


| Basic Information | |
|---|---|
| Family ID | F021214 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 220 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 220 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.32 % |
| % of genes near scaffold ends (potentially truncated) | 37.27 % |
| % of genes from short scaffolds (< 2000 bps) | 67.27 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (37.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 220 Family Scaffolds |
|---|---|---|
| PF00313 | CSD | 10.45 |
| PF00899 | ThiF | 6.82 |
| PF14460 | Prok-E2_D | 2.73 |
| PF13545 | HTH_Crp_2 | 2.73 |
| PF00106 | adh_short | 2.27 |
| PF14454 | Prok_Ub | 1.82 |
| PF00072 | Response_reg | 1.36 |
| PF13493 | DUF4118 | 1.36 |
| PF00589 | Phage_integrase | 1.36 |
| PF08240 | ADH_N | 1.36 |
| PF00989 | PAS | 0.91 |
| PF01243 | Putative_PNPOx | 0.91 |
| PF00027 | cNMP_binding | 0.91 |
| PF07238 | PilZ | 0.91 |
| PF02416 | TatA_B_E | 0.91 |
| PF00689 | Cation_ATPase_C | 0.91 |
| PF13538 | UvrD_C_2 | 0.91 |
| PF00196 | GerE | 0.45 |
| PF00873 | ACR_tran | 0.45 |
| PF13432 | TPR_16 | 0.45 |
| PF04101 | Glyco_tran_28_C | 0.45 |
| PF00583 | Acetyltransf_1 | 0.45 |
| PF04055 | Radical_SAM | 0.45 |
| PF12532 | DUF3732 | 0.45 |
| PF06100 | MCRA | 0.45 |
| PF13602 | ADH_zinc_N_2 | 0.45 |
| PF01927 | Mut7-C | 0.45 |
| PF13476 | AAA_23 | 0.45 |
| PF13701 | DDE_Tnp_1_4 | 0.45 |
| PF01229 | Glyco_hydro_39 | 0.45 |
| PF00665 | rve | 0.45 |
| PF14559 | TPR_19 | 0.45 |
| PF08388 | GIIM | 0.45 |
| PF14451 | Ub-Mut7C | 0.45 |
| PF01740 | STAS | 0.45 |
| PF08029 | HisG_C | 0.45 |
| PF06271 | RDD | 0.45 |
| PF00128 | Alpha-amylase | 0.45 |
| PF11663 | Toxin_YhaV | 0.45 |
| PF14534 | DUF4440 | 0.45 |
| PF00990 | GGDEF | 0.45 |
| PF13520 | AA_permease_2 | 0.45 |
| PF12704 | MacB_PCD | 0.45 |
| PF06739 | SBBP | 0.45 |
| PF13669 | Glyoxalase_4 | 0.45 |
| PF00733 | Asn_synthase | 0.45 |
| PF07366 | SnoaL | 0.45 |
| PF01257 | 2Fe-2S_thioredx | 0.45 |
| PF10771 | DUF2582 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 220 Family Scaffolds |
|---|---|---|---|
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.91 |
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.45 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.45 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.45 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.45 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.45 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.45 |
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.45 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.45 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.45 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.45 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
| COG4716 | Myosin-crossreactive antigen (function unknown) | Function unknown [S] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.09 % |
| Unclassified | root | N/A | 20.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10372041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300004080|Ga0062385_10479824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300004091|Ga0062387_100193673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1220 | Open in IMG/M |
| 3300004092|Ga0062389_101301666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 912 | Open in IMG/M |
| 3300004152|Ga0062386_100802423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300005537|Ga0070730_10008462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Xenorhabdus → Xenorhabdus szentirmaii | 8629 | Open in IMG/M |
| 3300005537|Ga0070730_10202982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_15 | 1322 | Open in IMG/M |
| 3300006642|Ga0075521_10548183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
| 3300006893|Ga0073928_10161318 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300009518|Ga0116128_1001751 | All Organisms → cellular organisms → Bacteria | 9373 | Open in IMG/M |
| 3300009518|Ga0116128_1002282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7978 | Open in IMG/M |
| 3300009518|Ga0116128_1017263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2482 | Open in IMG/M |
| 3300009518|Ga0116128_1019090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2345 | Open in IMG/M |
| 3300009518|Ga0116128_1041922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 | 1472 | Open in IMG/M |
| 3300009518|Ga0116128_1048557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300009518|Ga0116128_1076289 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300009518|Ga0116128_1151727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 662 | Open in IMG/M |
| 3300009518|Ga0116128_1175370 | Not Available | 607 | Open in IMG/M |
| 3300009519|Ga0116108_1031012 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300009519|Ga0116108_1031927 | Not Available | 1737 | Open in IMG/M |
| 3300009519|Ga0116108_1058674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1207 | Open in IMG/M |
| 3300009519|Ga0116108_1086715 | Not Available | 956 | Open in IMG/M |
| 3300009519|Ga0116108_1099101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300009547|Ga0116136_1005929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4928 | Open in IMG/M |
| 3300009547|Ga0116136_1014512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2748 | Open in IMG/M |
| 3300009547|Ga0116136_1042055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1325 | Open in IMG/M |
| 3300009547|Ga0116136_1084400 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300009548|Ga0116107_1000563 | All Organisms → cellular organisms → Bacteria | 27851 | Open in IMG/M |
| 3300009548|Ga0116107_1015815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3076 | Open in IMG/M |
| 3300009548|Ga0116107_1026332 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300009548|Ga0116107_1112344 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300009548|Ga0116107_1138273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300009614|Ga0116104_1087084 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009615|Ga0116103_1046469 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300009618|Ga0116127_1060830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1060 | Open in IMG/M |
| 3300009618|Ga0116127_1088033 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300009621|Ga0116116_1017504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2705 | Open in IMG/M |
| 3300009621|Ga0116116_1018162 | Not Available | 2633 | Open in IMG/M |
| 3300009630|Ga0116114_1013917 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300009631|Ga0116115_1148825 | Not Available | 594 | Open in IMG/M |
| 3300009632|Ga0116102_1103026 | Not Available | 818 | Open in IMG/M |
| 3300009636|Ga0116112_1026538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1885 | Open in IMG/M |
| 3300009637|Ga0116118_1073777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300009638|Ga0116113_1191167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
| 3300009640|Ga0116126_1247619 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009643|Ga0116110_1023122 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
| 3300009643|Ga0116110_1039429 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300009644|Ga0116121_1007197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3787 | Open in IMG/M |
| 3300009645|Ga0116106_1288321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300009646|Ga0116132_1176211 | Not Available | 650 | Open in IMG/M |
| 3300009683|Ga0116224_10586206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300009700|Ga0116217_10139626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1625 | Open in IMG/M |
| 3300009824|Ga0116219_10093565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1756 | Open in IMG/M |
| 3300009839|Ga0116223_10130160 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300009839|Ga0116223_10733019 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010339|Ga0074046_10020786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4607 | Open in IMG/M |
| 3300010339|Ga0074046_10081700 | Not Available | 2099 | Open in IMG/M |
| 3300010339|Ga0074046_10120882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1681 | Open in IMG/M |
| 3300010339|Ga0074046_10677404 | Not Available | 607 | Open in IMG/M |
| 3300010341|Ga0074045_10393232 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010341|Ga0074045_10619026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 690 | Open in IMG/M |
| 3300010379|Ga0136449_100892336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium | 1450 | Open in IMG/M |
| 3300010379|Ga0136449_101412056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300010379|Ga0136449_101894158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 887 | Open in IMG/M |
| 3300010379|Ga0136449_102930949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300010379|Ga0136449_104170190 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014151|Ga0181539_1004987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11016 | Open in IMG/M |
| 3300014151|Ga0181539_1076682 | Not Available | 1466 | Open in IMG/M |
| 3300014151|Ga0181539_1139071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12 | 979 | Open in IMG/M |
| 3300014151|Ga0181539_1339323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300014152|Ga0181533_1022946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3905 | Open in IMG/M |
| 3300014153|Ga0181527_1013390 | All Organisms → cellular organisms → Bacteria | 5763 | Open in IMG/M |
| 3300014153|Ga0181527_1116308 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300014156|Ga0181518_10042313 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
| 3300014156|Ga0181518_10127123 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300014156|Ga0181518_10234264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300014156|Ga0181518_10483038 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300014158|Ga0181521_10480035 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300014161|Ga0181529_10183227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1243 | Open in IMG/M |
| 3300014162|Ga0181538_10044359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2816 | Open in IMG/M |
| 3300014164|Ga0181532_10000358 | All Organisms → cellular organisms → Bacteria | 47383 | Open in IMG/M |
| 3300014165|Ga0181523_10119945 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300014490|Ga0182010_10058557 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300014496|Ga0182011_10089340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2154 | Open in IMG/M |
| 3300014502|Ga0182021_13700516 | Not Available | 508 | Open in IMG/M |
| 3300014638|Ga0181536_10310446 | Not Available | 730 | Open in IMG/M |
| 3300014838|Ga0182030_10021621 | All Organisms → cellular organisms → Bacteria | 12043 | Open in IMG/M |
| 3300014839|Ga0182027_10538513 | Not Available | 1268 | Open in IMG/M |
| 3300017822|Ga0187802_10110721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1036 | Open in IMG/M |
| 3300017925|Ga0187856_1014524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4298 | Open in IMG/M |
| 3300017925|Ga0187856_1024519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2990 | Open in IMG/M |
| 3300017925|Ga0187856_1031090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2542 | Open in IMG/M |
| 3300017925|Ga0187856_1037473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2234 | Open in IMG/M |
| 3300017929|Ga0187849_1002415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17915 | Open in IMG/M |
| 3300017929|Ga0187849_1003413 | All Organisms → cellular organisms → Bacteria | 14033 | Open in IMG/M |
| 3300017929|Ga0187849_1005853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9602 | Open in IMG/M |
| 3300017929|Ga0187849_1007655 | All Organisms → cellular organisms → Bacteria | 7861 | Open in IMG/M |
| 3300017929|Ga0187849_1030668 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300017929|Ga0187849_1041216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2247 | Open in IMG/M |
| 3300017929|Ga0187849_1046449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 | 2066 | Open in IMG/M |
| 3300017929|Ga0187849_1048427 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300017929|Ga0187849_1058117 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300017929|Ga0187849_1062782 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300017929|Ga0187849_1157329 | Not Available | 912 | Open in IMG/M |
| 3300017929|Ga0187849_1311462 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300017931|Ga0187877_1001964 | All Organisms → cellular organisms → Bacteria | 19468 | Open in IMG/M |
| 3300017931|Ga0187877_1017952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3941 | Open in IMG/M |
| 3300017931|Ga0187877_1022549 | All Organisms → cellular organisms → Bacteria | 3352 | Open in IMG/M |
| 3300017931|Ga0187877_1042188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2151 | Open in IMG/M |
| 3300017931|Ga0187877_1048120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1966 | Open in IMG/M |
| 3300017931|Ga0187877_1159283 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300017931|Ga0187877_1192221 | Not Available | 803 | Open in IMG/M |
| 3300017931|Ga0187877_1268270 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300017935|Ga0187848_10221238 | Not Available | 807 | Open in IMG/M |
| 3300017935|Ga0187848_10332389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300017938|Ga0187854_10030897 | Not Available | 2834 | Open in IMG/M |
| 3300017938|Ga0187854_10046399 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300017938|Ga0187854_10083119 | Not Available | 1528 | Open in IMG/M |
| 3300017938|Ga0187854_10237224 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300017938|Ga0187854_10240192 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300017938|Ga0187854_10244415 | Not Available | 780 | Open in IMG/M |
| 3300017940|Ga0187853_10003099 | All Organisms → cellular organisms → Bacteria | 13122 | Open in IMG/M |
| 3300017940|Ga0187853_10055495 | Not Available | 2020 | Open in IMG/M |
| 3300017941|Ga0187850_10413477 | Not Available | 588 | Open in IMG/M |
| 3300017943|Ga0187819_10246044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
| 3300017946|Ga0187879_10011863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5531 | Open in IMG/M |
| 3300017946|Ga0187879_10659711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300017955|Ga0187817_10099665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
| 3300017955|Ga0187817_10179750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1347 | Open in IMG/M |
| 3300017975|Ga0187782_10800471 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300017988|Ga0181520_10022831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7008 | Open in IMG/M |
| 3300017996|Ga0187891_1008352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5816 | Open in IMG/M |
| 3300017996|Ga0187891_1136619 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300017998|Ga0187870_1010718 | All Organisms → cellular organisms → Bacteria | 5314 | Open in IMG/M |
| 3300017998|Ga0187870_1280993 | Not Available | 564 | Open in IMG/M |
| 3300018002|Ga0187868_1246317 | Not Available | 604 | Open in IMG/M |
| 3300018003|Ga0187876_1127583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300018003|Ga0187876_1200745 | Not Available | 669 | Open in IMG/M |
| 3300018003|Ga0187876_1274688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 543 | Open in IMG/M |
| 3300018004|Ga0187865_1025378 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
| 3300018004|Ga0187865_1068848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1363 | Open in IMG/M |
| 3300018005|Ga0187878_1028241 | All Organisms → cellular organisms → Bacteria | 2779 | Open in IMG/M |
| 3300018005|Ga0187878_1357675 | Not Available | 515 | Open in IMG/M |
| 3300018009|Ga0187884_10421176 | Not Available | 537 | Open in IMG/M |
| 3300018009|Ga0187884_10473264 | Not Available | 503 | Open in IMG/M |
| 3300018013|Ga0187873_1182815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 790 | Open in IMG/M |
| 3300018013|Ga0187873_1334434 | Not Available | 554 | Open in IMG/M |
| 3300018015|Ga0187866_1088077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1306 | Open in IMG/M |
| 3300018015|Ga0187866_1139836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300018016|Ga0187880_1301794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300018017|Ga0187872_10214412 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300018018|Ga0187886_1171637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300018018|Ga0187886_1343227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 552 | Open in IMG/M |
| 3300018019|Ga0187874_10006767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7096 | Open in IMG/M |
| 3300018019|Ga0187874_10015973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4065 | Open in IMG/M |
| 3300018020|Ga0187861_10040078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2533 | Open in IMG/M |
| 3300018020|Ga0187861_10340243 | Not Available | 636 | Open in IMG/M |
| 3300018021|Ga0187882_1228744 | Not Available | 725 | Open in IMG/M |
| 3300018022|Ga0187864_10122250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
| 3300018023|Ga0187889_10360695 | Not Available | 634 | Open in IMG/M |
| 3300018023|Ga0187889_10526301 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018024|Ga0187881_10005777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9246 | Open in IMG/M |
| 3300018024|Ga0187881_10044053 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300018024|Ga0187881_10205346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300018024|Ga0187881_10258470 | Not Available | 728 | Open in IMG/M |
| 3300018026|Ga0187857_10146936 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300018026|Ga0187857_10258065 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300018034|Ga0187863_10773314 | Not Available | 544 | Open in IMG/M |
| 3300018035|Ga0187875_10090570 | Not Available | 1747 | Open in IMG/M |
| 3300018035|Ga0187875_10107290 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300018044|Ga0187890_10661002 | Not Available | 589 | Open in IMG/M |
| 3300018057|Ga0187858_10368321 | Not Available | 898 | Open in IMG/M |
| 3300018057|Ga0187858_10854562 | Not Available | 537 | Open in IMG/M |
| 3300018086|Ga0187769_10289532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1223 | Open in IMG/M |
| 3300018090|Ga0187770_10871862 | Not Available | 722 | Open in IMG/M |
| 3300019082|Ga0187852_1193638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300019082|Ga0187852_1289405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300019082|Ga0187852_1342077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 590 | Open in IMG/M |
| 3300019230|Ga0181501_1336400 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300025439|Ga0208323_1069832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300025441|Ga0208456_1041823 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300025441|Ga0208456_1095683 | Not Available | 507 | Open in IMG/M |
| 3300025444|Ga0208189_1070187 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025459|Ga0208689_1051795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300025472|Ga0208692_1059042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300025477|Ga0208192_1066880 | Not Available | 682 | Open in IMG/M |
| 3300025500|Ga0208686_1036918 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300025506|Ga0208937_1101250 | Not Available | 636 | Open in IMG/M |
| 3300025576|Ga0208820_1091481 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027825|Ga0209039_10005100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9212 | Open in IMG/M |
| 3300027854|Ga0209517_10380624 | Not Available | 799 | Open in IMG/M |
| 3300027857|Ga0209166_10005919 | All Organisms → cellular organisms → Bacteria | 8269 | Open in IMG/M |
| 3300027857|Ga0209166_10142556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_15 | 1310 | Open in IMG/M |
| 3300029817|Ga0247275_1027578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1727 | Open in IMG/M |
| 3300029952|Ga0311346_10621546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 961 | Open in IMG/M |
| 3300031247|Ga0265340_10268965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 758 | Open in IMG/M |
| 3300031670|Ga0307374_10531833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 620 | Open in IMG/M |
| 3300031672|Ga0307373_10067033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3449 | Open in IMG/M |
| 3300032160|Ga0311301_10731900 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300032160|Ga0311301_11049186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300032892|Ga0335081_10325476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2019 | Open in IMG/M |
| 3300032892|Ga0335081_11420022 | Not Available | 774 | Open in IMG/M |
| 3300032897|Ga0335071_10514312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1150 | Open in IMG/M |
| 3300033402|Ga0326728_10000550 | All Organisms → cellular organisms → Bacteria | 147039 | Open in IMG/M |
| 3300033402|Ga0326728_10001106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 97787 | Open in IMG/M |
| 3300033402|Ga0326728_10001469 | All Organisms → cellular organisms → Bacteria | 82915 | Open in IMG/M |
| 3300033402|Ga0326728_10014178 | All Organisms → cellular organisms → Bacteria | 17039 | Open in IMG/M |
| 3300033402|Ga0326728_10015298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15990 | Open in IMG/M |
| 3300033402|Ga0326728_10028921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9546 | Open in IMG/M |
| 3300033402|Ga0326728_10049182 | All Organisms → cellular organisms → Bacteria | 6217 | Open in IMG/M |
| 3300033402|Ga0326728_10056315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5569 | Open in IMG/M |
| 3300033402|Ga0326728_10102446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 3442 | Open in IMG/M |
| 3300033402|Ga0326728_10103220 | All Organisms → cellular organisms → Bacteria | 3422 | Open in IMG/M |
| 3300033402|Ga0326728_10157784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2432 | Open in IMG/M |
| 3300033402|Ga0326728_10319108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1398 | Open in IMG/M |
| 3300033402|Ga0326728_10740907 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300033402|Ga0326728_11206724 | Not Available | 502 | Open in IMG/M |
| 3300033405|Ga0326727_10502076 | Not Available | 1055 | Open in IMG/M |
| 3300033977|Ga0314861_0069756 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 37.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 23.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 8.18% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 6.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.36% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.45% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.45% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103720411 | 3300001356 | Peatlands Soil | SQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0062385_104798242 | 3300004080 | Bog Forest Soil | VSESESQFKGIRGFLWLAVGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0062387_1001936732 | 3300004091 | Bog Forest Soil | VSESESQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0062389_1013016661 | 3300004092 | Bog Forest Soil | CVSESESQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0062386_1008024231 | 3300004152 | Bog Forest Soil | MAETESRFKDICGFLWLAVGFLLVAVAIGSAIYIAVHLLNH* |
| Ga0070730_100084626 | 3300005537 | Surface Soil | MSETRGQFEGLRGFLRLAVGFLLLAAAIGSMIYIVAHLLSYF* |
| Ga0070730_102029822 | 3300005537 | Surface Soil | MSETRGQFEGLRGFLRLAVGFLLLAAAMGSAIYIVVHLLSRL* |
| Ga0075521_105481831 | 3300006642 | Arctic Peat Soil | VSESESQFKGIRGFLWLAAGFLLPAAAIGSALYVVVHLLKCL* |
| Ga0073928_101613181 | 3300006893 | Iron-Sulfur Acid Spring | MPGTQGRFEGLRGFLRLAVGFMLLAAAVGSAIYIV |
| Ga0116128_10017517 | 3300009518 | Peatland | MSETQGPLKGIRGFLWLAVGFLLVAAAIGSAIYIVAHLLKYL* |
| Ga0116128_10022827 | 3300009518 | Peatland | MSETEGQFKGIRGFLWLAVGFLLLAAAIGSAIYIIAHLLTYL* |
| Ga0116128_10172634 | 3300009518 | Peatland | MAETGQFKGIRGFLWLAVGFLLLAAAIGSAIYIFAHLLHYL* |
| Ga0116128_10190902 | 3300009518 | Peatland | VSEPESQFKGIRGLLWLAVGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0116128_10419221 | 3300009518 | Peatland | MSETQGQLKAICGFLWLAVGFLLLAATIGSAIYIIAHLLNYL* |
| Ga0116128_10485572 | 3300009518 | Peatland | CMSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL* |
| Ga0116128_10762892 | 3300009518 | Peatland | MSETEGQFNGIRGFLWLAVGFSLLAAAIGSAIYFVVHLLNYL* |
| Ga0116128_11517272 | 3300009518 | Peatland | MSETASQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL* |
| Ga0116128_11753701 | 3300009518 | Peatland | MSETQGQFKGIRGFLWLAVGFLLLAATVGSAIYIVAHLLNYL* |
| Ga0116108_10310122 | 3300009519 | Peatland | MSETQGQFKGIRGFLWLAVGLLLLAAAIGSAIYIVAHLLKYL* |
| Ga0116108_10319271 | 3300009519 | Peatland | MSQTEGQFKGFRGFIWLAVGLLLLAAATGSAIYIVVHLFNYL* |
| Ga0116108_10586742 | 3300009519 | Peatland | MSETEGQFKGIGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL* |
| Ga0116108_10867152 | 3300009519 | Peatland | MFETESQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLSYL* |
| Ga0116108_10991011 | 3300009519 | Peatland | TAQEDPCMYETEGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL* |
| Ga0116136_10059292 | 3300009547 | Peatland | VAESESQFKGIRRFLWLAVGFLLLAAAIGSAIYIVAHLLKCL* |
| Ga0116136_10145124 | 3300009547 | Peatland | MSETQGQFNGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLNRYKRC* |
| Ga0116136_10420552 | 3300009547 | Peatland | MSETASQFKGIRGFLWLAVGILLLAAAIGSAIYIVVHLLNYQ* |
| Ga0116136_10844002 | 3300009547 | Peatland | MSETQGQLKGIRGFLWLAVGFLLLVAAVGSTIYIVAHLLNYL* |
| Ga0116107_100056316 | 3300009548 | Peatland | MDETQGQFKGIRGFFWLAVGFLLLAAAIGSAIYIVAHLLKYL* |
| Ga0116107_10158155 | 3300009548 | Peatland | MSETQGQFKSIRGFLWLAVGFLLLAAAIGSTIYIVVHLLN* |
| Ga0116107_10263323 | 3300009548 | Peatland | QFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL* |
| Ga0116107_11123441 | 3300009548 | Peatland | GQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLK* |
| Ga0116107_11382732 | 3300009548 | Peatland | ESESQFKGIRGFLWLAAGFLLLAAALGSATYIVVHLLKCL* |
| Ga0116104_10870842 | 3300009614 | Peatland | MSETESQFKGIRGFLWLAVGFLLQAAAIGSAIYIVVHLLKYL* |
| Ga0116103_10464691 | 3300009615 | Peatland | MSETQGQFKGIRGYLQLAVGFLLLAAAIGSAIYIVVHLLKYL |
| Ga0116127_10608301 | 3300009618 | Peatland | AESESQFKGIRRFLWLAVGFLLLAAAIGSAIYIVAHLLKCL* |
| Ga0116127_10880332 | 3300009618 | Peatland | KGIRGFLWLAVGFLLLASALGSAIYIVVHLLNYL* |
| Ga0116116_10175043 | 3300009621 | Peatland | MSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL* |
| Ga0116116_10181624 | 3300009621 | Peatland | MSETQGQFNGICGFLWLAVGILLLAAVIGSAIYIVVHLLNYL* |
| Ga0116114_10139172 | 3300009630 | Peatland | MSEAQGQFKGIGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL* |
| Ga0116115_11488251 | 3300009631 | Peatland | IRGFLWLAVGFLLLAAAIGSAIYIVAHLLNRYKRC* |
| Ga0116102_11030262 | 3300009632 | Peatland | VSQSESQFKGVRGFLWLAVGFLLLAAAIGSALYVVVHLL |
| Ga0116112_10265384 | 3300009636 | Peatland | KGIGGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0116118_10737773 | 3300009637 | Peatland | MAETESQFKGFRGFLWLAVGLLLLAAAIGSTIYITVHLLKYL* |
| Ga0116113_11911671 | 3300009638 | Peatland | PQSTQEDFCVSESESQFKGIRGFLWLAVGFWLLAAALGSATYIVVHLLKCL* |
| Ga0116126_12476191 | 3300009640 | Peatland | TQEDPCVSESESQFKGIRGFLWLAVGFLLLAADMGSAIYIVVHLLKFS* |
| Ga0116110_10231222 | 3300009643 | Peatland | MYEAESQFKGIRGFLWLAVGSLLLAAAIGSAIYIVVHLLNYL* |
| Ga0116110_10394291 | 3300009643 | Peatland | MSETEGQFKGIGGFLWLGVGFLLLTAAVGSAIYIVAHFLKYL* |
| Ga0116121_10071972 | 3300009644 | Peatland | MYEAESQFKGIRGFLWLAVGSLLLAAAIGSGIYIVARLLDYL* |
| Ga0116106_12883211 | 3300009645 | Peatland | VSESESQFKGIRGFLWLAVGLLLVAAATEGAIYIVVHLLSTCEPDSS |
| Ga0116132_11762111 | 3300009646 | Peatland | EDPCMSETQGQFKGIRGFLWLAVGFLLLAATVGSAIYIVAHLLNYL* |
| Ga0116132_12074582 | 3300009646 | Peatland | DAAQEDPCMSETECQFNGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLIYL* |
| Ga0116224_105862061 | 3300009683 | Peatlands Soil | VSESESQFKSIRGFLWLAAGFLLLAAALGSATYIVVHLLKC |
| Ga0116217_101396263 | 3300009700 | Peatlands Soil | QFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0116219_100935651 | 3300009824 | Peatlands Soil | PLSTQEDFCVSESESQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0116223_101301601 | 3300009839 | Peatlands Soil | TQEDLCVSDSESQFKGIRGFLWLAAGFLPLAAASGSVIYIVVHLLS* |
| Ga0116223_107330191 | 3300009839 | Peatlands Soil | TQEDPCVSETESQFNGIRGFLWLAVGFLVLAAATGSAICIVLHLLNYL* |
| Ga0074046_100207863 | 3300010339 | Bog Forest Soil | MSESGGHFKGIRRLIWLAVGFLLLAAALESAIYIVVHLLNY* |
| Ga0074046_100817003 | 3300010339 | Bog Forest Soil | MSEAESQFKGIRGFLWLAVGLLLVAAALGSAIYIVVHHLNYL* |
| Ga0074046_101208823 | 3300010339 | Bog Forest Soil | QFKGIGGFLWLAAGFLLLAAAIGSAIYIVAHLLKCL* |
| Ga0074046_106774042 | 3300010339 | Bog Forest Soil | MSETEGQFKGIRGFLWLAAGFLLLAAALGSAIYIVVHLLS* |
| Ga0074045_103932321 | 3300010341 | Bog Forest Soil | MSETEGQFKGIRGFLWLAVGVLLLAAAAGSAIYIVVHLL |
| Ga0074045_106190262 | 3300010341 | Bog Forest Soil | VSEPESQFEGIRRFLWLAVGFLLLAAALGSAIYIVV |
| Ga0136449_1008923362 | 3300010379 | Peatlands Soil | MSEAESQFKGIRGFLWLAVGFLLIAAAVGSAIYIVVHLFNYL* |
| Ga0136449_1014120562 | 3300010379 | Peatlands Soil | MSETESQFKGIRGFLWLAVGFLLLAAALGSTLYIVVHLLNY* |
| Ga0136449_1018941582 | 3300010379 | Peatlands Soil | MSEAEGQFKGIRGFLWLAVGFLLLAAAIGSAIYLAIQVFDLL* |
| Ga0136449_1029309491 | 3300010379 | Peatlands Soil | TESQFKGIRGFLWLAVGLLLLVLATGSAIYIVVHLLECL* |
| Ga0136449_1041701902 | 3300010379 | Peatlands Soil | VSDSKGRFKGIRGFRWLFFGFWLLAAALGSAMYIVVHLLS |
| Ga0181539_10049878 | 3300014151 | Bog | MAQTESQFKGIRGFLWPAVGILLLAAAIGSAIYIVVHLLKYL* |
| Ga0181539_10766822 | 3300014151 | Bog | MSKTQGQFKGIRGFLWLAVGSLLLAAAIGSAIYIVVHLLKYL* |
| Ga0181539_11390711 | 3300014151 | Bog | TLNTTQEDPCVSESESQFKGIRGFLWLAVGFSLLAAAIGSAIYIAVHLLNYL* |
| Ga0181539_13393231 | 3300014151 | Bog | MSENEGLFNGIRGFLWLAVGVLLLAAAIGSTIYIVV |
| Ga0181533_10229467 | 3300014152 | Bog | MSKTQGQFKGIRGFLWLAVGSLLLAAAIGSAIYLVAHLLKYL* |
| Ga0181527_10133904 | 3300014153 | Bog | MSESEGQFKGIRGFRGLAVGFLLLAAAIGSAIYIVVHLLNYL* |
| Ga0181527_11163081 | 3300014153 | Bog | MSETEAQLKGIRGFLWLAVGFLLLAAAVGSAIYIVVHLLNYL* |
| Ga0181518_100423134 | 3300014156 | Bog | MAETESRFKGFRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL* |
| Ga0181518_101271232 | 3300014156 | Bog | MSETESQFKGIGGFLWLGVGFLLLTAAVGSAIYIVAHFLKYL* |
| Ga0181518_102342642 | 3300014156 | Bog | CMSETQGHFSGIRGFLWLAVGFLLLAAAIGSAVYIIVQLLK* |
| Ga0181518_104830381 | 3300014156 | Bog | MYEAESQFKGIRGFLWLAVGSLLLAAAIGSAIYIVVQLLNYL |
| Ga0181521_104800352 | 3300014158 | Bog | KGIRGFLWLAVGFLLLAADMGSAIYIVVHLLKFS* |
| Ga0181529_101832271 | 3300014161 | Bog | PYVAESESQFKGIRGFLWLAVGLLLLAAAIGSALYIVVHLLKCL* |
| Ga0181538_100443595 | 3300014162 | Bog | FKGIRGFLWLAVGFLLLAAAIGSLIYIVVHLLKCL* |
| Ga0181532_1000035815 | 3300014164 | Bog | VYEAESQFKGIRGFLWLAVGSLLLAAAIGSGIYIVARLLDYL* |
| Ga0181523_101199453 | 3300014165 | Bog | FKGIRGFLWLAVGSLLLAAAIGSGIYIVARLLDYL* |
| Ga0182010_100585573 | 3300014490 | Fen | VSESESQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL* |
| Ga0182011_100893404 | 3300014496 | Fen | MYETESQFKGIRGFLWLAVGLSLLAAAVGSAIYIVVHLFNYS* |
| Ga0182021_137005161 | 3300014502 | Fen | MSESESQFKGIRGFLWLAVGFLLLAAALGSALYIVAHLLTCL* |
| Ga0181536_103104461 | 3300014638 | Bog | MSENEGLFNGIRGFLWLAVGVLLLAAAIGSTIYIVVHLLN* |
| Ga0182030_1002162118 | 3300014838 | Bog | MSETQSQFKGIRRFLWLAVGFLLLAAALGSAIYIVAHLFKCL* |
| Ga0182027_105385132 | 3300014839 | Fen | MSESESQFKGIGGFLWLAAGFLLLAAAIGSALYVVVHLLKCL* |
| Ga0187802_101107212 | 3300017822 | Freshwater Sediment | ESQFKGIRGFLWLAVGFLLLAAAIGSALYVVVHLLKCL |
| Ga0187856_10145244 | 3300017925 | Peatland | MSETASQFKGIRGFLWLAVGILLLAAAIGSAIYIVVHLLNYQ |
| Ga0187856_10245192 | 3300017925 | Peatland | MSETQGQLKAICGFLWLAVGFLLLAATIGSAIYIIAHLLNYL |
| Ga0187856_10310902 | 3300017925 | Peatland | MFETESQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLSYL |
| Ga0187856_10374732 | 3300017925 | Peatland | MAETESRFKDICGFLWLAVGFLLVAVAIGSAIYIAVHLLNH |
| Ga0187849_100241510 | 3300017929 | Peatland | MSETEGQFKGIRGFLWLAVGFLLLAAAIGSAIYIIAHLLTYL |
| Ga0187849_10034131 | 3300017929 | Peatland | CMSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL |
| Ga0187849_10058538 | 3300017929 | Peatland | MSETQGPLKGIRGFLWLAVGFLLVAAAIGSAIYIVAHLLKYL |
| Ga0187849_10076556 | 3300017929 | Peatland | MSETQGQFNGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLNRYKRC |
| Ga0187849_10306684 | 3300017929 | Peatland | MSQTEGQFKGFRGFIWLAVGLLLLAAATGSAIYIVVHLFNYL |
| Ga0187849_10412161 | 3300017929 | Peatland | MSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL |
| Ga0187849_10464493 | 3300017929 | Peatland | MSETEGQFNGIRGFLWLAVGFSLLAAAIGSAIYFVVHLLNYL |
| Ga0187849_10484273 | 3300017929 | Peatland | MSETEGQFKGIRGFLWLAVGLLLLAAAIGSAIYIVVHLLDYL |
| Ga0187849_10581172 | 3300017929 | Peatland | MSETQGQFKGIRGFLWLAVGLLLLAAAIGSAIYIVAHLLKYL |
| Ga0187849_10627822 | 3300017929 | Peatland | MSETQGQLKGIRGFLWLAVGFLLLVAAVGSTIYIVAHLLNYL |
| Ga0187849_11573291 | 3300017929 | Peatland | MYETEGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL |
| Ga0187849_13114622 | 3300017929 | Peatland | MAETESQFKGIRGVLWLAAGILLLAAALGSAIYIVAHLLKYL |
| Ga0187877_100196410 | 3300017931 | Peatland | MDETQGQFKGIRGFFWLAVGFLLLAAAIGSAIYIVAHLLKYL |
| Ga0187877_10179523 | 3300017931 | Peatland | MAETESRFKDIRGSLWLAVGFLLVAVAIGSAIYIAVHLLNH |
| Ga0187877_10225495 | 3300017931 | Peatland | MYEAESQFRGILGFLWLAVGFLLLAATLGSAIYIVVHLLNYL |
| Ga0187877_10421881 | 3300017931 | Peatland | MSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLL |
| Ga0187877_10481204 | 3300017931 | Peatland | MAETGQFKGIRGFLWLAVGFLLLAAAIGSAIYIFAHLLHYL |
| Ga0187877_11592832 | 3300017931 | Peatland | MSETQGQFKGIRGFLWLAVGILVLAAAIGSAIYIVAHLLKYL |
| Ga0187877_11922212 | 3300017931 | Peatland | QGQLKGIRGFLWLAVGFLLLEAAIGTAIYIVAHLLKYL |
| Ga0187877_12682702 | 3300017931 | Peatland | CMSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLK |
| Ga0187848_102212382 | 3300017935 | Peatland | MSEAQGQFKGIGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL |
| Ga0187848_103323891 | 3300017935 | Peatland | MSETQGPSKGIRGFLWLAVGVLLLAAAIGSAIYIV |
| Ga0187854_100308972 | 3300017938 | Peatland | MSQIEGQFKGFRGFIWLAVGLLLLAAATGSAIYIVVHLFNYL |
| Ga0187854_100463993 | 3300017938 | Peatland | MSETEGQFKGIGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL |
| Ga0187854_100831192 | 3300017938 | Peatland | MSETASQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL |
| Ga0187854_102372241 | 3300017938 | Peatland | MSETQGQFKGIRGFLWLAVGFLLLAATVGSAIYIVAHLLNYL |
| Ga0187854_102401921 | 3300017938 | Peatland | CNTGGPCVSESECQFKGIRGFLWLAVGFLLLAAAMGGAIYIVAHLFNYL |
| Ga0187854_102444151 | 3300017938 | Peatland | MSESQGQLKGIRGFLWLAVGFLLLEAAIGTAIYIVAHLLKYL |
| Ga0187853_100030991 | 3300017940 | Peatland | PCMSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLNYL |
| Ga0187853_100554952 | 3300017940 | Peatland | MSETQGQFNGICGFLWLAVGILLLAAVIGSAIYIVVHLLNYL |
| Ga0187850_104134773 | 3300017941 | Peatland | QFQGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLIYL |
| Ga0187819_102460441 | 3300017943 | Freshwater Sediment | MSEFQSQFKGIRGFLWLAVGILLLAAATGSAIFIVDHLPD |
| Ga0187879_100118635 | 3300017946 | Peatland | CMSETEGQFKGIGGFLWLGVGFLLLTAAVGSAIYIVAHFLKYL |
| Ga0187879_106597112 | 3300017946 | Peatland | MSETEGQFKGIGGFLWLGVGFLLLTAAVGSAIYIVAHFLKYL |
| Ga0187817_100996652 | 3300017955 | Freshwater Sediment | VSESESQFKGIRGFLWLAVGILLLAAAIGSGFYIVAHLLKYL |
| Ga0187817_101797501 | 3300017955 | Freshwater Sediment | ESESQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKCL |
| Ga0187782_108004711 | 3300017975 | Tropical Peatland | MTETQGHFKGVRGFLWLSIGLLLLAAAIGSAIYIVVRLVN |
| Ga0181520_100228313 | 3300017988 | Bog | VYEAESQFKGIRGFLWLAVGSLLLAAAIGSGIYIVARLLDYL |
| Ga0187891_10083521 | 3300017996 | Peatland | VAESESQFKGIRRFLWLAVGFLLLAAAIGSAIYIVAHLLKCL |
| Ga0187891_11366192 | 3300017996 | Peatland | MSETQGPSKGIRGFLWLAVGVLLLAAAIGSAIYIVAHFLNCL |
| Ga0187870_10107185 | 3300017998 | Peatland | MSETQGQFKSIRGFLWLAVGFLLLAAAIGSTIYIVVHLLN |
| Ga0187870_12809931 | 3300017998 | Peatland | HPQCNTGGPCMSETASQFKGIRGFLWLAVGILLLAAAIGSAIYIVVHLLNYQ |
| Ga0187868_12463171 | 3300018002 | Peatland | PCMSETQGQFNGICGFLWLAVGILLLAAVIGSAIYIVVHLLNYL |
| Ga0187876_11275831 | 3300018003 | Peatland | MSETEGQFKGIRGFLWLAAGLLLLAAALGSAIYIVVYLFNYL |
| Ga0187876_12007451 | 3300018003 | Peatland | MSETQGQFNGIRGFLWLAVGFLLLAAAIGSAIYMVVHLLNHL |
| Ga0187876_12746881 | 3300018003 | Peatland | MSEAESQFKGIRGFLWLAVGFGLVAAAIGSAIYIVAHLLNYL |
| Ga0187865_10253782 | 3300018004 | Peatland | MSETQGQFEGISGFLWLAVGFLLLAAAIGSAIYVVVHLLNYL |
| Ga0187865_10688481 | 3300018004 | Peatland | TRNETQEDPCVAESERQFKGIRGFLWLAVGFLLLAAAIGSTLYVVVHLLKCL |
| Ga0187878_10282414 | 3300018005 | Peatland | MSQTEGQFKGFRGFTWLAVGLLLLAAATGSAIYIVVHLFNYL |
| Ga0187878_13576751 | 3300018005 | Peatland | QFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHVLNYL |
| Ga0187884_104211762 | 3300018009 | Peatland | KGIRGFLWLAVGFLLLAAALGSAIYIILHLLSYLRAAQ |
| Ga0187884_104732642 | 3300018009 | Peatland | MYEAESQFKGIRGFLWLAVGSLLLAAAIGSAIYIVVHLLNYL |
| Ga0187873_11828151 | 3300018013 | Peatland | TKGDPCVSESESQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLVNCL |
| Ga0187873_13344342 | 3300018013 | Peatland | MSETEDQFKGTGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL |
| Ga0187866_10880771 | 3300018015 | Peatland | KGDPCVSESESQFKGIRGFLWLVAGFLLLAAAIGSALYVVVHLLKCL |
| Ga0187866_11398363 | 3300018015 | Peatland | DPCMYETEGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLKYL |
| Ga0187880_13017941 | 3300018016 | Peatland | DPCMSGTQGQLKGIRGFLWLAVGFLLLAAALGSAIYIILHLLSYLRAAQ |
| Ga0187872_102144121 | 3300018017 | Peatland | NPCMSETQGEFKGIRGFLWLAVGFLLLASAIGSATYIVFHLLNYL |
| Ga0187886_11716371 | 3300018018 | Peatland | TRGAAQGDLCMSGTQGQLKGIRGFLWLAVGFLLLAATIGSAIYIVAHLLN |
| Ga0187886_13432271 | 3300018018 | Peatland | MAETESQFKSIRGFLWLAVGFLLLVAAIGSAIYIVVHLLNYL |
| Ga0187874_1000676710 | 3300018019 | Peatland | MAETGQFKGIRGFLWLTAGLLLLAAALGSAIYIVAHLLKYL |
| Ga0187874_100159736 | 3300018019 | Peatland | VSESESQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL |
| Ga0187861_100400784 | 3300018020 | Peatland | CMSETASQFKGIRGFLWLAVGILLLAAAIGSAIYIVVHLLNYQ |
| Ga0187861_103402431 | 3300018020 | Peatland | MSEAQGQFTGIGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL |
| Ga0187882_12287442 | 3300018021 | Peatland | MSQIEGQFKGFRGFIWLAVGLLLLAVATGSAIYMVVHLFNYL |
| Ga0187864_101222501 | 3300018022 | Peatland | MSETQGPFNGIRGFFWLALGFLLLAAAIGSAIYIVAHLLNYL |
| Ga0187889_103606952 | 3300018023 | Peatland | FKGIRGFLWLAVGLLLLAAAIGSAIYIVVHLLDYL |
| Ga0187889_105263011 | 3300018023 | Peatland | QEDPCMSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLK |
| Ga0187881_100057779 | 3300018024 | Peatland | MDETQGQFKSIRGFFWLAVGFLLLAAAIGSAIYIVAHLLKYL |
| Ga0187881_100440534 | 3300018024 | Peatland | MSETEGQLKGIRGFLWLALAFLLLTAAIGSAIYIVVHLLYYL |
| Ga0187881_102053462 | 3300018024 | Peatland | MSETEGRFKGIGGFLWLGVGFLLLTAAVGSAIYIVAH |
| Ga0187881_102584701 | 3300018024 | Peatland | MSETEGQFKGIGGFLWLAVGFLRLAAATGSAIYIVVHLLTYL |
| Ga0187857_101469361 | 3300018026 | Peatland | MSETEGQFNGIRGFLWLAVGFSLLAAAIGSAIYFVVYLLNYL |
| Ga0187857_102580653 | 3300018026 | Peatland | MSETQGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLK |
| Ga0187863_107733142 | 3300018034 | Peatland | GSRMYEAESQFKGIRGFLWLAVGSLLLAAAIGSGIYIVARLLDYL |
| Ga0187875_100905703 | 3300018035 | Peatland | MYEAERQFKGIRGFLWLAVGFLLIAAAIGSAIYVVAPLLNYL |
| Ga0187875_101072903 | 3300018035 | Peatland | MSQTEGQFKGFRGFIWLAVGLLLLAAATGSAIYIVVHLFYYL |
| Ga0187890_106610022 | 3300018044 | Peatland | MSETQGPSKGIRGFLWLAVGVLLLAAAIGSAIYIVVHLLKCL |
| Ga0187858_103683211 | 3300018057 | Peatland | MSESQGQLKGIRGFLWLAVGFLLLEAAIGSAIYIVAHLLKYL |
| Ga0187858_108545622 | 3300018057 | Peatland | ETEGQFKGIRGFLWLAVGLLLLAAAIGSAIYIVVHLLDYL |
| Ga0187769_102895321 | 3300018086 | Tropical Peatland | MSEAESQFKGILGFLWLAVGFLLLAVVIGSGIYIVVHLLNNL |
| Ga0187770_108718621 | 3300018090 | Tropical Peatland | MSETEGIFKGFRGLIWLTIGGLLLAAALESAIYIVVHLLE |
| Ga0187852_11936382 | 3300019082 | Peatland | MSEAEGQFKGSRGFLWLAFGFLLLAAAIGSAIYIV |
| Ga0187852_12894052 | 3300019082 | Peatland | MIKAQENLCLTETQGQFKGIQGFLWLAAGLLLLAAAMGSAIYIVVHLLNYL |
| Ga0187852_13420772 | 3300019082 | Peatland | MSEAGSQLNGARGFLRLAIGFLLLAAALGSAIYIVAHLLKYL |
| Ga0181501_13364001 | 3300019230 | Peatland | VYEAESQFKGIRGFLWLAVGSLLLAAAIGSGIYIVARL |
| Ga0208323_10698321 | 3300025439 | Peatland | MAETESRFKDICGFLWLAVGFLLVAVAIGSAIYIAV |
| Ga0208456_10418232 | 3300025441 | Peatland | LRIFETPNQFKGIRGFLWLAVGFLLLAAALGSAAYIVAHLFKRL |
| Ga0208456_10956831 | 3300025441 | Peatland | AQEDSCMSETQGQFKSIRGFLWLAVGFLLLAAAIGSTIYIVVHLLN |
| Ga0208189_10701873 | 3300025444 | Peatland | MYEAESQFKGIRGFLWLAVGFLLLASAIGSATYIVFHLLNYL |
| Ga0208689_10517953 | 3300025459 | Peatland | DPCMSQTEGQFKGFRGFIWLAVGLLLLAAATGSAIYIVVHLFNYL |
| Ga0208692_10590422 | 3300025472 | Peatland | PCMSETQGQLKGIRGFLWLAVGLLLLAATIGSAIYIVAHLLNYL |
| Ga0208192_10668802 | 3300025477 | Peatland | MSETQGQFNGIRGFLWLAVGFLLLAAAIGSAIYIVAHLLN |
| Ga0208686_10369182 | 3300025500 | Peatland | EPCLSESESQFKGIRRFLWLADGFLLLAAAIGSAIYIVVRFLNYF |
| Ga0208937_11012501 | 3300025506 | Peatland | EGQFKGIGGFLWLGVGFLLLSAAVGSAIYIVAHFLKYL |
| Ga0208820_10914812 | 3300025576 | Peatland | EDPCVSESESQFKGIRGFLWLAVGFLLLAADMGSAIYIVVHLLKFS |
| Ga0209039_100051009 | 3300027825 | Bog Forest Soil | MSESGGHFKGIRRLIWLAVGFLLLAAALESAIYIVVHLLNY |
| Ga0209517_103806242 | 3300027854 | Peatlands Soil | MSETEGQFKGIRGFLWLAAGFLLLAAALGSAIYIVVHLLS |
| Ga0209166_100059196 | 3300027857 | Surface Soil | MSETRGQFEGLRGFLRLAVGFLLLAAAIGSMIYIVAHLLSYF |
| Ga0209166_101425562 | 3300027857 | Surface Soil | MSETRGQFEGLRGFLRLAVGFLLLAAAMGSAIYIVVHLLSRL |
| Ga0247275_10275781 | 3300029817 | Soil | QEDFCVSESESQFKGIRGFLWLAVGFLLLAAAIGSALYVVVHLLKCL |
| Ga0311346_106215462 | 3300029952 | Bog | TQEDFCVSESESQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL |
| Ga0265340_102689651 | 3300031247 | Rhizosphere | EDFCVSESESQFKGIRGFLWLAAGFLLLAAAIGSALYIVVHLLKCL |
| Ga0307374_105318331 | 3300031670 | Soil | QEDFCVSESESQFKGIRGFLWMAVGFLLLAAAIGSAIYIVAHLLKCL |
| Ga0307373_100670334 | 3300031672 | Soil | VAESESQFKGIRGFLWLAVGFLLLAAALGSATYIVVHLLKCL |
| Ga0311301_107319002 | 3300032160 | Peatlands Soil | EPWMSETESQFKGIRGFLWLAVGLLLLVLATGSAIYIVVHLLECL |
| Ga0311301_110491862 | 3300032160 | Peatlands Soil | MSETESQFKGIRGFLWLAVGFLLLAAALGSTLYIVVHLLNY |
| Ga0335081_103254762 | 3300032892 | Soil | MSQTEGRFKGIRGFLWLAIGLLLVLTALGSLVYIIVHLG |
| Ga0335081_114200222 | 3300032892 | Soil | MSNTENHFKGIRSFLRLAIGFLLLAVALGCAIYIVVHLLKYL |
| Ga0335071_105143121 | 3300032897 | Soil | SESQFKGIRGFLWLAAGFLLLAAAIGSALYVVVHLLKCL |
| Ga0326728_100005507 | 3300033402 | Peat Soil | MSGTESRFKGIGGFLWQAVGFLLLAAAFGSAIYIVAHFLKYF |
| Ga0326728_1000110619 | 3300033402 | Peat Soil | MAEAESRSKDIGGFLWLAVGFLLVAVAIGSAIYIAVHLLNH |
| Ga0326728_1000146919 | 3300033402 | Peat Soil | MAETGQFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLVNCL |
| Ga0326728_100141787 | 3300033402 | Peat Soil | MSEPQGQFKGIRGFLWLAVGFLLLAAALGSAIYILVHLLSCL |
| Ga0326728_1001529819 | 3300033402 | Peat Soil | MSEAESQFQGIRGILWLAVGFLLLAAAIGSAIYIAVHLLNCL |
| Ga0326728_100289217 | 3300033402 | Peat Soil | MAETESRFKDICGSLWLAVGFLLVAVAIGSAIYIAVHLLNH |
| Ga0326728_100491825 | 3300033402 | Peat Soil | MYEAESQFKGIPGFLWLAVGYLLLAAAIGSAIYIVVQLLNYL |
| Ga0326728_100563152 | 3300033402 | Peat Soil | MAETESRFKGIRGFLWLAVGFLLLAAAIGSAIYIVVHLLKYL |
| Ga0326728_101024462 | 3300033402 | Peat Soil | MSEMQNQFEGFRGSLWLAVGFLLLAAALGSAVYIVAHVIALL |
| Ga0326728_101032204 | 3300033402 | Peat Soil | VSQTEGQFKGFRGFIWLAVGLLLLAAATGSAIYIVVHLFNYL |
| Ga0326728_101577844 | 3300033402 | Peat Soil | MAETESRFKDICGFLWQAVGFLLGAVAIGSAIYIAVHLLNH |
| Ga0326728_103191082 | 3300033402 | Peat Soil | MAETESRFKVSRGFLWLAVGLLLLAAAIGSAIYIVASLLNNL |
| Ga0326728_107409071 | 3300033402 | Peat Soil | MYETESQFRGVRGFLWLAVGSLLLAAAIGSAIYIIVDLVRDL |
| Ga0326728_112067241 | 3300033402 | Peat Soil | ENPCMSESQGQFKGIRGFLWLAVGFLLLAAAIGNAIYIVAHLLKYL |
| Ga0326727_105020762 | 3300033405 | Peat Soil | MSLTEGPFKGFRGFIWLAVGLLLLAAATGSAIYIIVHLFNYL |
| Ga0314861_0069756_1108_1233 | 3300033977 | Peatland | MSDSDQFKGFRGFLWRAVGFLLMAAAIGSATYIIVHLLKCR |
| ⦗Top⦘ |