAFHAEPGD* |
| Ga0126380_109663401 | 3300010043 | Tropical Forest Soil | DQRDLQVALQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETPQI* |
| Ga0126380_111244381 | 3300010043 | Tropical Forest Soil | QVIGKISDQRDLQVALQIAAAVLVCGGLLMLLVIHFIRRDGMRHPAVEAFHAEPPVEIPPA* |
| Ga0126373_106209861 | 3300010048 | Tropical Forest Soil | GLEIAVAVMVCGALLMFLVIHFIRRDGIRHPILEAFRVEPGD* |
| Ga0126372_122660142 | 3300010360 | Tropical Forest Soil | LQIAVAVMVCGALLMLLVIHFIRRDGMRHPTLEAFHAEPGD* |
| Ga0126378_113094543 | 3300010361 | Tropical Forest Soil | HDLQVGLQIAVAVMVCGALLMFLVIHFIRRDGIRHRVLEAFHAEPGD* |
| Ga0126378_126778863 | 3300010361 | Tropical Forest Soil | AVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPQSESAD* |
| Ga0126377_134323481 | 3300010362 | Tropical Forest Soil | VAVMVCGALLMFLVIHFIRRDGMRHPTLEAFHAEPGD* |
| Ga0105239_104452663 | 3300010375 | Corn Rhizosphere | VVVMVGGALLMFLVMYFIRRDGLCHPELDAFRVEPGD* |
| Ga0150983_106800751 | 3300011120 | Forest Soil | RISDLHDMQLALQIAVAVMVAGGLLMFLVIHFIRRDGLQHSCLESFRAEPGD* |
| Ga0150983_122076011 | 3300011120 | Forest Soil | VLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0150983_136422081 | 3300011120 | Forest Soil | LGLQIAVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPGD* |
| Ga0137392_1000552313 | 3300011269 | Vadose Zone Soil | VVGKIFDFHDLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDTFHAEPGD* |
| Ga0137392_108852713 | 3300011269 | Vadose Zone Soil | GLGPPVVGKISDLHDLQLGLQIAVAVMVCGALLMFLVIHFIRRDGIRHRVLEAFRAESGD |
| Ga0137392_116223071 | 3300011269 | Vadose Zone Soil | QFGLQIAVAVMVCGGLLMFLVIHFIRRDGLQHSCLESFRAEPGD* |
| Ga0137391_104388413 | 3300011270 | Vadose Zone Soil | VMVGGSLLMFLVIYFIRRDGLHHPRLAQFQAEPGD* |
| Ga0137393_112939391 | 3300011271 | Vadose Zone Soil | VGLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELESFHAEPVPERLP* |
| Ga0137389_105439141 | 3300012096 | Vadose Zone Soil | QIAVAVMVCGALLMFLVIYFIRRDGLRHPILDAFRVEPGD* |
| Ga0137389_118230422 | 3300012096 | Vadose Zone Soil | VLVCGALLMLLVIHFIRRDGLRHPTLASFHAEPGD* |
| Ga0137388_102615513 | 3300012189 | Vadose Zone Soil | DLQLGLQVAVAVMVGGSLLMFLVIYFIRRDGLHHPRLAQFQAEPGD* |
| Ga0137388_110266943 | 3300012189 | Vadose Zone Soil | AVMVCGGLLMFLVIHFIRRDGLQHQCLESFRAEPGD* |
| Ga0137383_100263615 | 3300012199 | Vadose Zone Soil | KISDIRDLQLGLQIAVAVLVCGALLMLLVIHFIRRDGMRHPTLDSFHAEPGD* |
| Ga0137383_105138063 | 3300012199 | Vadose Zone Soil | VAVMVAGALLMLVVIHFIRRDGMRHPVLEAFHAESGD* |
| Ga0137382_109705651 | 3300012200 | Vadose Zone Soil | VAVLVCGGLLMLLVIHFIRRDGLRHPQLESFHAEPVHEPTK* |
| Ga0137399_105742113 | 3300012203 | Vadose Zone Soil | LQIAVAVMVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD* |
| Ga0137399_107331263 | 3300012203 | Vadose Zone Soil | MVCGALLMLLVIHFIRRDGLRHPTLACFHAEPGD* |
| Ga0137399_109582833 | 3300012203 | Vadose Zone Soil | LGLQIAVAVMVCGALLMLLVIHFIRRDGLRHPTLASFHIEPGD* |
| Ga0137362_101477094 | 3300012205 | Vadose Zone Soil | ALQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETPEQI* |
| Ga0137380_113935031 | 3300012206 | Vadose Zone Soil | VVGRISDLRDLQLGLQISVAVMVAGALLMLVVIHFIRRDGMRHPVLEAFHAESGD* |
| Ga0137380_113992582 | 3300012206 | Vadose Zone Soil | VAIGVMIAGGLTMFLVMYFIRRDGLRHPRLEAFRAEGP* |
| Ga0137381_114538342 | 3300012207 | Vadose Zone Soil | DLQLGLQISVAVMVAGALLMLVVIHFIRRDGMRHPVLEAFHAESGD* |
| Ga0137370_102666291 | 3300012285 | Vadose Zone Soil | IAVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPGD* |
| Ga0137387_101574193 | 3300012349 | Vadose Zone Soil | VGRISDQHDLQVGLQIAVAVMVCGALLMFLVIHFIRRDGIRHPILEAFHAEPGD* |
| Ga0137371_104597843 | 3300012356 | Vadose Zone Soil | LVCGGLLMLLVIHFIRRDGLRHPQLEGFHAEPLPEQLPLP* |
| Ga0137384_107018421 | 3300012357 | Vadose Zone Soil | SDTRDLQVGLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELECFHAEPLPERLP* |
| Ga0137360_105970491 | 3300012361 | Vadose Zone Soil | HIVGKISDLRDLQVGLQLAVAVMVCGALLMLLVIHFIRRDGIRHPTLDTFHAESGDSLV* |
| Ga0137360_106934691 | 3300012361 | Vadose Zone Soil | GLQVAVVVMVGGALLMFLVMYFIRRDGLCHPELDSFRAELGD* |
| Ga0134056_11857581 | 3300012397 | Grasslands Soil | VAVMVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0137397_105228313 | 3300012685 | Vadose Zone Soil | DLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0137396_111277821 | 3300012918 | Vadose Zone Soil | LAVAVMVCGALLMLLVIHFIRRDGIRHPTLDTFHAESGDSLV* |
| Ga0137396_111915512 | 3300012918 | Vadose Zone Soil | LGPHIVGKISDLHDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHPALDAFHAEPGD* |
| Ga0137394_1000189419 | 3300012922 | Vadose Zone Soil | MVCGALLMLLVIHFIRRDGLRHPTLASFHAEPGD* |
| Ga0137394_113591451 | 3300012922 | Vadose Zone Soil | LQVGLQIAVAVMVCGALLMLVVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0137359_102828292 | 3300012923 | Vadose Zone Soil | MQFGLQIAVAVMVAGGLLMFLVIHFIRRDGLRHQCLESFHAEPGD* |
| Ga0137359_113500161 | 3300012923 | Vadose Zone Soil | ISDLHDMQFALEIAVAVMVLGGLLMFLVIHFIRRDGLQHSCLESFRAEPGD* |
| Ga0137359_116244892 | 3300012923 | Vadose Zone Soil | SDLHDMQFALEIAVAVMVLGGLLMFLVIHFIRRDGLQHSCLESFRAEPGD* |
| Ga0137413_102708723 | 3300012924 | Vadose Zone Soil | DQRDLQVALQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHVEPPETPEQI* |
| Ga0137413_117138911 | 3300012924 | Vadose Zone Soil | QVALQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHVEPPETSEQI* |
| Ga0137416_101891113 | 3300012927 | Vadose Zone Soil | AVMVCGGLLMFLVIHFIRRDGLRHECLAAFHAETGD* |
| Ga0137404_101010925 | 3300012929 | Vadose Zone Soil | DLHDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEAND* |
| Ga0137404_112857422 | 3300012929 | Vadose Zone Soil | LGPHVIGKISDMRDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHSCLDAFHAEADD* |
| Ga0137407_120709432 | 3300012930 | Vadose Zone Soil | ISDLRDLQLGQQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0153915_134454931 | 3300012931 | Freshwater Wetlands | RDLQVGLQVAVGVMVCGALLLFLVIYFIRRDGLHHPRLDAFRAEHDD* |
| Ga0137410_106411933 | 3300012944 | Vadose Zone Soil | DLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDTFHAEPGD* |
| Ga0126375_108877023 | 3300012948 | Tropical Forest Soil | SDQHDLQLGLEIAVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPDSAD* |
| Ga0164301_100189616 | 3300012960 | Soil | LQVAVAVMVCGSLLMFLVIYFVRRDGLRHPCLAAFHVEPGD* |
| Ga0164301_101684891 | 3300012960 | Soil | LGLQVAVVVMGGGALLMFLVMYFIRRDGLCHPELDAFRVEPGD* |
| Ga0134076_100105874 | 3300012976 | Grasslands Soil | HDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD* |
| Ga0164305_117340682 | 3300012989 | Soil | DLQVGLEISVGVLVCGALLMLLVIHFIRRDGLRHPDLESFQVETMP* |
| Ga0137405_10821483 | 3300015053 | Vadose Zone Soil | HVVGRISDLRDLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHSTLDAFHAEPGD* |
| Ga0137405_10821491 | 3300015053 | Vadose Zone Soil | HVVGRISDLRDLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHSTLDPFHAEPGD* |
| Ga0137405_10881503 | 3300015053 | Vadose Zone Soil | GLQIAVAVLVCGALLMLLVIHFIRRDGIRHSTLDAFHAEPGD* |
| Ga0137405_12018893 | 3300015053 | Vadose Zone Soil | VVGRISDLRDLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHSTLDAFHAEPGD* |
| Ga0137405_12640611 | 3300015053 | Vadose Zone Soil | RDLQDLQVALQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETTGQA* |
| Ga0137420_13594056 | 3300015054 | Vadose Zone Soil | MVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD* |
| Ga0167661_10272843 | 3300015167 | Glacier Forefield Soil | LQVGLEISVAILVCGGLLMLLVIHFIRRDGLRHPGLESFQSEALPEHLP* |
| Ga0137418_107042151 | 3300015241 | Vadose Zone Soil | AVMVCGALLMLLVIHFIRRDGLRHPTLACFHAEPGD* |
| Ga0137403_109555402 | 3300015264 | Vadose Zone Soil | QFGLQIAVAVMVAGGLLMFLVIHFIRRDGLRHQCLESFHAEPGD* |
| Ga0134073_100050111 | 3300015356 | Grasslands Soil | IAVAVMVCGALLMFLVIHFIRRDGIRHRVLETFPAEPGD* |
| Ga0134072_100073454 | 3300015357 | Grasslands Soil | HVVGKISDQHDLQVGLQIAVAVMVCGALLMFLVIHFIRRDGIRHRVLETFPAEPGD* |
| Ga0132257_1033087921 | 3300015373 | Arabidopsis Rhizosphere | MVGGALLMFLVMYFIRRDGLRHPELEAFHAEPGD* |
| Ga0182033_1000052117 | 3300016319 | Soil | AVMACGALLMFLVIHFIRRDGIRHRVLEAFHAEPGD |
| Ga0182039_120848452 | 3300016422 | Soil | GKVSDQHDLQVGLQIAVAVMVGGALLMFLVIHFIRRDGIRHPTLDAFRVEPGD |
| Ga0134112_101539031 | 3300017656 | Grasslands Soil | DLQLGLQISVAVMVAGALLMLVVIHFIRRDGIRHPVLDAFHAEPGD |
| Ga0134074_12485181 | 3300017657 | Grasslands Soil | DLQLGLQISVAVMVAGALLMLVVIHFIRRDGIRHPILEAFRVEPGD |
| Ga0187821_101014243 | 3300017936 | Freshwater Sediment | QVAVAVMVFGSLLMFLVIYFVRRDGLHHPRLAAFHAEPGD |
| Ga0187765_102707723 | 3300018060 | Tropical Peatland | AVAVMVGGALLMLVVIHFIRRDGLRHPHLERFRVEPGD |
| Ga0066662_107489573 | 3300018468 | Grasslands Soil | LGVQLSVAVMVAGAVLMLVVIHCIRRDGIRHPVLGAFHAEPGD |
| Ga0066662_114697041 | 3300018468 | Grasslands Soil | VAVMVVGALLMFLVMHFIRRDGLHHPHMAAFHAELDH |
| Ga0066662_129183392 | 3300018468 | Grasslands Soil | IGKISDMRDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHSCLDAFHAEADD |
| Ga0137408_11770941 | 3300019789 | Vadose Zone Soil | LEKFLSDQRDLQVALQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETTGQA |
| Ga0179594_102182821 | 3300020170 | Vadose Zone Soil | AVVVMVGGALLMFLVMYFIRRDGLCHPELDSFRAELGD |
| Ga0179594_104170671 | 3300020170 | Vadose Zone Soil | GKISDLRDLQLGLQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD |
| Ga0210407_102480351 | 3300020579 | Soil | QVAVAVMVFGSLLMFLVIYFVRRDGLHHPSLASFRVEPGD |
| Ga0210407_103396793 | 3300020579 | Soil | DLHDLQLGLQICVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPYV |
| Ga0210407_107809001 | 3300020579 | Soil | SDLRDMQLALQIAVAVMVAGGLLMFLVIHFIRRDGLQHSCLDSFRAEPGD |
| Ga0210403_109453842 | 3300020580 | Soil | AVMVFGSLLMFLVIYFVRRDGLHHPRLAAFHAEAND |
| Ga0210403_110132962 | 3300020580 | Soil | RDMQVALQIAVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPGD |
| Ga0210403_113370751 | 3300020580 | Soil | VMVAGGLLMFLVIHFIRRDGLQHQCLDSFRVEPGD |
| Ga0210395_109065543 | 3300020582 | Soil | AVMVAGGLLMFLVIHFIRRDGLRHQCLESFHAEPGD |
| Ga0210404_106392592 | 3300021088 | Soil | LGLQIAVAVMVCGGLLMFLVIHFIRRDGLRHQCLASFHAEPVD |
| Ga0210406_102581431 | 3300021168 | Soil | LADLILGLQVAVVVMVGGALLMFLVMYFIRRDGLCHPELEAFRAELGD |
| Ga0210400_103456551 | 3300021170 | Soil | VAVMVCGGLLMFLVIHFIRRDGLKHECLAHFHIETETGD |
| Ga0210393_111148901 | 3300021401 | Soil | AVMVMGSLLMLLVIHFVRRDGLHSSRLPAFRSEPDPSMHTPT |
| Ga0210389_113476931 | 3300021404 | Soil | DLHDLQLGLQVCVAVMVCGALLMLLVIHFIRRDGLRHPSLDVFHAESAD |
| Ga0210387_111274662 | 3300021405 | Soil | GLQVAVLVMVAGALLMFLVMYFIRRDGLCHPEMDAFRAEPGD |
| Ga0210383_116377991 | 3300021407 | Soil | VMVCGGLLMLLVIHFIRRDGLRHPSLEIFHAESAD |
| Ga0210394_115385031 | 3300021420 | Soil | VMVFGSLLMFLVIYFVRRDGLHHPRLAAFHVEPCD |
| Ga0210392_100111991 | 3300021475 | Soil | EISVGVLVCGGLLMLVVIHFIRRDGLRHPELESFHVEVVPERLP |
| Ga0210409_1000395313 | 3300021559 | Soil | LQVGMQIAVAVLVCGALLMLLVIHFIRRDGMRHPTLDAFHAEPGD |
| Ga0210409_102813401 | 3300021559 | Soil | AVLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD |
| Ga0210409_106489423 | 3300021559 | Soil | LQIAVAVMVCGALLMLLVIHFIRRDGLCHPTLAAFHAEPGD |
| Ga0242655_100430721 | 3300022532 | Soil | ISDLRDLQVGLQIAVAVLVCGALLMLLVIHFIRRDGMRHPTLDAFHAEPGD |
| Ga0242654_101455493 | 3300022726 | Soil | VAVMVAGGLLMFLVIHFIRRDGLQHSCLESFRAEPGD |
| Ga0242654_102965032 | 3300022726 | Soil | GLQIAVAVLVGGALLMLLVIHFIRRDGLRHPAVEAFHAEPPPEIPGPS |
| Ga0179589_102677441 | 3300024288 | Vadose Zone Soil | DLQVGLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELESFHVDPVPERLP |
| Ga0247668_10834522 | 3300024331 | Soil | VCGALLMLLVIHFIRRDGLRHPAVESFHAEPPEPSL |
| Ga0207706_107092753 | 3300025933 | Corn Rhizosphere | VAVVVMVGGALLMFLVMYFIRRDGLCHPELDAFRVEPGD |
| Ga0207665_113274102 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFGLQIAVAVMVFGGLLMLLVIHFVRRDGLQHPLLASFRAEPGD |
| Ga0207689_109492762 | 3300025942 | Miscanthus Rhizosphere | LQLGLEIAVAILVCGALLMLLVIHFVKRDGLRHPALESFHAEPQSESAL |
| Ga0207712_108180863 | 3300025961 | Switchgrass Rhizosphere | CGALLMLLVIHFVKRDGLRHPALESFHAEPQSESAD |
| Ga0207668_120073441 | 3300025972 | Switchgrass Rhizosphere | DLILGLQVAVVVMVGGALLMFLVMYFIRRDGLCHPELDAFRVEPGD |
| Ga0209849_10697881 | 3300026215 | Soil | ILGLQVAVVVMVGGALLMFLVMYFIRRDGLCHPELDSFRAELGD |
| Ga0209239_10872533 | 3300026310 | Grasslands Soil | LQFSLEIAVAVMVCGALLLFLVIYFVRRDGIRHPILETFHVEPGD |
| Ga0209239_13028701 | 3300026310 | Grasslands Soil | LGPHVVGRISDQHDLQVGLQIAVAVMVCGALLMFLVIHFIRRDGIRHPILEAFHAEPGD |
| Ga0209687_12055602 | 3300026322 | Soil | LQVGLQIAVGVMVCGALLMFLVMYFIRRDGIRHPILEAFRAEPGD |
| Ga0209802_12890391 | 3300026328 | Soil | IVGKISDTHDLQLGLQIAVAVMVCGALLMFLVIHFIRRDGIRHPILDAFRVEPGD |
| Ga0209158_12953272 | 3300026333 | Soil | LQIAVAVMVCGALLMLLVIHFIRRDGIRHSCLDAFHAEADD |
| Ga0209159_12755362 | 3300026343 | Soil | GLLMLLVIHFIRRDGLRHPQLEGFHAEPLPEQLPLP |
| Ga0257147_10800842 | 3300026475 | Soil | AVAVLVGGALLMLLVIHFIRRDGLRHPAVEAFHAEPPPEIPGPS |
| Ga0257168_10330281 | 3300026514 | Soil | VGVLVCGGLLMLLVIHFIRRDGLRHPELESFHAEPVPERLP |
| Ga0209161_104739971 | 3300026548 | Soil | PHVVGKISDQHDLQVGLQIAVAVMVCGALLMFLVIHFIRRDGIRHRVLETFPAEPGD |
| Ga0209388_10505363 | 3300027655 | Vadose Zone Soil | VMVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD |
| Ga0209447_1000109111 | 3300027701 | Bog Forest Soil | LGLQISVAVMVCGGLLMLLVIHFIRRDGLRHPSLEIFHAESAD |
| Ga0209178_12659172 | 3300027725 | Agricultural Soil | DLRDLQLGMQIAVAVMVGGALLMFLVMYFIKRDGLRHPELEAFHAEPSD |
| Ga0209580_102849901 | 3300027842 | Surface Soil | VCGALLMLLVIHFIRRDGLRHPHLEAFHVEHSPELSK |
| Ga0209180_101619303 | 3300027846 | Vadose Zone Soil | QIAVAVLVCGALLMLLVIHFIRRDGMRHPTLDAFHAEPGD |
| Ga0209693_106306951 | 3300027855 | Soil | ILGLQVAVVVMVGGALLMFLVMYFIRRDGLCHPELDAFRAELGD |
| Ga0209701_103338373 | 3300027862 | Vadose Zone Soil | HVIGKISDMRDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHSCLDAFHAEADD |
| Ga0209590_109806631 | 3300027882 | Vadose Zone Soil | KISDMRDLQLGLQIAVAVMVCGALLMLLVIHFIRRDGIRHSTLDAFHAEADD |
| Ga0209380_101649491 | 3300027889 | Soil | GLQIAVAVMVCGALLMLLVIHFIRRDGLRHPSLEMFHAESAD |
| Ga0209068_109281172 | 3300027894 | Watersheds | QIAVAVMVGGALLMLLVIHFIRRDGLCHPCLDQFRVEPGD |
| Ga0209583_106805082 | 3300027910 | Watersheds | MKNSIAIFAVAVLVCGALLMLLVIHFIRRDGMRHPTLDAFHAEPGD |
| Ga0209698_104503783 | 3300027911 | Watersheds | GRISDLHDLQFGLQIAVAVLVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD |
| Ga0257175_10108381 | 3300028673 | Soil | LAVAVMVCGALLMLLVIHFIRRDGIRHPTLDTFHAESGDGLV |
| Ga0222749_107340701 | 3300029636 | Soil | AVAVMVAGGLLMFLVIHFIRRDGLQHSCLESFRAEPGD |
| Ga0311372_104955571 | 3300030520 | Palsa | LCVAVMVGGALLMLLVIHFIRRDGLRHPSLEVFHAESAD |
| Ga0302180_102823581 | 3300031028 | Palsa | DLHDLQLGLQLCVAVMVGGALLMLLVIHFIRRDGLRHPSLEVFHAESAD |
| Ga0170823_119103711 | 3300031128 | Forest Soil | QVGLEISVGVLVCGGLLMLLVVHFIRRDGLRHPELECFHAEPVPERLP |
| Ga0170823_146710442 | 3300031128 | Forest Soil | CGGLLMGLVIHFIRRDGLRHPVLESFHAEPLPEHLP |
| Ga0170823_151290181 | 3300031128 | Forest Soil | RDLQVGLEISVGVLVCGGLLMLVVIHFIRRDGLRHPELESFHAEVVPERLP |
| Ga0170824_1049242811 | 3300031231 | Forest Soil | ALQIAVAVMVCGGLLMFLVIHFIRRDGLRHQCLASFRAEPGD |
| Ga0170818_1069398271 | 3300031474 | Forest Soil | ISDTRDLQVGLEISVGVLVCGGLLMLVVIHFIRRDGLRHPELESFHVEVVPERLP |
| Ga0318541_104132771 | 3300031545 | Soil | RDLQVGLEIAVAILVCGALLMLLVIHFIRRDGLRHPQLEDFHVDHPHELVEKS |
| Ga0318573_104473263 | 3300031564 | Soil | DQHDLQLGLEIAVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPDSAD |
| Ga0310686_1172557454 | 3300031708 | Soil | GLQISVAVMVCGGLLMLLVIHFIRRDGLRHPSLEVFHAESAD |
| Ga0307476_104770581 | 3300031715 | Hardwood Forest Soil | VLVCGALLMLLVIHFIRRDGLRHPTLDVFHAEAND |
| Ga0307474_109727491 | 3300031718 | Hardwood Forest Soil | CGGLLMLVVIHFIRRDGLRHPELESFHAEAVPERLP |
| Ga0307469_114689221 | 3300031720 | Hardwood Forest Soil | AVMVCGALLMLLVIHFIRRDGLRHPTLDSFHAELVD |
| Ga0307469_115357001 | 3300031720 | Hardwood Forest Soil | RDLQVGLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELESFHVDPVPERQP |
| Ga0307469_121052262 | 3300031720 | Hardwood Forest Soil | WISDLRDLQFGLQIAVAVMVAGGLLMFLVIHFIRRDGLRHSCLESFHAEPGD |
| Ga0307516_105952241 | 3300031730 | Ectomycorrhiza | DLQVGLEIAVGVLVCGGLLMLLVIHFIRRDGLRHPDLESFQVEQQIP |
| Ga0307475_100468191 | 3300031754 | Hardwood Forest Soil | GLQIAVAVLVCGALLMLLVIHFIRRDGIRHSCLDAFHVEPGD |
| Ga0307475_101604373 | 3300031754 | Hardwood Forest Soil | DMQFGLQIAVAVMVAGGLLMFLVIHFIRRDGLKHQCLSSFHVEPGD |
| Ga0307475_103394323 | 3300031754 | Hardwood Forest Soil | KISDTRDLQVGLEISVGVLVCGGLLMLVVIHFIRRDGLRHPELESFHAEAVPERLP |
| Ga0307475_109903501 | 3300031754 | Hardwood Forest Soil | GPNVIGRISDLHDMQVGLQIAVAVMVCGALLMLLVIHFIRRDGIRHRVLDAFHAESGD |
| Ga0318543_104048833 | 3300031777 | Soil | VLVCGALLMLLVIHFVKRDGLRHPALESFHAEPDSAD |
| Ga0318576_103488851 | 3300031796 | Soil | DLQLGLEIAVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPDSAD |
| Ga0307473_103235821 | 3300031820 | Hardwood Forest Soil | VGRISDLHDMQFGLQIAVAVMVAGGLLMFLVIHFVRRDGLQHQCLESFRAEPGD |
| Ga0307473_109531511 | 3300031820 | Hardwood Forest Soil | DAHDLQVGLEIAVGILVCGALLMLLVIHFIRRDGLRHPQLEAFHVEQPEMVGRS |
| Ga0307478_116103661 | 3300031823 | Hardwood Forest Soil | HDLQLGLQICVAVMVCGALLMLLVIHFIRRDGLRHPTLDAFHAEPFV |
| Ga0318511_103056321 | 3300031845 | Soil | AVAVMACGALLMFLVIHFIRRDGIRHRVLEAFHAEPGD |
| Ga0310909_111126512 | 3300031947 | Soil | DQHDLQVGLQIAVAVMACGALLMFLVIHFIRRDGIRHRVLEAFHAEPGD |
| Ga0307479_101161644 | 3300031962 | Hardwood Forest Soil | VLVCGGLLMLLVIHFIRRDGLRHPELESFHVDPVPERLP |
| Ga0307479_105977313 | 3300031962 | Hardwood Forest Soil | GLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELESFHAEIVPERLP |
| Ga0307479_109806612 | 3300031962 | Hardwood Forest Soil | LQIAAAVLVCGALLMLLVIHFIRRDGLRHPAVEAFHAEPPETSA |
| Ga0307479_117102021 | 3300031962 | Hardwood Forest Soil | VAVMVAGGLLMFLVIHFIRRDGLQHSCLDSFRAEPGD |
| Ga0307479_119912021 | 3300031962 | Hardwood Forest Soil | LILGLQVAVVVMVGGALLMFLVMYFIRRDGLRHPELEAFHAEAGD |
| Ga0306922_114055643 | 3300032001 | Soil | SDLRDLQVGLEIAVAILVCGALLMLLVIHFIRRDGLRHPQLEDFHIDHPHELVEKS |
| Ga0318506_101499533 | 3300032052 | Soil | IAVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPDSAD |
| Ga0318504_101068021 | 3300032063 | Soil | GLEIAVAVLVCGALLMLLVIHFVKRDGLRHPALESFHAEPDSAD |
| Ga0307470_110795551 | 3300032174 | Hardwood Forest Soil | VAVVVMVGGALLMFLVMYFIRRDGLRHPELEAFHAEPGD |
| Ga0307470_112651652 | 3300032174 | Hardwood Forest Soil | GLEISVGVLVCGGLLMLLVIHFIRRDGLRHPELESFHVDPVPERLP |
| Ga0307471_1012448513 | 3300032180 | Hardwood Forest Soil | IAVAVMVCGALLMLLVIHFIRRDGIRHPTLDAFHAEPGD |
| Ga0307471_1027508911 | 3300032180 | Hardwood Forest Soil | VGVLVCGGLLMLVVIHFIRRDGLRHPELESFHVEVVPERLP |
| Ga0307471_1034769582 | 3300032180 | Hardwood Forest Soil | CGALLMLLVIHFIRRDGIRHQTLDTFHAESGDGLV |
| Ga0306920_1037627782 | 3300032261 | Soil | SDLRDLQVGLEIAVAILVCGALLMLLVIHFIRRDGLRHPQLEAFHMDQSQELVEKS |
| ⦗Top⦘ |