


| Basic Information | |
|---|---|
| Family ID | F020785 |
| Family Type | Metagenome |
| Number of Sequences | 222 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MNANANGWHGAPIKALDEAKTGRLREESNAEWRPRPPVPFGLLPK |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.59 % |
| % of genes near scaffold ends (potentially truncated) | 96.85 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.270 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.108 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.640 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.901 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.81% β-sheet: 0.00% Coil/Unstructured: 82.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF03441 | FAD_binding_7 | 4.05 |
| PF00528 | BPD_transp_1 | 3.15 |
| PF13561 | adh_short_C2 | 2.25 |
| PF03480 | DctP | 1.80 |
| PF13416 | SBP_bac_8 | 1.80 |
| PF02518 | HATPase_c | 1.80 |
| PF13302 | Acetyltransf_3 | 1.35 |
| PF01578 | Cytochrom_C_asm | 1.35 |
| PF00482 | T2SSF | 1.35 |
| PF04039 | MnhB | 1.35 |
| PF01979 | Amidohydro_1 | 0.90 |
| PF04995 | CcmD | 0.90 |
| PF01634 | HisG | 0.90 |
| PF00005 | ABC_tran | 0.90 |
| PF07719 | TPR_2 | 0.90 |
| PF13417 | GST_N_3 | 0.90 |
| PF00497 | SBP_bac_3 | 0.90 |
| PF00571 | CBS | 0.90 |
| PF02530 | Porin_2 | 0.90 |
| PF02653 | BPD_transp_2 | 0.90 |
| PF08546 | ApbA_C | 0.90 |
| PF05977 | MFS_3 | 0.90 |
| PF08770 | SoxZ | 0.90 |
| PF00899 | ThiF | 0.90 |
| PF00925 | GTP_cyclohydro2 | 0.90 |
| PF00237 | Ribosomal_L22 | 0.90 |
| PF00662 | Proton_antipo_N | 0.90 |
| PF07650 | KH_2 | 0.90 |
| PF02826 | 2-Hacid_dh_C | 0.90 |
| PF00701 | DHDPS | 0.90 |
| PF12680 | SnoaL_2 | 0.45 |
| PF00107 | ADH_zinc_N | 0.45 |
| PF05258 | DciA | 0.45 |
| PF04364 | DNA_pol3_chi | 0.45 |
| PF13545 | HTH_Crp_2 | 0.45 |
| PF00970 | FAD_binding_6 | 0.45 |
| PF13385 | Laminin_G_3 | 0.45 |
| PF01315 | Ald_Xan_dh_C | 0.45 |
| PF03448 | MgtE_N | 0.45 |
| PF06808 | DctM | 0.45 |
| PF01026 | TatD_DNase | 0.45 |
| PF03486 | HI0933_like | 0.45 |
| PF00436 | SSB | 0.45 |
| PF02955 | GSH-S_ATP | 0.45 |
| PF00916 | Sulfate_transp | 0.45 |
| PF01053 | Cys_Met_Meta_PP | 0.45 |
| PF01872 | RibD_C | 0.45 |
| PF09339 | HTH_IclR | 0.45 |
| PF01648 | ACPS | 0.45 |
| PF01266 | DAO | 0.45 |
| PF03591 | AzlC | 0.45 |
| PF00171 | Aldedh | 0.45 |
| PF03462 | PCRF | 0.45 |
| PF04055 | Radical_SAM | 0.45 |
| PF12399 | BCA_ABC_TP_C | 0.45 |
| PF04379 | DUF525 | 0.45 |
| PF05035 | DGOK | 0.45 |
| PF09976 | TPR_21 | 0.45 |
| PF03737 | RraA-like | 0.45 |
| PF03472 | Autoind_bind | 0.45 |
| PF13393 | tRNA-synt_His | 0.45 |
| PF00288 | GHMP_kinases_N | 0.45 |
| PF04174 | CP_ATPgrasp_1 | 0.45 |
| PF13384 | HTH_23 | 0.45 |
| PF03741 | TerC | 0.45 |
| PF04828 | GFA | 0.45 |
| PF02875 | Mur_ligase_C | 0.45 |
| PF01799 | Fer2_2 | 0.45 |
| PF04679 | DNA_ligase_A_C | 0.45 |
| PF13380 | CoA_binding_2 | 0.45 |
| PF14602 | Hexapep_2 | 0.45 |
| PF02786 | CPSase_L_D2 | 0.45 |
| PF00834 | Ribul_P_3_epim | 0.45 |
| PF12838 | Fer4_7 | 0.45 |
| PF01259 | SAICAR_synt | 0.45 |
| PF01207 | Dus | 0.45 |
| PF00083 | Sugar_tr | 0.45 |
| PF08530 | PepX_C | 0.45 |
| PF02515 | CoA_transf_3 | 0.45 |
| PF04011 | LemA | 0.45 |
| PF03976 | PPK2 | 0.45 |
| PF00719 | Pyrophosphatase | 0.45 |
| PF04365 | BrnT_toxin | 0.45 |
| PF08666 | SAF | 0.45 |
| PF14403 | CP_ATPgrasp_2 | 0.45 |
| PF00275 | EPSP_synthase | 0.45 |
| PF02922 | CBM_48 | 0.45 |
| PF16576 | HlyD_D23 | 0.45 |
| PF01738 | DLH | 0.45 |
| PF06831 | H2TH | 0.45 |
| PF13279 | 4HBT_2 | 0.45 |
| PF04972 | BON | 0.45 |
| PF01842 | ACT | 0.45 |
| PF07219 | HemY_N | 0.45 |
| PF12146 | Hydrolase_4 | 0.45 |
| PF13181 | TPR_8 | 0.45 |
| PF02016 | Peptidase_S66 | 0.45 |
| PF13649 | Methyltransf_25 | 0.45 |
| PF13577 | SnoaL_4 | 0.45 |
| PF01380 | SIS | 0.45 |
| PF02381 | MraZ | 0.45 |
| PF13481 | AAA_25 | 0.45 |
| PF00294 | PfkB | 0.45 |
| PF00106 | adh_short | 0.45 |
| PF01321 | Creatinase_N | 0.45 |
| PF04358 | DsrC | 0.45 |
| PF00534 | Glycos_transf_1 | 0.45 |
| PF01734 | Patatin | 0.45 |
| PF09864 | MliC | 0.45 |
| PF00383 | dCMP_cyt_deam_1 | 0.45 |
| PF06707 | DUF1194 | 0.45 |
| PF08379 | Bact_transglu_N | 0.45 |
| PF00908 | dTDP_sugar_isom | 0.45 |
| PF00389 | 2-Hacid_dh | 0.45 |
| PF14681 | UPRTase | 0.45 |
| PF00160 | Pro_isomerase | 0.45 |
| PF13414 | TPR_11 | 0.45 |
| PF13686 | DrsE_2 | 0.45 |
| PF01066 | CDP-OH_P_transf | 0.45 |
| PF00146 | NADHdh | 0.45 |
| PF01613 | Flavin_Reduct | 0.45 |
| PF00069 | Pkinase | 0.45 |
| PF02738 | MoCoBD_1 | 0.45 |
| PF00329 | Complex1_30kDa | 0.45 |
| PF02684 | LpxB | 0.45 |
| PF01039 | Carboxyl_trans | 0.45 |
| PF00702 | Hydrolase | 0.45 |
| PF02322 | Cyt_bd_oxida_II | 0.45 |
| PF03401 | TctC | 0.45 |
| PF00873 | ACR_tran | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 4.05 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.80 |
| COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 1.80 |
| COG2111 | Multisubunit Na+/H+ antiporter, MnhB subunit | Inorganic ion transport and metabolism [P] | 1.35 |
| COG3114 | Heme exporter protein D | Intracellular trafficking, secretion, and vesicular transport [U] | 0.90 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG0091 | Ribosomal protein L22 | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 0.90 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.90 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.90 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.90 |
| COG2197 | DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains | Transcription [K] | 0.90 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.45 |
| COG3262 | Ni,Fe-hydrogenase III component G | Energy production and conversion [C] | 0.45 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.45 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.45 |
| COG3734 | 2-keto-3-deoxy-galactonokinase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.45 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.45 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.45 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.45 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.45 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.45 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.45 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.45 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.45 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.45 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.45 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.45 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.45 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.45 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.45 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.45 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.45 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.45 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.45 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.45 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.45 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.45 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.45 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.45 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.45 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.45 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.45 |
| COG0852 | NADH:ubiquinone oxidoreductase 27 kD subunit (chain C) | Energy production and conversion [C] | 0.45 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.45 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.45 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.45 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.45 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.45 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.45 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.45 |
| COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 0.45 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG1619 | Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling) | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.45 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.45 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.45 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.45 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.45 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.45 |
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.45 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.45 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.45 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.45 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.45 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.45 |
| COG2308 | Circularly permuted ATP-grasp protein | General function prediction only [R] | 0.45 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.45 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.45 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.45 |
| COG2920 | Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C) | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG2927 | DNA polymerase III, chi subunit | Replication, recombination and repair [L] | 0.45 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.45 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.45 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.45 |
| COG2967 | Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transport | Inorganic ion transport and metabolism [P] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.07 % |
| Unclassified | root | N/A | 27.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS401DXCRG | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300003541|JGI20214J51650_10837018 | Not Available | 643 | Open in IMG/M |
| 3300004047|Ga0055499_10093085 | Not Available | 548 | Open in IMG/M |
| 3300004157|Ga0062590_100489741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300005186|Ga0066676_10559671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300005187|Ga0066675_10967408 | Not Available | 641 | Open in IMG/M |
| 3300005218|Ga0068996_10066151 | Not Available | 746 | Open in IMG/M |
| 3300005328|Ga0070676_10113860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1688 | Open in IMG/M |
| 3300005329|Ga0070683_100618530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300005332|Ga0066388_104003559 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005332|Ga0066388_108330414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300005334|Ga0068869_101012347 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005334|Ga0068869_101833098 | Not Available | 543 | Open in IMG/M |
| 3300005338|Ga0068868_100750568 | Not Available | 877 | Open in IMG/M |
| 3300005347|Ga0070668_100023340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4679 | Open in IMG/M |
| 3300005347|Ga0070668_100065980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2807 | Open in IMG/M |
| 3300005354|Ga0070675_100050381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3419 | Open in IMG/M |
| 3300005354|Ga0070675_101923728 | Not Available | 545 | Open in IMG/M |
| 3300005355|Ga0070671_100755136 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 845 | Open in IMG/M |
| 3300005356|Ga0070674_101570787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300005364|Ga0070673_100022716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 4570 | Open in IMG/M |
| 3300005364|Ga0070673_100250856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1542 | Open in IMG/M |
| 3300005364|Ga0070673_100734127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300005366|Ga0070659_101009915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 730 | Open in IMG/M |
| 3300005366|Ga0070659_101334270 | Not Available | 637 | Open in IMG/M |
| 3300005367|Ga0070667_100154647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2016 | Open in IMG/M |
| 3300005406|Ga0070703_10210819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300005438|Ga0070701_10550518 | Not Available | 757 | Open in IMG/M |
| 3300005440|Ga0070705_100872405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300005445|Ga0070708_100878635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
| 3300005451|Ga0066681_10773113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300005459|Ga0068867_100029945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3925 | Open in IMG/M |
| 3300005471|Ga0070698_100187086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2008 | Open in IMG/M |
| 3300005471|Ga0070698_100370254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300005530|Ga0070679_101271030 | Not Available | 681 | Open in IMG/M |
| 3300005543|Ga0070672_100244398 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1510 | Open in IMG/M |
| 3300005554|Ga0066661_10889997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300005556|Ga0066707_10034748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2826 | Open in IMG/M |
| 3300005577|Ga0068857_101981515 | Not Available | 571 | Open in IMG/M |
| 3300005598|Ga0066706_10144002 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300005616|Ga0068852_100027955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4607 | Open in IMG/M |
| 3300005618|Ga0068864_100151858 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300005764|Ga0066903_106191414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 625 | Open in IMG/M |
| 3300005764|Ga0066903_107412972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300005841|Ga0068863_100971861 | Not Available | 851 | Open in IMG/M |
| 3300005940|Ga0073913_10019159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 978 | Open in IMG/M |
| 3300006050|Ga0075028_100908637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 543 | Open in IMG/M |
| 3300006050|Ga0075028_100984502 | Not Available | 524 | Open in IMG/M |
| 3300006057|Ga0075026_100052600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1924 | Open in IMG/M |
| 3300006169|Ga0082029_1420989 | Not Available | 625 | Open in IMG/M |
| 3300006358|Ga0068871_101570920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 288 | 622 | Open in IMG/M |
| 3300006358|Ga0068871_102307906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300006755|Ga0079222_10023787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2506 | Open in IMG/M |
| 3300006796|Ga0066665_10188309 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300006806|Ga0079220_11046311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300006854|Ga0075425_100911840 | Not Available | 1004 | Open in IMG/M |
| 3300006880|Ga0075429_101861036 | Not Available | 522 | Open in IMG/M |
| 3300006881|Ga0068865_100301935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300006903|Ga0075426_10385580 | Not Available | 1033 | Open in IMG/M |
| 3300006904|Ga0075424_100301415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1706 | Open in IMG/M |
| 3300006904|Ga0075424_101135243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300006954|Ga0079219_11946884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300007076|Ga0075435_100192894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas communis | 1725 | Open in IMG/M |
| 3300007076|Ga0075435_100947726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300009092|Ga0105250_10543970 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009093|Ga0105240_11680362 | Not Available | 663 | Open in IMG/M |
| 3300009094|Ga0111539_10385525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300009094|Ga0111539_13137238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300009100|Ga0075418_11828752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 661 | Open in IMG/M |
| 3300009101|Ga0105247_10070231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2187 | Open in IMG/M |
| 3300009177|Ga0105248_10687219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
| 3300009792|Ga0126374_10446756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300010335|Ga0134063_10242879 | Not Available | 855 | Open in IMG/M |
| 3300010360|Ga0126372_10788610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300010360|Ga0126372_12101811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300010366|Ga0126379_10950457 | Not Available | 963 | Open in IMG/M |
| 3300010400|Ga0134122_11299746 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010401|Ga0134121_10277405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → Aestuariivita boseongensis | 1476 | Open in IMG/M |
| 3300010403|Ga0134123_10782076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → Aestuariivita boseongensis | 945 | Open in IMG/M |
| 3300010429|Ga0116241_10945724 | Not Available | 656 | Open in IMG/M |
| 3300012198|Ga0137364_11070174 | Not Available | 608 | Open in IMG/M |
| 3300012203|Ga0137399_11151558 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012285|Ga0137370_10545078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 713 | Open in IMG/M |
| 3300012360|Ga0137375_10701783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300012474|Ga0157356_1004601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300012529|Ga0136630_1289994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300012903|Ga0157289_10411750 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012951|Ga0164300_10748018 | Not Available | 599 | Open in IMG/M |
| 3300012957|Ga0164303_10162417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1196 | Open in IMG/M |
| 3300012957|Ga0164303_10893481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300012958|Ga0164299_10331771 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012986|Ga0164304_11384551 | Not Available | 577 | Open in IMG/M |
| 3300012987|Ga0164307_11476558 | Not Available | 574 | Open in IMG/M |
| 3300012988|Ga0164306_10662497 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012989|Ga0164305_10352876 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300013100|Ga0157373_11301129 | Not Available | 550 | Open in IMG/M |
| 3300013296|Ga0157374_10031145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4846 | Open in IMG/M |
| 3300013307|Ga0157372_11231760 | Not Available | 864 | Open in IMG/M |
| 3300013308|Ga0157375_10024617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5575 | Open in IMG/M |
| 3300013308|Ga0157375_10152891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2444 | Open in IMG/M |
| 3300014312|Ga0075345_1068840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 758 | Open in IMG/M |
| 3300014325|Ga0163163_10910609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 943 | Open in IMG/M |
| 3300014326|Ga0157380_10030713 | All Organisms → cellular organisms → Bacteria | 4117 | Open in IMG/M |
| 3300014745|Ga0157377_10816289 | Not Available | 689 | Open in IMG/M |
| 3300014969|Ga0157376_11494675 | Not Available | 708 | Open in IMG/M |
| 3300015371|Ga0132258_10023689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13488 | Open in IMG/M |
| 3300015371|Ga0132258_10382006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3493 | Open in IMG/M |
| 3300015371|Ga0132258_10863007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2284 | Open in IMG/M |
| 3300015371|Ga0132258_11379267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1781 | Open in IMG/M |
| 3300015371|Ga0132258_13930041 | Not Available | 1010 | Open in IMG/M |
| 3300015373|Ga0132257_101704715 | Not Available | 808 | Open in IMG/M |
| 3300015374|Ga0132255_101461633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300015374|Ga0132255_102806720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300015374|Ga0132255_103328382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
| 3300017789|Ga0136617_10075559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2944 | Open in IMG/M |
| 3300017792|Ga0163161_10400615 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300017792|Ga0163161_11020435 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300017959|Ga0187779_10022692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3583 | Open in IMG/M |
| 3300017959|Ga0187779_10027975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3235 | Open in IMG/M |
| 3300017959|Ga0187779_10565128 | Not Available | 758 | Open in IMG/M |
| 3300017961|Ga0187778_10008113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6645 | Open in IMG/M |
| 3300017961|Ga0187778_10270652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
| 3300017966|Ga0187776_10001824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10806 | Open in IMG/M |
| 3300017973|Ga0187780_10245713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1253 | Open in IMG/M |
| 3300017999|Ga0187767_10099876 | Not Available | 805 | Open in IMG/M |
| 3300018054|Ga0184621_10340018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300018056|Ga0184623_10181047 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300018060|Ga0187765_10321520 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300018064|Ga0187773_10018169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2989 | Open in IMG/M |
| 3300018064|Ga0187773_10290340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 909 | Open in IMG/M |
| 3300018078|Ga0184612_10347361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300018081|Ga0184625_10565730 | Not Available | 563 | Open in IMG/M |
| 3300025290|Ga0207673_1021101 | Not Available | 881 | Open in IMG/M |
| 3300025315|Ga0207697_10103992 | Not Available | 1212 | Open in IMG/M |
| 3300025461|Ga0208851_1035669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300025893|Ga0207682_10462211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 601 | Open in IMG/M |
| 3300025906|Ga0207699_10587056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 810 | Open in IMG/M |
| 3300025909|Ga0207705_11210626 | Not Available | 579 | Open in IMG/M |
| 3300025917|Ga0207660_11094119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300025920|Ga0207649_11468351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300025923|Ga0207681_10085091 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300025926|Ga0207659_10021599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4276 | Open in IMG/M |
| 3300025931|Ga0207644_10618213 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 900 | Open in IMG/M |
| 3300025935|Ga0207709_11251874 | Not Available | 612 | Open in IMG/M |
| 3300025936|Ga0207670_11320854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hwanghaeella → Hwanghaeella grinnelliae | 612 | Open in IMG/M |
| 3300025937|Ga0207669_10368272 | Not Available | 1116 | Open in IMG/M |
| 3300025937|Ga0207669_11046103 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025938|Ga0207704_10050607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2507 | Open in IMG/M |
| 3300025938|Ga0207704_11787871 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300025940|Ga0207691_10007603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10430 | Open in IMG/M |
| 3300025940|Ga0207691_10253353 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1519 | Open in IMG/M |
| 3300025940|Ga0207691_11504286 | Not Available | 550 | Open in IMG/M |
| 3300025941|Ga0207711_10745084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300025945|Ga0207679_11482439 | Not Available | 622 | Open in IMG/M |
| 3300025945|Ga0207679_11714070 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025960|Ga0207651_10690791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
| 3300025960|Ga0207651_11057862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 726 | Open in IMG/M |
| 3300025960|Ga0207651_11533120 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025961|Ga0207712_10838579 | Not Available | 810 | Open in IMG/M |
| 3300025972|Ga0207668_10060685 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
| 3300025972|Ga0207668_10777587 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300025981|Ga0207640_10658294 | Not Available | 893 | Open in IMG/M |
| 3300025986|Ga0207658_10852926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 828 | Open in IMG/M |
| 3300025986|Ga0207658_11824700 | Not Available | 555 | Open in IMG/M |
| 3300026078|Ga0207702_10172800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1983 | Open in IMG/M |
| 3300026078|Ga0207702_10925137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300026089|Ga0207648_11511052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 631 | Open in IMG/M |
| 3300026095|Ga0207676_11615868 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300026121|Ga0207683_11864258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 550 | Open in IMG/M |
| 3300026142|Ga0207698_12129692 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026550|Ga0209474_10563604 | Not Available | 580 | Open in IMG/M |
| 3300027765|Ga0209073_10038080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1527 | Open in IMG/M |
| 3300027765|Ga0209073_10468934 | Not Available | 526 | Open in IMG/M |
| 3300027841|Ga0209262_10594398 | Not Available | 537 | Open in IMG/M |
| 3300027890|Ga0209496_10026361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1948 | Open in IMG/M |
| 3300027902|Ga0209048_10009887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8604 | Open in IMG/M |
| 3300028380|Ga0268265_10916408 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300028380|Ga0268265_11395596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 702 | Open in IMG/M |
| 3300028381|Ga0268264_11254357 | Not Available | 751 | Open in IMG/M |
| 3300028381|Ga0268264_12284107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300028679|Ga0302169_10055082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 927 | Open in IMG/M |
| 3300028739|Ga0302205_10120634 | Not Available | 670 | Open in IMG/M |
| 3300028743|Ga0302262_10288002 | Not Available | 558 | Open in IMG/M |
| 3300028869|Ga0302263_10149678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300029984|Ga0311332_10078132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2366 | Open in IMG/M |
| 3300029984|Ga0311332_10341126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1154 | Open in IMG/M |
| 3300029987|Ga0311334_10259139 | Not Available | 1347 | Open in IMG/M |
| 3300029987|Ga0311334_11275017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
| 3300030000|Ga0311337_11265535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300030002|Ga0311350_10447723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100 | 1159 | Open in IMG/M |
| 3300030294|Ga0311349_10118735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2467 | Open in IMG/M |
| 3300030943|Ga0311366_10094848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2561 | Open in IMG/M |
| 3300030943|Ga0311366_10663370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
| 3300031232|Ga0302323_102911794 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031521|Ga0311364_10445527 | Not Available | 1312 | Open in IMG/M |
| 3300031521|Ga0311364_11193143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300031544|Ga0318534_10420433 | Not Available | 767 | Open in IMG/M |
| 3300031548|Ga0307408_100030096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3768 | Open in IMG/M |
| 3300031562|Ga0310886_10709955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 627 | Open in IMG/M |
| 3300031740|Ga0307468_101667938 | Not Available | 598 | Open in IMG/M |
| 3300031740|Ga0307468_102218676 | Not Available | 532 | Open in IMG/M |
| 3300031795|Ga0318557_10088014 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300031908|Ga0310900_11047144 | Not Available | 673 | Open in IMG/M |
| 3300031918|Ga0311367_11131511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 779 | Open in IMG/M |
| 3300031918|Ga0311367_11589818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300032180|Ga0307471_100608794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
| 3300032180|Ga0307471_101372559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300032180|Ga0307471_101709053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 783 | Open in IMG/M |
| 3300032180|Ga0307471_102819685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 617 | Open in IMG/M |
| 3300032205|Ga0307472_100515304 | Not Available | 1035 | Open in IMG/M |
| 3300032205|Ga0307472_100571894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 991 | Open in IMG/M |
| 3300032205|Ga0307472_100620997 | Not Available | 958 | Open in IMG/M |
| 3300032211|Ga0310896_10151206 | Not Available | 1100 | Open in IMG/M |
| 3300032342|Ga0315286_12120639 | Not Available | 519 | Open in IMG/M |
| 3300033004|Ga0335084_11424517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 687 | Open in IMG/M |
| 3300033412|Ga0310810_10018980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 8255 | Open in IMG/M |
| 3300033418|Ga0316625_100249753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1216 | Open in IMG/M |
| 3300033433|Ga0326726_11662926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
| 3300033433|Ga0326726_12380950 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300033487|Ga0316630_10630535 | Not Available | 899 | Open in IMG/M |
| 3300033803|Ga0314862_0004966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2147 | Open in IMG/M |
| 3300034176|Ga0364931_0284624 | Not Available | 547 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.25% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.35% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.45% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.45% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.45% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.45% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.45% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.45% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.45% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_02003790 | 2189573004 | Grass Soil | MGANANGWHGPTVKADDEAKTGCLREEDNAEGRPRTPVPFGLLQRA |
| JGI20214J51650_108370181 | 3300003541 | Wetland | MDANANGWLGAPIKAPDEAKTGRLREEGNDEWRPKPPVPFGL |
| Ga0055499_100930852 | 3300004047 | Natural And Restored Wetlands | MSACANGWHGAPIEAPDEAQTGRLREERNEEWRPRAPVPFGLLPK |
| Ga0062590_1004897411 | 3300004157 | Soil | MGANANGWPEAPIATADDAKTRSLGEESNKEWRLGAPVPF |
| Ga0066676_105596711 | 3300005186 | Soil | MDANANGRHGASIKAHDEAKTGRLREEGNAEWRPMMPVPFGLLPKTPIA |
| Ga0066675_109674081 | 3300005187 | Soil | MGANANGCAGAPIAAADEIKIGGLDEESNKEWRPRAAVRFGLLPQRVRVHSVQAL |
| Ga0068996_100661511 | 3300005218 | Natural And Restored Wetlands | MGANANGWHGAPIEAPDEVQTGRLREESNEEWRLRAPVPFGLLPKTLIAV |
| Ga0070676_101138602 | 3300005328 | Miscanthus Rhizosphere | MDASANGRYGLPIKADDEAKTGRLGKEDNAEWRPRSPVPFGLLPK |
| Ga0070683_1006185301 | 3300005329 | Corn Rhizosphere | MFTDANGRHGQPIKALDEAKTGCLCEESNAEWGPMPPVPCGL |
| Ga0066388_1040035592 | 3300005332 | Tropical Forest Soil | MGAYANERPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPFGLLPKTP |
| Ga0066388_1083304142 | 3300005332 | Tropical Forest Soil | MDANANGWHGAPIEALHLPTAAVQTGRLHKEGNEEWRPRAPVPFGLL |
| Ga0068869_1010123472 | 3300005334 | Miscanthus Rhizosphere | MSANANGWHGAPIKALDAAKTGCLRKECNAEWRPRAPVPFGLLPK |
| Ga0068869_1018330981 | 3300005334 | Miscanthus Rhizosphere | SRAAVHTMPTDADGWHEAPSRLDDAKTGRLREESNAERRARAPVPFRLPPK* |
| Ga0068868_1007505681 | 3300005338 | Miscanthus Rhizosphere | MFTNANGRHGPPIKALDEAKTGRLCEESNAEWRPMPPVPFGLL |
| Ga0070668_1000233406 | 3300005347 | Switchgrass Rhizosphere | MDANANGVPWGDNRGADEAKTGSLGEERNKEWRPTASVPFGLLPKTP |
| Ga0070668_1000659804 | 3300005347 | Switchgrass Rhizosphere | MSANANGWHGAPIEADDEAKTRCLREEDNAEWRPRAPVPFGLLPKTP |
| Ga0070675_1000503816 | 3300005354 | Miscanthus Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPF |
| Ga0070675_1019237281 | 3300005354 | Miscanthus Rhizosphere | MFANANGWHEAPIEARDEAQTGCLREECNEEWRFRAPVPFGLLPKWPFASLQSLARRPT* |
| Ga0070671_1007551361 | 3300005355 | Switchgrass Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLP |
| Ga0070674_1015707871 | 3300005356 | Miscanthus Rhizosphere | MGANANGWRGAPIEALDEAKTRCLGEECNEEWRPRPPVPFGLL |
| Ga0070673_1000227167 | 3300005364 | Switchgrass Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGL |
| Ga0070673_1002508563 | 3300005364 | Switchgrass Rhizosphere | MFTNANGRQGPPIKALDEAKTGRLCEESNAEWRPMPPVPFGLLRKRRCASLRK |
| Ga0070673_1007341272 | 3300005364 | Switchgrass Rhizosphere | MDANANGWHGAPIEAADEAKTERLREENNAEWSPMPPVPSGLLPKTPIAA |
| Ga0070659_1010099153 | 3300005366 | Corn Rhizosphere | ANGWHEAPIEARDEAQTGCLREECNEEWRFRAPVPFGLLPKWPFASLQSLARRPA* |
| Ga0070659_1013342702 | 3300005366 | Corn Rhizosphere | MFTNANGRHAPPIQALDEEKTGRLCEDSNAEWRRMPPAPFGLLRK |
| Ga0070667_1001546471 | 3300005367 | Switchgrass Rhizosphere | MGANANGWHGAPIEADDEAKTRCLREEDNAEWRPRAPVPFGLL |
| Ga0070703_102108191 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MGANANGRHGAPIAAADEAKTRSLGEESNKEWRPMPPVPFGLLPKTPSAAL |
| Ga0070701_105505181 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MDANANGWHGAPIAAADEAKTRSLGEESNKEWRPMPPVPFGLLPKTP |
| Ga0070705_1008724052 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGANANGWRGAPIEALDEAKTRCLGEECNEEWRPRPPVPFGL |
| Ga0070708_1008786351 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDANANRWHGAPIKAADEAKTGRLREENNAEWRPMPPVPFGLLPKTPIAALQ |
| Ga0066681_107731132 | 3300005451 | Soil | MPANANGWHGAPIKALDEAKTARLSEECNAEWRPMPPVPFGLPCNAFVDIV* |
| Ga0068867_1000299451 | 3300005459 | Miscanthus Rhizosphere | MDTNANGWDGAPIKATQLPNEEAETWRLREEGNAEWRPMPPVPFGLLPKTPSAAL |
| Ga0070698_1001870864 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDANANGRHGAPIKTHDEAKTGRLREEGNAEWRPMMSVPFGLLPKTPITALRSL |
| Ga0070698_1003702543 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDANANGRHGAPIKAHDDAKTGRLREEGNAEWRPMMPVPFGLLP |
| Ga0070679_1012710302 | 3300005530 | Corn Rhizosphere | MDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFRLPPK* |
| Ga0070672_1002443982 | 3300005543 | Miscanthus Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFG |
| Ga0066661_108899971 | 3300005554 | Soil | MDANANWRHGAPIKAPHLPNEEAKTGRLREEGNAEWRHMMPVPFGLLPKTPIAALR |
| Ga0066707_100347481 | 3300005556 | Soil | MGANANGWHGAPIAAAYLPNTEAKTSGLGKESNKEWRP |
| Ga0068857_1019815152 | 3300005577 | Corn Rhizosphere | MAAKANGGRGAPIKAPDEAKTVRLSEDGNDEWRPRGPVPFGLLRKWSCALLR |
| Ga0066706_101440021 | 3300005598 | Soil | MDANANGWHGAPIAAADEAKTSGLGEESNKEWRPMPPVPFG |
| Ga0068852_1000279556 | 3300005616 | Corn Rhizosphere | MATNANGRHGVPIKAPDEAKTARLSEDGNDEWHPMPPVPAGLQRKWHF |
| Ga0068864_1001518583 | 3300005618 | Switchgrass Rhizosphere | MGANANGWHGPPVKADDEAKTGRLREEDNAEGRPMPPVPFGLLP |
| Ga0066903_1061914142 | 3300005764 | Tropical Forest Soil | MGAYAKGCPRAPIKAQDEAKTRRLGEDGNTEWRPKAPVPFGLP |
| Ga0066903_1074129722 | 3300005764 | Tropical Forest Soil | MGAYANGCPGAPIKAPDEAKTSGLGEDGNTEWRPRTPVPFGLLPKTPIA |
| Ga0068863_1009718611 | 3300005841 | Switchgrass Rhizosphere | MDANANGWLQVPIKAADGETGRLRNENNAEWRLKLPAPV |
| Ga0073913_100191591 | 3300005940 | Sand | MDANANGWLGAPIKAPDEAKTGRLREEGNAEWRPKPPVPFGLLP |
| Ga0075028_1009086373 | 3300006050 | Watersheds | MGANANGWLGAPIKALDDAQTGCLREESNEEWRPKAPVPFGLLPKTPIAASR |
| Ga0075028_1009845021 | 3300006050 | Watersheds | MDANANGWHGAPIKAPHLPNEDAKTGCLREEGNAEWRP |
| Ga0075026_1000526001 | 3300006057 | Watersheds | MGANANGWLGAPIKALDEAQTGRLREESNEEWRPKAPVPFGLLPKTP |
| Ga0082029_14209891 | 3300006169 | Termite Nest | MFTNANGWHGPPIKADDEAKTGRLREEDNAEWRPRAPVPLGFL |
| Ga0068871_1015709202 | 3300006358 | Miscanthus Rhizosphere | MFANANGWRGAPIAAPDAVQTGRLHKEGNKEWRPRAPVPFGLLPK |
| Ga0068871_1023079061 | 3300006358 | Miscanthus Rhizosphere | MDANANGRLGVPIKALDEAKTGCLGEESNEEWDRKAPVPFGLLP |
| Ga0079222_100237873 | 3300006755 | Agricultural Soil | MDANANGQHGVPIKALDEAKTGCLCEESNAEWRVM |
| Ga0066665_101883091 | 3300006796 | Soil | MGANANGWHGAPIAAADEAKTSGLGEESNKEWRPR |
| Ga0079220_110463111 | 3300006806 | Agricultural Soil | MAANANGWHEAPIKADDEAKTARLRKEDNAEWRFRAAVPFGL |
| Ga0075425_1009118402 | 3300006854 | Populus Rhizosphere | GPVHAMGANANGWHGAPIAAADEAKTGGLGEEGNKEWRPRTPVPFGLLPSGATRLCP* |
| Ga0075429_1018610361 | 3300006880 | Populus Rhizosphere | MSANANAWHEAPIEARDEAQTGCLREECNEEWRFRAPVPFGLLPKWP |
| Ga0068865_1003019351 | 3300006881 | Miscanthus Rhizosphere | MDANANGWHGAPIKADDEAKTGRLREEDNAEWRPRPPVPSGLL |
| Ga0075426_103855802 | 3300006903 | Populus Rhizosphere | MDTNANRWHGPRIKADDEAKTGCLREEDNTEWWPRAPVPF |
| Ga0075424_1003014151 | 3300006904 | Populus Rhizosphere | MGANANGWHGAPIAAADDAKTGGLGEEGNKEWRPRAP |
| Ga0075424_1011352431 | 3300006904 | Populus Rhizosphere | MDANANGQHGVPIKALDEAKTGCLCEESNAEWRVMMPVPSGLRPKW |
| Ga0079219_119468843 | 3300006954 | Agricultural Soil | MGANANEWHGAPIKADDEAKTGRLGEEDNVEWRTMPLVPFGLLP |
| Ga0075435_1001928943 | 3300007076 | Populus Rhizosphere | MGANANGWHGAPIAAADEAKTGGLGEESNKEWRPR |
| Ga0075435_1009477262 | 3300007076 | Populus Rhizosphere | MDANANGWHGVPIKTADEAKTERLREENNAEWRAMPPVP |
| Ga0105250_105439701 | 3300009092 | Switchgrass Rhizosphere | MNANANGWHGAPIAAADEAKTRSLGEDSNKEWRPMPPVPFGL |
| Ga0105240_116803622 | 3300009093 | Corn Rhizosphere | MPASANGCHGAPIEALDEAKTGCLCEESNEEWRVKPPVPFGLLPKGPCASLRSLGGL |
| Ga0111539_103855253 | 3300009094 | Populus Rhizosphere | MDANANGWHGAPIEADDEAKTRCLREEDNAEWRPRAPVPFGLLPKTPIAALQ |
| Ga0111539_131372382 | 3300009094 | Populus Rhizosphere | MGANANGWRGAPIEALDEAKTRCLGEECNEEWRPRPPVPFGLLPKTPIAAL |
| Ga0075418_118287521 | 3300009100 | Populus Rhizosphere | MDANANGWHAAPIKADDEVKTRCLHEEDNAEWGRRVPVP |
| Ga0105247_100702314 | 3300009101 | Switchgrass Rhizosphere | MDANANGWHGAPIKADDEAKTRCLREEDNAEWRPRA |
| Ga0105248_106872191 | 3300009177 | Switchgrass Rhizosphere | MDANANGRHGPPIKADDEAKTGRLREENNAEWHRRAPVPFGL |
| Ga0126374_104467561 | 3300009792 | Tropical Forest Soil | MGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPR |
| Ga0134063_102428792 | 3300010335 | Grasslands Soil | MGANANGCAGAPIAAADEIKTGGLDEESNKEWRPRAAVRFGLLPQ |
| Ga0126372_107886101 | 3300010360 | Tropical Forest Soil | MGAYANGCPGAPIKAPDEAKTSGLGEDGNTEWRPRTPV |
| Ga0126372_121018112 | 3300010360 | Tropical Forest Soil | MGAYANGCPGAPIKAQDEAKTCGLGEDGNTEWRPRTPVPFGLLP |
| Ga0126379_109504571 | 3300010366 | Tropical Forest Soil | MGAYANERPGAPIKAQDEAKTSGLGEDGNTEWRPR |
| Ga0134122_112997462 | 3300010400 | Terrestrial Soil | MGANANGRPGAPIATADDAKTRGLGEESNKEWRPR |
| Ga0134121_102774053 | 3300010401 | Terrestrial Soil | MSANANGWHGAPIKALDEVQTGRLHKESNAEWRPRAPVPFGLLPKKPC |
| Ga0134123_107820763 | 3300010403 | Terrestrial Soil | MSANANGWHGPPIKADDEAKTGRLREEDNAEWRPRAPVPFGLLPK |
| Ga0116241_109457242 | 3300010429 | Anaerobic Digestor Sludge | MDANANGWFGAPIKAPDEAKTGRLREEGNAEWRPKPPVPFGLLPKTPGAALRSL |
| Ga0137364_110701742 | 3300012198 | Vadose Zone Soil | MDANANGWHGAPIAAAHLTNKEAETSGQGEESNKEWRPKP |
| Ga0137399_111515581 | 3300012203 | Vadose Zone Soil | MSASANEWHGAPIEALDEAKTGRLCEESNEEWHPRTPVPFGLLPCNARVDI |
| Ga0137370_105450781 | 3300012285 | Vadose Zone Soil | MGAPIKTPILKKSEAKTGRLGEERNAEWRPMPPVPFGLLRKWLCA |
| Ga0137375_107017832 | 3300012360 | Vadose Zone Soil | MNANANGWHGAPIKALDEAKTGRLREESNAEWRPRPPVPFGLLPK |
| Ga0157356_10046012 | 3300012474 | Unplanted Soil | MDANASGRQGAPIKAPDDAKTGRLGEEGNEEWRSMPPVPFGLPP |
| Ga0136630_12899941 | 3300012529 | Polar Desert Sand | MDANANGWPGAPIAAADEAKTCALGEESNKEWRPRAPVPFGLLPKTLIA |
| Ga0157289_104117501 | 3300012903 | Soil | MDANANGWDGAPIKATDEAKTGRLREEGNAEWRPIPPVPFG |
| Ga0164300_107480181 | 3300012951 | Soil | MSANANAWHEAPIEARDEAQTGCLREECNEEWRFRAAVPFGLLPKWPFASLQS |
| Ga0164303_101624171 | 3300012957 | Soil | MDANANGWHGAPIKAADKAKTERLREENNAEWRPMPPVPSGLLPETHIAA |
| Ga0164303_108934811 | 3300012957 | Soil | MDASANGWHGAQIKALDEAKTGCLCKESDAEGRAKAPVPFGLLPKWPCALLQSLA |
| Ga0164299_103317712 | 3300012958 | Soil | MDANANGWHGAPIKAADEAKTERLREENNAEWRPMPA |
| Ga0164304_113845511 | 3300012986 | Soil | MDANANGQHGVPVKALDEAKTGCLCEESNAEWRVMMPVPSG |
| Ga0164307_114765581 | 3300012987 | Soil | MDANANVWDGAPIKAADEAKTGRLRAENNAEWRPMPHVPSGL |
| Ga0164306_106624971 | 3300012988 | Soil | MDANANVWDGAPIKAADEAKTGCLRDENNAEWCAMPHVPSGLLPKTPITAL |
| Ga0164305_103528763 | 3300012989 | Soil | MDVNANVWDGAPIKAADEAKTGRLREENNAEWRPMPHVPSGLLPK |
| Ga0157373_113011292 | 3300013100 | Corn Rhizosphere | MDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFGLLPK* |
| Ga0157374_100311454 | 3300013296 | Miscanthus Rhizosphere | MDANANGWHGAPIKAADEAKTERLREENNAEWRPTAHVPFGLLP |
| Ga0157372_112317601 | 3300013307 | Corn Rhizosphere | MAAKANGRHEAPIKAPDEAKTWRRSEGGNDEWRSR |
| Ga0157375_100246179 | 3300013308 | Miscanthus Rhizosphere | MGANANGWHGPPVKADDEAKTGRLREEDNAEGRPMPPVPF |
| Ga0157375_101528913 | 3300013308 | Miscanthus Rhizosphere | MDANANGWHGVPIKTADEAKTERLRKENNAEWRAMPPVPSGLLPK |
| Ga0075345_10688402 | 3300014312 | Natural And Restored Wetlands | MNTIANERHRAPIAAADDAKAGSLCEERNKEWRPMPLVPFGL |
| Ga0163163_109106091 | 3300014325 | Switchgrass Rhizosphere | MDAIANGWPGAPIATADEAKTGGLGEESNKEWRPRAPVPFG |
| Ga0157380_100307134 | 3300014326 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPSVPFGLLPK |
| Ga0157377_108162891 | 3300014745 | Miscanthus Rhizosphere | MDANANGRHGAPIKATDEAKTGCLREEGNAEWRPMPPIPFGLLPKTPSAAL |
| Ga0157376_114946751 | 3300014969 | Miscanthus Rhizosphere | MDANANGRIGVPIKTLDEAKTGRLSEESNEEWHPKAPVPFGLQPRN |
| Ga0132258_1002368914 | 3300015371 | Arabidopsis Rhizosphere | MDANANGWHGPPIKADDEAKTGRLRKEDNAEWRPRTPVPFGLLPKTPIAALQ |
| Ga0132258_103820065 | 3300015371 | Arabidopsis Rhizosphere | MGVNANGWHGAPIAAADDAKTRGLGEESNKEWRPRTPVPF |
| Ga0132258_108630073 | 3300015371 | Arabidopsis Rhizosphere | MDANANGQHGVPIKALDESKTGYLCEESYAEWRVRMPVPFGLLPKWPC |
| Ga0132258_113792671 | 3300015371 | Arabidopsis Rhizosphere | MGAYANERLGVPIATADEAKTSGLGEESNKEWRPRPRVPFGLLPKTPIAA |
| Ga0132258_139300412 | 3300015371 | Arabidopsis Rhizosphere | MGANANERPGAPIAAADEAKTGGLGEESNKEWRPR |
| Ga0132257_1017047152 | 3300015373 | Arabidopsis Rhizosphere | MDANANGWHGPPIKADDEAKTGRLRKEDNEEWRPRTPVPFGLLPKTPIAALQ |
| Ga0132255_1014616331 | 3300015374 | Arabidopsis Rhizosphere | MDANANRWHGPPIKADDEAKTERLREKDNTEWRPRSPVPFGLLLKTPI |
| Ga0132255_1028067201 | 3300015374 | Arabidopsis Rhizosphere | MGAYANEWHGAPIATADDTKTSSLGEESNKEWRPRAPVPFGLLPKTP |
| Ga0132255_1033283821 | 3300015374 | Arabidopsis Rhizosphere | MDANANEWHGAPIVAADDAKTGGLGEESNKEWRPRALVPFGLLPKTPI |
| Ga0136617_100755591 | 3300017789 | Polar Desert Sand | MDANANGCPGAPIAAADEAKTSGLGEESNKEWRPRAPVPF |
| Ga0163161_104006151 | 3300017792 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLL |
| Ga0163161_110204352 | 3300017792 | Switchgrass Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLL |
| Ga0187779_100226921 | 3300017959 | Tropical Peatland | MGAYANGRPGAPIKAQDEAKTSGLGEDGNTEWRPRT |
| Ga0187779_100279751 | 3300017959 | Tropical Peatland | MGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPFGLLPKTPI |
| Ga0187779_105651282 | 3300017959 | Tropical Peatland | MGAYANGCPGAPIKAQDEAKTRGLGEDGNTEWRPRTPVPFGLLP |
| Ga0187778_100081131 | 3300017961 | Tropical Peatland | MRANANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPFGLLP |
| Ga0187778_102706521 | 3300017961 | Tropical Peatland | MGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPF |
| Ga0187776_100018241 | 3300017966 | Tropical Peatland | MGADANGRRWVPIKAADEAKTGGLGEESNKEWRPTAPVPS |
| Ga0187780_102457131 | 3300017973 | Tropical Peatland | MGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPV |
| Ga0187767_100998762 | 3300017999 | Tropical Peatland | MGAYANGCPGAPIKAQDEAKTGGLGEDGNTEWRPRTPV |
| Ga0184621_103400181 | 3300018054 | Groundwater Sediment | MDANANGWHGAPIAAADAAKTSSLGEESNKEWRPMPPVPFGLL |
| Ga0184623_101810471 | 3300018056 | Groundwater Sediment | MDANANGWHGAPIAAAQLANPEAKTESLGEESNKEWRPRPPVPFGLLPKTPIA |
| Ga0187765_103215201 | 3300018060 | Tropical Peatland | MDAYANGWHGPPIEADDEAKTGRLREEDNAEWRPKAPVPF |
| Ga0187773_100181691 | 3300018064 | Tropical Peatland | MGADANGRRWVPIKAADEAKTGGLGEESNKEWRPTAP |
| Ga0187773_102903401 | 3300018064 | Tropical Peatland | MGADANGRRWVPIKAADEAKTGGLGEESNKEWRPTAPVPFGLLPKTPIAA |
| Ga0184612_103473612 | 3300018078 | Groundwater Sediment | MNANANGWHGAPIKAPDEAKTGRLREESNAEWRSMMPVPFGLLPK |
| Ga0184625_105657302 | 3300018081 | Groundwater Sediment | MDTNANGWHGVPIAAADEAKTRSLGKESNKEWHPRAPVPFGLLPKTPV |
| Ga0207673_10211011 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MDANANGWHGAPIEAADEAKTERLREENNAEWSPMPPVPSGLLPKTPIAALQ |
| Ga0207697_101039921 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MGANANGWHGPPGKADDVAKTGRLREEDNAEGRPMPTVPFGLLA |
| Ga0208851_10356692 | 3300025461 | Arctic Peat Soil | MNAIANGWHGAPIAAAQLANEDAKTGGLGEKSNKEW |
| Ga0207682_104622111 | 3300025893 | Miscanthus Rhizosphere | MGAIANGRPGAPIATADEAKTGGLGEESNNEWRPRAPVPFGL |
| Ga0207699_105870562 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDANANGQHGVPIKALDEAKTGCLCEESNAEWRVMM |
| Ga0207705_112106262 | 3300025909 | Corn Rhizosphere | MAAKANGRHEAPIKAPDEAKTVRLSEDGNDEWRSRGPVPSGLLR |
| Ga0207660_110941191 | 3300025917 | Corn Rhizosphere | MGANANQWHGPPIKADDEAKTGRFREEDNAKWRPRTLVPSGLPPKTLG |
| Ga0207649_114683512 | 3300025920 | Corn Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLPKTLSAALQSL |
| Ga0207681_100850911 | 3300025923 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDVAKTGRLRKEDNAEGRPMPTVPFGLLPKTLSAP |
| Ga0207659_100215991 | 3300025926 | Miscanthus Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGL |
| Ga0207644_106182131 | 3300025931 | Switchgrass Rhizosphere | MGTNAKGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLP |
| Ga0207709_112518742 | 3300025935 | Miscanthus Rhizosphere | MDANANGWHGAPIAAADEAKARSLCEESNKEWRPMPPVPFGLLPKTP |
| Ga0207670_113208543 | 3300025936 | Switchgrass Rhizosphere | MSANANGWHGPPIKADDEAKTGRLREEDNAEWRTRAP |
| Ga0207669_103682721 | 3300025937 | Miscanthus Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPM |
| Ga0207669_110461031 | 3300025937 | Miscanthus Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLPKTLSA |
| Ga0207704_100506071 | 3300025938 | Miscanthus Rhizosphere | MDTNANGWDGAPIKATQLPNEEAETWRLREEGNAEWRPMPPGPFGLLPKTPS |
| Ga0207704_117878712 | 3300025938 | Miscanthus Rhizosphere | MDASANGRYGLPIKADDEAKTGRLGKEDNAEWRPRS |
| Ga0207691_100076031 | 3300025940 | Miscanthus Rhizosphere | MGANANGWHGPPGKADDVAKTGRLRKEDNAEGRPMPTVPFGLLPKTLSA |
| Ga0207691_102533532 | 3300025940 | Miscanthus Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPM |
| Ga0207691_115042862 | 3300025940 | Miscanthus Rhizosphere | MAAKANGRHEAPIKAPDEAKTVRLSEDGNDEWRSRG |
| Ga0207711_107450841 | 3300025941 | Switchgrass Rhizosphere | MDANANGWHGAPIKADDEAKTRCLREEDNAEWRPR |
| Ga0207679_114824391 | 3300025945 | Corn Rhizosphere | MDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFGLLPKW |
| Ga0207679_117140702 | 3300025945 | Corn Rhizosphere | MGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPR |
| Ga0207651_106907913 | 3300025960 | Switchgrass Rhizosphere | MDANANGWHGAPIKADDEAKTRCLREEDNAEWRPRAPVPFGLL |
| Ga0207651_110578622 | 3300025960 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDVAKTGRLRTEDNAEGRPMPPVPFGLLPKTLS |
| Ga0207651_115331202 | 3300025960 | Switchgrass Rhizosphere | MDTNANEWHGAAIAAADDAKTGGLGEECNKEWCPRAIVPFGLL |
| Ga0207712_108385791 | 3300025961 | Switchgrass Rhizosphere | MDANANGWDGAPIKATDEAKTGRLREEGNAEWRPIP |
| Ga0207668_100606851 | 3300025972 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPP |
| Ga0207668_107775871 | 3300025972 | Switchgrass Rhizosphere | MGANANRWSEAPIKAADEAKTERLREENNAGWRLRPPVPSGLLPKTPSA |
| Ga0207640_106582941 | 3300025981 | Corn Rhizosphere | MDANANGWHGAPIKAADEAKTARLREENNAEWRPMP |
| Ga0207658_108529261 | 3300025986 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMP |
| Ga0207658_118247001 | 3300025986 | Switchgrass Rhizosphere | MDANANGWHGAPIKALDEAKTGRLCKESNAEWCAKTPVPF |
| Ga0207702_101728001 | 3300026078 | Corn Rhizosphere | MDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFRLPPK |
| Ga0207702_109251371 | 3300026078 | Corn Rhizosphere | MDANANGQHGVPIKALDEAKTGCLCEESNAEWRVMMPVPSGLRPKWPFAS |
| Ga0207648_115110522 | 3300026089 | Miscanthus Rhizosphere | MGANANGRGGVPIAAADDAKTGGLGEESNKEWHAARPVPLGLLPKT |
| Ga0207676_116158682 | 3300026095 | Switchgrass Rhizosphere | MGANANRWSEAPIKAADEAKTERLSEENNAGWRLRP |
| Ga0207683_118642581 | 3300026121 | Miscanthus Rhizosphere | MGANANRWPEAPIKAADEAKTERLREEDNAEWRLRPPVPSGLLP |
| Ga0207698_121296922 | 3300026142 | Corn Rhizosphere | MGTNANGWRGAPIKAADEAKTERLREENNAEWRPM |
| Ga0209474_105636042 | 3300026550 | Soil | MPANANGWHGAPIKALDEAKTARLSEECNAEWRPMPPVPFGLP |
| Ga0209073_100380801 | 3300027765 | Agricultural Soil | MDANANGQHGVPIKALDEAKTGCLCEERNAEWRVML |
| Ga0209073_104689341 | 3300027765 | Agricultural Soil | MSIDANGWHGAPIEALDEAQTGRLREESNEEWRARAPVPFGLLPKWPCASLQSLARRP |
| Ga0209262_105943982 | 3300027841 | Freshwater | MDANANGWLGAPIKAPDEAKTGHLREEGNDEWRPKPP |
| Ga0209496_100263611 | 3300027890 | Wetland | MDANANGWIGAPIKAPDEAKTGRLREEGNDEWRPKPP |
| Ga0209048_100098871 | 3300027902 | Freshwater Lake Sediment | MDANANGQHGTPIKAPDEAKTGCLREEGNAEWRPRMPVPFGLLP |
| Ga0268265_109164081 | 3300028380 | Switchgrass Rhizosphere | MGANANRWSEAPIKAADEAKTERLSEENNAGWRLRPPVPS |
| Ga0268265_113955961 | 3300028380 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDVAKTGRLRKEDNAEGRPMPTVPFGLL |
| Ga0268264_112543572 | 3300028381 | Switchgrass Rhizosphere | MAANANGRNEAAIKAHDEAKTGRLGEECNEEWRLSAPVPFGLLPKTRIAALQR |
| Ga0268264_122841072 | 3300028381 | Switchgrass Rhizosphere | MGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPSVPFGL |
| Ga0302169_100550821 | 3300028679 | Fen | MGANANGWHGAPIAAAQLANEEAKTGGLSEDSNKEWRPRTPVPF |
| Ga0302205_101206341 | 3300028739 | Fen | MNAIANGWHGAPIAAADEAKTGSLCEESNKEWRPMPPVPFAQLGQ |
| Ga0302262_102880021 | 3300028743 | Fen | MGAYANGRHGAPIAAADEAKTGGLGEESNKEWRPMASVPFGLLPKTPI |
| Ga0302263_101496781 | 3300028869 | Fen | MGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRASVPFAQLGQLRPKT |
| Ga0311332_100781321 | 3300029984 | Fen | MGANANGWHGAPIAAAQLANEEAKTSGLGEDSNKEWRPRTPV |
| Ga0311332_103411261 | 3300029984 | Fen | MNAIANGWHGAPIAAADEAKTGSLCEESNKEWRPMPPVPFGLL |
| Ga0311334_102591391 | 3300029987 | Fen | MDADANGWPVVPIATADEAKTSGLGEESNKEWRPWPPVP |
| Ga0311334_112750172 | 3300029987 | Fen | MSACANGCHGVPIKALDEAQTGRLREECNAEWRPRAPVPFGLLPKGSCA |
| Ga0311337_112655351 | 3300030000 | Fen | MGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRTP |
| Ga0311350_104477231 | 3300030002 | Fen | MGANANGWHGAAIAAAQLANDEAKTGGLGEKSNKEWRPRTPVPFGLL |
| Ga0311349_101187351 | 3300030294 | Fen | MGANANGWHGAPIAAADEAKTGGLGEDRNKEWRPRTPVPFGLLPK |
| Ga0311366_100948481 | 3300030943 | Fen | MGANANGWHGAPIAAAQLANEEAKTSGLGEDSNKEWRPRTP |
| Ga0311366_106633701 | 3300030943 | Fen | MGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRTPVPFGLLPKTPIAALR |
| Ga0302323_1029117941 | 3300031232 | Fen | MGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRT |
| Ga0311364_104455272 | 3300031521 | Fen | MNAIANGWHGAPIAAADEAKTGGLCEESNKEWRPMPPVPFGL |
| Ga0311364_111931432 | 3300031521 | Fen | MNAIANGWHGAPIAAADEAKIGGLGEESNKEWRPMPPVPFGLLPKTPIATLRR |
| Ga0318534_104204332 | 3300031544 | Soil | MGANANGHNEAPIKVQDEAKTGRLGDECNEEWRLIASVPFGLLPKTPI |
| Ga0307408_1000300966 | 3300031548 | Rhizosphere | MDANANGWHGAPIKELDEAKTGRLCEESNDEWRAGTPVPFGLLP |
| Ga0310886_107099551 | 3300031562 | Soil | MSAYANGCLGPPIKAADEAKTGCLREENNAEWRPKAPVPFGLLPKMPIA |
| Ga0307468_1016679382 | 3300031740 | Hardwood Forest Soil | MGANANGWPEAPIATADEAKTRGLGEESNKEWRLGAPVPFGLLPKAPIA |
| Ga0307468_1022186761 | 3300031740 | Hardwood Forest Soil | MAANASGWLGMPIEAPDEAKTGRLGEKGNEEWRPKQAAPFGLL |
| Ga0318557_100880143 | 3300031795 | Soil | MGASANGRNEAPIKAHDEAKTGRLGEECNEEWRLSAPIPFGLLPKTRIAALR |
| Ga0310900_110471442 | 3300031908 | Soil | MDANANGRDGAPIKATQLPNEEAKTGRLREEGNAEWRPMPSVPF |
| Ga0311367_111315112 | 3300031918 | Fen | MDADANGWPVVPIATADEAKTSGLGEESNKEWRPW |
| Ga0311367_115898182 | 3300031918 | Fen | MGANANGWHGAPIAAADEAKTGGLGEESTKEWRPRTPVPFG |
| Ga0307471_1006087941 | 3300032180 | Hardwood Forest Soil | MGTYANGCPGAPIKAQDEAKTGGLGEDGNAEWRPRTPVPFGLLSKTPIA |
| Ga0307471_1013725592 | 3300032180 | Hardwood Forest Soil | MDASANVRHGAPIKALDDAKTGRLGKESNAEWRPMMPVP |
| Ga0307471_1017090532 | 3300032180 | Hardwood Forest Soil | MGANANGWPGAPIAAADEAKTSGLGEERNKEWRPRAPVPFGL |
| Ga0307471_1028196852 | 3300032180 | Hardwood Forest Soil | MGANANGRRGPPIKANDEAKTGRLREEDNAEWRPKAPVPFG |
| Ga0307472_1005153041 | 3300032205 | Hardwood Forest Soil | RLGAPIKAQDEAKTGGLGEGGNAEWRPRTPVPFGLRLCP |
| Ga0307472_1005718942 | 3300032205 | Hardwood Forest Soil | MGAYANGRPGAPIKAQDEAKTRGLGEDGNAEWRPKTPVPFGLLP |
| Ga0307472_1006209971 | 3300032205 | Hardwood Forest Soil | MGANANGRHGPTVKADDDAKTGRLREQDNAEGRPMPPVPFGLLPKTLLCP |
| Ga0310896_101512063 | 3300032211 | Soil | MFTNANRRYGPPIKALDEAKTGRLCEESNAEWRPMLPV |
| Ga0315286_121206391 | 3300032342 | Sediment | MSTSANGWHGAPIKALDEAETGCLGEESNAEWRPRAPVPFGL |
| Ga0335084_114245171 | 3300033004 | Soil | MDANANAWHGPPDKAHDEAKTGRLREEDNAVGRPMPPVPFGLLPKTLSTVL |
| Ga0310810_100189808 | 3300033412 | Soil | MDANANGWHGAPIKALDEAKTGRLGEESNAEWRFRAPVPFRLPPK |
| Ga0316625_1002497531 | 3300033418 | Soil | MDTNANGWLGAPIKAPDEAKTGRLREEGNAEWRPKPPVPFGLLPKTPG |
| Ga0326726_116629261 | 3300033433 | Peat Soil | MDASANGRHGAPIKADDEAKTGRLREEDNTEWRPRAPVPFGLLPKTPIAAL |
| Ga0326726_123809502 | 3300033433 | Peat Soil | MGTNANGWHGPSLKADDKAKTGRLREEDNAEGGLMSPFPFGLLPKT |
| Ga0316630_106305351 | 3300033487 | Soil | MPTNANGWAGAPIKARDEAKTGRLGEERNAEWRPGAPV |
| Ga0314862_0004966_1_123 | 3300033803 | Peatland | MDAYANVRPGAPIKAQDEAKTSGLGEDGNTEWRPRTHVPYG |
| Ga0364931_0284624_2_142 | 3300034176 | Sediment | MDANANGWAGAPTAAADDAKTGGLGEESNKEWRPRAPVPFAQLCQLR |
| ⦗Top⦘ |