


| Basic Information | |
|---|---|
| Family ID | F020736 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 222 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PWSGTRRYRRVQQPMLEEVCAENNQHLFDYHIPVANKPDF |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.79 % |
| % of genes near scaffold ends (potentially truncated) | 91.89 % |
| % of genes from short scaffolds (< 2000 bps) | 89.19 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.982 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.369 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.730 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.757 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 0.00% Coil/Unstructured: 95.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF03069 | FmdA_AmdA | 3.60 |
| PF13531 | SBP_bac_11 | 2.25 |
| PF13412 | HTH_24 | 1.80 |
| PF00152 | tRNA-synt_2 | 1.80 |
| PF04255 | DUF433 | 1.35 |
| PF00496 | SBP_bac_5 | 1.35 |
| PF13360 | PQQ_2 | 1.35 |
| PF00753 | Lactamase_B | 1.35 |
| PF01979 | Amidohydro_1 | 0.90 |
| PF00034 | Cytochrom_C | 0.90 |
| PF09864 | MliC | 0.90 |
| PF00903 | Glyoxalase | 0.90 |
| PF01042 | Ribonuc_L-PSP | 0.90 |
| PF01546 | Peptidase_M20 | 0.90 |
| PF00890 | FAD_binding_2 | 0.90 |
| PF04909 | Amidohydro_2 | 0.90 |
| PF06863 | DUF1254 | 0.90 |
| PF04185 | Phosphoesterase | 0.90 |
| PF00561 | Abhydrolase_1 | 0.90 |
| PF03401 | TctC | 0.45 |
| PF00550 | PP-binding | 0.45 |
| PF08238 | Sel1 | 0.45 |
| PF01557 | FAA_hydrolase | 0.45 |
| PF00912 | Transgly | 0.45 |
| PF01343 | Peptidase_S49 | 0.45 |
| PF00583 | Acetyltransf_1 | 0.45 |
| PF05598 | DUF772 | 0.45 |
| PF06707 | DUF1194 | 0.45 |
| PF01522 | Polysacc_deac_1 | 0.45 |
| PF13545 | HTH_Crp_2 | 0.45 |
| PF01656 | CbiA | 0.45 |
| PF00255 | GSHPx | 0.45 |
| PF07992 | Pyr_redox_2 | 0.45 |
| PF01627 | Hpt | 0.45 |
| PF13620 | CarboxypepD_reg | 0.45 |
| PF01494 | FAD_binding_3 | 0.45 |
| PF12686 | DUF3800 | 0.45 |
| PF13714 | PEP_mutase | 0.45 |
| PF12706 | Lactamase_B_2 | 0.45 |
| PF00005 | ABC_tran | 0.45 |
| PF00528 | BPD_transp_1 | 0.45 |
| PF01135 | PCMT | 0.45 |
| PF13614 | AAA_31 | 0.45 |
| PF13808 | DDE_Tnp_1_assoc | 0.45 |
| PF06577 | EipA | 0.45 |
| PF01894 | UPF0047 | 0.45 |
| PF01799 | Fer2_2 | 0.45 |
| PF12681 | Glyoxalase_2 | 0.45 |
| PF11392 | DUF2877 | 0.45 |
| PF13358 | DDE_3 | 0.45 |
| PF02738 | MoCoBD_1 | 0.45 |
| PF08241 | Methyltransf_11 | 0.45 |
| PF07883 | Cupin_2 | 0.45 |
| PF07690 | MFS_1 | 0.45 |
| PF02416 | TatA_B_E | 0.45 |
| PF04205 | FMN_bind | 0.45 |
| PF04014 | MazE_antitoxin | 0.45 |
| PF03747 | ADP_ribosyl_GH | 0.45 |
| PF01663 | Phosphodiest | 0.45 |
| PF03928 | HbpS-like | 0.45 |
| PF13193 | AMP-binding_C | 0.45 |
| PF00112 | Peptidase_C1 | 0.45 |
| PF03466 | LysR_substrate | 0.45 |
| PF01464 | SLT | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 3.60 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.35 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.90 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.90 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.90 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.45 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.45 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.45 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.45 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.45 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.45 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.45 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.45 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.98 % |
| Unclassified | root | N/A | 18.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001850|RCM37_1380887 | Not Available | 557 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101072415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101726218 | Not Available | 525 | Open in IMG/M |
| 3300004633|Ga0066395_10001555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8044 | Open in IMG/M |
| 3300004635|Ga0062388_100862035 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005332|Ga0066388_101233804 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300005332|Ga0066388_104367948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. P52-10 | 720 | Open in IMG/M |
| 3300005436|Ga0070713_100550054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1093 | Open in IMG/M |
| 3300005542|Ga0070732_10443023 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005554|Ga0066661_10458885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300005569|Ga0066705_10298266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK | 1021 | Open in IMG/M |
| 3300005569|Ga0066705_10802479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 561 | Open in IMG/M |
| 3300005576|Ga0066708_10541497 | Not Available | 750 | Open in IMG/M |
| 3300005607|Ga0070740_10258157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 709 | Open in IMG/M |
| 3300005713|Ga0066905_101655050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005764|Ga0066903_100001661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16612 | Open in IMG/M |
| 3300005764|Ga0066903_102135009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1079 | Open in IMG/M |
| 3300005764|Ga0066903_102157472 | Not Available | 1073 | Open in IMG/M |
| 3300005764|Ga0066903_104121235 | Not Available | 778 | Open in IMG/M |
| 3300005764|Ga0066903_105222193 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 687 | Open in IMG/M |
| 3300005764|Ga0066903_107555159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 560 | Open in IMG/M |
| 3300006034|Ga0066656_10829439 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006052|Ga0075029_100365436 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300006086|Ga0075019_10064502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2076 | Open in IMG/M |
| 3300006176|Ga0070765_101826581 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006176|Ga0070765_102153801 | Not Available | 520 | Open in IMG/M |
| 3300006800|Ga0066660_10903287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 719 | Open in IMG/M |
| 3300006871|Ga0075434_100135428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2482 | Open in IMG/M |
| 3300007788|Ga0099795_10058553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300009038|Ga0099829_10856903 | Not Available | 754 | Open in IMG/M |
| 3300009038|Ga0099829_11387222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300009090|Ga0099827_10203097 | Not Available | 1649 | Open in IMG/M |
| 3300009090|Ga0099827_10220263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1585 | Open in IMG/M |
| 3300009137|Ga0066709_100709181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1448 | Open in IMG/M |
| 3300009143|Ga0099792_10366330 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300009143|Ga0099792_10548952 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300009167|Ga0113563_13974264 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009523|Ga0116221_1099935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300009524|Ga0116225_1404580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300009525|Ga0116220_10387569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300009824|Ga0116219_10398973 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010043|Ga0126380_10285091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
| 3300010043|Ga0126380_11344859 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010046|Ga0126384_10642928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 934 | Open in IMG/M |
| 3300010048|Ga0126373_12582056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300010162|Ga0131853_10832290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300010343|Ga0074044_10415351 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010358|Ga0126370_11825977 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010359|Ga0126376_10594741 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300010359|Ga0126376_11056248 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300010359|Ga0126376_12231993 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010360|Ga0126372_10162542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1804 | Open in IMG/M |
| 3300010360|Ga0126372_10265481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1484 | Open in IMG/M |
| 3300010360|Ga0126372_10609839 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300010360|Ga0126372_10682667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1000 | Open in IMG/M |
| 3300010360|Ga0126372_11125403 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300010362|Ga0126377_10772700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
| 3300010362|Ga0126377_11102611 | Not Available | 862 | Open in IMG/M |
| 3300010362|Ga0126377_11788672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 690 | Open in IMG/M |
| 3300010362|Ga0126377_13259030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300010366|Ga0126379_10548214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1235 | Open in IMG/M |
| 3300010366|Ga0126379_12501770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 615 | Open in IMG/M |
| 3300010366|Ga0126379_12850464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 578 | Open in IMG/M |
| 3300010366|Ga0126379_13741820 | Not Available | 510 | Open in IMG/M |
| 3300010376|Ga0126381_102093266 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010376|Ga0126381_102272902 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300010379|Ga0136449_101444133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300010379|Ga0136449_103559455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300010398|Ga0126383_12809403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 569 | Open in IMG/M |
| 3300010880|Ga0126350_10753319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300011270|Ga0137391_11389798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300011271|Ga0137393_11241125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 632 | Open in IMG/M |
| 3300011443|Ga0137457_1194820 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012096|Ga0137389_10481182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1064 | Open in IMG/M |
| 3300012096|Ga0137389_10906181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 757 | Open in IMG/M |
| 3300012096|Ga0137389_10981403 | Not Available | 724 | Open in IMG/M |
| 3300012202|Ga0137363_10075190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2499 | Open in IMG/M |
| 3300012205|Ga0137362_10149143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1998 | Open in IMG/M |
| 3300012205|Ga0137362_11434549 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012211|Ga0137377_10395064 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300012212|Ga0150985_111143547 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012350|Ga0137372_10697463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 735 | Open in IMG/M |
| 3300012361|Ga0137360_10034689 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300012361|Ga0137360_10826326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli | 798 | Open in IMG/M |
| 3300012362|Ga0137361_11374243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 630 | Open in IMG/M |
| 3300012363|Ga0137390_11225338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300012469|Ga0150984_118234123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
| 3300012683|Ga0137398_10090901 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300012685|Ga0137397_10365610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1075 | Open in IMG/M |
| 3300012925|Ga0137419_11503274 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012927|Ga0137416_10899962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 787 | Open in IMG/M |
| 3300012927|Ga0137416_11048732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8 | 730 | Open in IMG/M |
| 3300012930|Ga0137407_12323206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300012931|Ga0153915_11260115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 864 | Open in IMG/M |
| 3300012944|Ga0137410_11404257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 607 | Open in IMG/M |
| 3300012944|Ga0137410_11894314 | Not Available | 528 | Open in IMG/M |
| 3300012948|Ga0126375_11073945 | Not Available | 661 | Open in IMG/M |
| 3300012971|Ga0126369_10610070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1162 | Open in IMG/M |
| 3300012971|Ga0126369_11071180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300012971|Ga0126369_11098573 | Not Available | 884 | Open in IMG/M |
| 3300012971|Ga0126369_12170697 | Not Available | 643 | Open in IMG/M |
| 3300012971|Ga0126369_12243005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300012971|Ga0126369_12893751 | Not Available | 562 | Open in IMG/M |
| 3300013503|Ga0120127_10118690 | Not Available | 608 | Open in IMG/M |
| 3300014199|Ga0181535_10654515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 600 | Open in IMG/M |
| 3300014489|Ga0182018_10740014 | Not Available | 511 | Open in IMG/M |
| 3300015245|Ga0137409_10058970 | All Organisms → cellular organisms → Bacteria | 3618 | Open in IMG/M |
| 3300015245|Ga0137409_11173168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 608 | Open in IMG/M |
| 3300015264|Ga0137403_10119900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → Rhizomicrobium electricum | 2623 | Open in IMG/M |
| 3300015371|Ga0132258_10810801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2360 | Open in IMG/M |
| 3300016319|Ga0182033_11321398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 648 | Open in IMG/M |
| 3300016341|Ga0182035_10566604 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300016341|Ga0182035_11409603 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300016341|Ga0182035_12123190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 510 | Open in IMG/M |
| 3300016371|Ga0182034_11217862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300016371|Ga0182034_11620033 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300016387|Ga0182040_10402683 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300016404|Ga0182037_10192416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1575 | Open in IMG/M |
| 3300017943|Ga0187819_10141266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1435 | Open in IMG/M |
| 3300017970|Ga0187783_11020827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 596 | Open in IMG/M |
| 3300017972|Ga0187781_10081794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300017972|Ga0187781_10193206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300017975|Ga0187782_11477203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300018006|Ga0187804_10042050 | Not Available | 1763 | Open in IMG/M |
| 3300018062|Ga0187784_10126739 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300018062|Ga0187784_11211163 | Not Available | 599 | Open in IMG/M |
| 3300018433|Ga0066667_10648504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300020034|Ga0193753_10318759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300020580|Ga0210403_10621893 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300021082|Ga0210380_10071451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1515 | Open in IMG/M |
| 3300021086|Ga0179596_10053752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
| 3300021086|Ga0179596_10556937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 582 | Open in IMG/M |
| 3300021181|Ga0210388_11690519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 524 | Open in IMG/M |
| 3300021401|Ga0210393_10573432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 922 | Open in IMG/M |
| 3300021402|Ga0210385_11283403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300021432|Ga0210384_10143276 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300021432|Ga0210384_11668859 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021433|Ga0210391_11489350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 519 | Open in IMG/M |
| 3300021476|Ga0187846_10245612 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300021476|Ga0187846_10292117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300021559|Ga0210409_11408950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 573 | Open in IMG/M |
| 3300021861|Ga0213853_10101861 | Not Available | 736 | Open in IMG/M |
| 3300024288|Ga0179589_10241160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300025915|Ga0207693_10210905 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300026291|Ga0209890_10265124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 529 | Open in IMG/M |
| 3300026355|Ga0257149_1003270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1837 | Open in IMG/M |
| 3300026359|Ga0257163_1035046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300026369|Ga0257152_1035092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 542 | Open in IMG/M |
| 3300026489|Ga0257160_1013421 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300026498|Ga0257156_1032995 | Not Available | 1050 | Open in IMG/M |
| 3300026498|Ga0257156_1095011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 620 | Open in IMG/M |
| 3300026551|Ga0209648_10024225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5307 | Open in IMG/M |
| 3300026551|Ga0209648_10438767 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300026557|Ga0179587_10172758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium genosp. B | 1357 | Open in IMG/M |
| 3300027575|Ga0209525_1153426 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027643|Ga0209076_1037081 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300027667|Ga0209009_1082281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300027706|Ga0209581_1166375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 709 | Open in IMG/M |
| 3300027783|Ga0209448_10091771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1018 | Open in IMG/M |
| 3300027826|Ga0209060_10464558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 575 | Open in IMG/M |
| 3300027842|Ga0209580_10416613 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027846|Ga0209180_10639570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 584 | Open in IMG/M |
| 3300027889|Ga0209380_10367144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 845 | Open in IMG/M |
| 3300027903|Ga0209488_10276037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 65-7 | 1258 | Open in IMG/M |
| 3300027903|Ga0209488_10296906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300027903|Ga0209488_10299986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1200 | Open in IMG/M |
| 3300027905|Ga0209415_10105385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3066 | Open in IMG/M |
| 3300027908|Ga0209006_11241101 | Not Available | 580 | Open in IMG/M |
| 3300027915|Ga0209069_10230567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 956 | Open in IMG/M |
| 3300028536|Ga0137415_10679640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300030056|Ga0302181_10257218 | Not Available | 788 | Open in IMG/M |
| 3300030743|Ga0265461_13925288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
| 3300030838|Ga0311335_11011406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300031028|Ga0302180_10363248 | Not Available | 731 | Open in IMG/M |
| 3300031236|Ga0302324_100927038 | Not Available | 1194 | Open in IMG/M |
| 3300031543|Ga0318516_10574890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300031545|Ga0318541_10339254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 839 | Open in IMG/M |
| 3300031572|Ga0318515_10175427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1146 | Open in IMG/M |
| 3300031572|Ga0318515_10321977 | Not Available | 829 | Open in IMG/M |
| 3300031573|Ga0310915_11105180 | Not Available | 551 | Open in IMG/M |
| 3300031708|Ga0310686_107894089 | Not Available | 582 | Open in IMG/M |
| 3300031708|Ga0310686_115220228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 589 | Open in IMG/M |
| 3300031719|Ga0306917_10739773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 772 | Open in IMG/M |
| 3300031723|Ga0318493_10462220 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031744|Ga0306918_11039403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300031763|Ga0318537_10225492 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031771|Ga0318546_10840985 | Not Available | 646 | Open in IMG/M |
| 3300031771|Ga0318546_11338107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 503 | Open in IMG/M |
| 3300031782|Ga0318552_10289790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 832 | Open in IMG/M |
| 3300031792|Ga0318529_10435956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 610 | Open in IMG/M |
| 3300031820|Ga0307473_10162950 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pla133 | 1283 | Open in IMG/M |
| 3300031879|Ga0306919_10040491 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300031880|Ga0318544_10113473 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300031890|Ga0306925_10223497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2031 | Open in IMG/M |
| 3300031890|Ga0306925_11522583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 64-17 | 654 | Open in IMG/M |
| 3300031910|Ga0306923_10779740 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031912|Ga0306921_10343722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300031912|Ga0306921_11468193 | Not Available | 747 | Open in IMG/M |
| 3300031942|Ga0310916_11177552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 634 | Open in IMG/M |
| 3300031947|Ga0310909_11614437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 64-17 | 514 | Open in IMG/M |
| 3300032001|Ga0306922_11404491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 702 | Open in IMG/M |
| 3300032001|Ga0306922_11911342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 581 | Open in IMG/M |
| 3300032051|Ga0318532_10331608 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032055|Ga0318575_10356701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 741 | Open in IMG/M |
| 3300032055|Ga0318575_10415221 | Not Available | 683 | Open in IMG/M |
| 3300032067|Ga0318524_10735783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300032094|Ga0318540_10466720 | Not Available | 610 | Open in IMG/M |
| 3300032160|Ga0311301_11032311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1082 | Open in IMG/M |
| 3300032174|Ga0307470_10882549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300032261|Ga0306920_100102182 | All Organisms → cellular organisms → Bacteria | 4244 | Open in IMG/M |
| 3300032261|Ga0306920_102857926 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 656 | Open in IMG/M |
| 3300032892|Ga0335081_10739630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1186 | Open in IMG/M |
| 3300032892|Ga0335081_11915168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300033289|Ga0310914_10851948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300034268|Ga0372943_0475327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 813 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.35% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.45% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.45% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.45% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.45% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.45% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.45% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.45% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM37_13808872 | 3300001850 | Marine Plankton | DPDTFEKPWSTFQRYRRGQQTLEEEACAENNEHLFDYHIPVADNPDF* |
| JGIcombinedJ26739_1010724151 | 3300002245 | Forest Soil | DAFNAPWLVTQHYNRVQQPMAELVCAENNEQFFKIPVADKADF* |
| JGIcombinedJ26739_1017262181 | 3300002245 | Forest Soil | RRYRRVQQPMSEEVCAENNTGFFDYHTPVASKPDF* |
| Ga0066395_100015557 | 3300004633 | Tropical Forest Soil | FNAPWSVQQRYNHIQRPMPEEICAENNEQFFKIPVASKPDF* |
| Ga0062388_1008620352 | 3300004635 | Bog Forest Soil | WSGKRRYRRVQEQMAEDVCAENNQHLFDYHIPIADKPDF* |
| Ga0066388_1012338042 | 3300005332 | Tropical Forest Soil | AFNEPWSGTRHYRRAQQPMLEEVCAENNQHLFDYHIPAASQPDF* |
| Ga0066388_1043679481 | 3300005332 | Tropical Forest Soil | EDPDAFNAPWSVMQRYDRIERPMVEEICAENNQHLFDYHMPVANKPDF* |
| Ga0070713_1005500541 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DTYYEPWSGMRRYRRVAQQYAEDICAENNQQLFEYKIPIASKPDF* |
| Ga0070732_104430232 | 3300005542 | Surface Soil | PDAFVEPWSGMRRFRRATQQFAEDICAENNQHLFDYKIPIASKPDF* |
| Ga0066661_104588853 | 3300005554 | Soil | DDPDAFNQPWSAVRQYRRVQQPMLEEVCAENNQHLFDYHIPVADRPDF* |
| Ga0066705_102982662 | 3300005569 | Soil | MRRYRRAQRDSVEMIYAENNQHLFDYHIPVATKPDF* |
| Ga0066705_108024791 | 3300005569 | Soil | TYYEPWSAFRRFRRVQQDYVEEVCAENNQHLFDYKIPVANKPDF* |
| Ga0066708_105414971 | 3300005576 | Soil | VTDPDTYYEPWSAMRRFRRVQQDYAEEACAEYNQHLFDYNLPMAKKSDF* |
| Ga0070740_102581571 | 3300005607 | Surface Soil | YEPWSGMRRFRRATQKFAEDICAENNQILFDYNMPVAEKPDF* |
| Ga0066905_1016550501 | 3300005713 | Tropical Forest Soil | EPWRALVRYQRVSEILAEEVCAENNQVLFDYHIPQADKPDF* |
| Ga0066903_10000166110 | 3300005764 | Tropical Forest Soil | MQRYDRIERPMAEEICAENNQHLFDYHIPVASNAEF* |
| Ga0066903_1000024806 | 3300005764 | Tropical Forest Soil | MQVDITFDDPDAFNAPWSVQQRYNHIQRPMPEEICAENNEQFFKIPVASKPDF* |
| Ga0066903_1021350093 | 3300005764 | Tropical Forest Soil | RRYRHDQGTLTEEICAENNQHLFDYGIPEAKTPDF* |
| Ga0066903_1021574721 | 3300005764 | Tropical Forest Soil | PDAFNAPWSVMQRYDRVQRQMDEEICAENNQHLFDYHIPVANKPDF* |
| Ga0066903_1041212351 | 3300005764 | Tropical Forest Soil | MRRYRRAPLEIVETICAENNEHLFDYHIPIASKPDF* |
| Ga0066903_1052221932 | 3300005764 | Tropical Forest Soil | FNAPWSVMQIYDRVQRPMDEEICAENNGHLFEYHIPVANKSDF* |
| Ga0066903_1075551591 | 3300005764 | Tropical Forest Soil | EDPDAFNAPWSVMQRYDRIERPMVEEICAENNQHLFDYHIPVANKPDF* |
| Ga0066656_108294392 | 3300006034 | Soil | PDTYYEPWTGMRRYRRASQQFREEICAEGNRMLFDYSIPMANQADF* |
| Ga0075024_1000442011 | 3300006047 | Watersheds | KLRRVQMPMHEEACAENNQNLFDYHIPVAGKPDF* |
| Ga0075029_1003654363 | 3300006052 | Watersheds | NTPWSVVQRYDRIQQPMNEEICAENNQQFFKIPMADKPDF* |
| Ga0075019_100645024 | 3300006086 | Watersheds | VVQRYDRIQQPMNEEICAENNQQFFKIPVADKPDF* |
| Ga0070765_1018265811 | 3300006176 | Soil | APWSLTQRYDRVQQPFAERICAENNKHLFNYRIPQTTNADF* |
| Ga0070765_1021538011 | 3300006176 | Soil | LQVNIVFEDPDAFNAVWSVMQRYDRVQRPMEEEACAENNQQFFAIPVANKPEF* |
| Ga0066660_109032872 | 3300006800 | Soil | VEDTDTYYEPWSGIRRYRRVQEEMVEEVCAENNAQLFDYHIPVAGKPDF* |
| Ga0075434_1001354284 | 3300006871 | Populus Rhizosphere | FYQPWTATHRYRRIQRPSAHEEVCAENNQSLFDYGIPVANKPDF* |
| Ga0099795_100585533 | 3300007788 | Vadose Zone Soil | FNAPWSVMQRYDRIQRQMDEQICAENNLQFFQIPVASKPDF* |
| Ga0099829_108569032 | 3300009038 | Vadose Zone Soil | PEAFNAPWSVMQRYDRVQRPMAEEICAENNQHLFDYHMPVANNPDF* |
| Ga0099829_113872221 | 3300009038 | Vadose Zone Soil | INNFTRVQMPMHEEACAENNQHLFDYRIPIADKPDF* |
| Ga0099827_102030972 | 3300009090 | Vadose Zone Soil | MRPGRRFGRHRRVQQEMLEEACAENSAHLFDDHIPVANQPDF* |
| Ga0099827_102202632 | 3300009090 | Vadose Zone Soil | MRRFRRVAQPYLEEVCAENNFHLFDYHIPKAEKPDF* |
| Ga0066709_1007091811 | 3300009137 | Grasslands Soil | MRRYRRVQQPMHEEVCSENNQHLFDYHIPVADKPDF* |
| Ga0099792_103663301 | 3300009143 | Vadose Zone Soil | PWSAIQRFRRVQQQMREEVCAENNHHLFDYGIPVANKPDF* |
| Ga0099792_105489521 | 3300009143 | Vadose Zone Soil | RPLKTQVSVRRVQEQMVEDVCAENNQRLFDYHIPSADKPDF* |
| Ga0113563_139742642 | 3300009167 | Freshwater Wetlands | QRYTRGEQTLQEEVCAENNQHLFDYNIPEAETPDF* |
| Ga0116221_10999351 | 3300009523 | Peatlands Soil | GMRRYRRAEREITENICAENNQHLFDYHIPVADKPDF* |
| Ga0116225_14045801 | 3300009524 | Peatlands Soil | QPWWGKRRYRRVQEAMLEDVCAENNQHLFDYHIPVANTPDF* |
| Ga0116220_103875691 | 3300009525 | Peatlands Soil | TQRYRRVDTPYFEEVCAENNLQFDYHIPVADKPDF* |
| Ga0126374_109583912 | 3300009792 | Tropical Forest Soil | MQVDITFDDPDAFNGPWSVMQRYDRVQQPMDEQICAENNLQFFQIPVADKPDF* |
| Ga0116219_103989731 | 3300009824 | Peatlands Soil | RRYRRVERRFIEDICAENNQHLFDYKIPIASRLDF* |
| Ga0126380_102850911 | 3300010043 | Tropical Forest Soil | AFNESWSAVQHYRRVSQEMQEEACAENNAHLFDYHIPVADKPDF* |
| Ga0126380_113448592 | 3300010043 | Tropical Forest Soil | TYYEAWSGNQRYDRADRPLTEQICAENNQHLFDYHIPVADKPDF* |
| Ga0126384_106429281 | 3300010046 | Tropical Forest Soil | SAVRQYRRVQQPMLEEVCAENNQHLFNYHIPAADKPDF* |
| Ga0126373_125820561 | 3300010048 | Tropical Forest Soil | DPNTFYAPWSAINNFKRIQMPMHEEACAENNQHLFDYHMPVASKPDF* |
| Ga0131853_108322902 | 3300010162 | Termite Gut | RFRRVTQQFAEDICAENNQIVFDYKMPVAEKPDF* |
| Ga0074044_104153512 | 3300010343 | Bog Forest Soil | IQRYDLVRRPMDEEICAENNQHLFDYHIPVANKPDF* |
| Ga0126370_118259771 | 3300010358 | Tropical Forest Soil | DPDAFNAPWWVIQRYDRVQRQMPEEICAENNQHLFDYHIPVANKLDF* |
| Ga0126376_105947411 | 3300010359 | Tropical Forest Soil | DAFYEPWSAMRQYRRVQQPMLEEVCAENNQHLFDYHIPMAEKPDF* |
| Ga0126376_110562482 | 3300010359 | Tropical Forest Soil | WTGMRRYRRAQREITENICAENNQHLFDYHIPVASKPDF* |
| Ga0126376_122319931 | 3300010359 | Tropical Forest Soil | DPDAFNAPWSVMQRYDRIERPMPEEICAENNQHLFDYHIPVASNVDF* |
| Ga0126372_101625422 | 3300010360 | Tropical Forest Soil | WSGMRRCRRVQQDMPEIVCAENNQHLFDYHIPMADKPNF* |
| Ga0126372_102654811 | 3300010360 | Tropical Forest Soil | MRRYRRAQREITENICAENNQHLFDYHVPTASKPDF* |
| Ga0126372_106098392 | 3300010360 | Tropical Forest Soil | WSGMRRYRRVHQPILEEVCAENNEHLFDYHIPVANKPDF* |
| Ga0126372_106826672 | 3300010360 | Tropical Forest Soil | RYRRVQRQFIEEICAENNQHLFDYKIPVADKADF* |
| Ga0126372_111254032 | 3300010360 | Tropical Forest Soil | AFNQPWSAVRQYRRVQQPMLEEVCAENNQHLFDYHIPVADKPDF* |
| Ga0126377_107727001 | 3300010362 | Tropical Forest Soil | MRRFRRVQQAYVEEVCAEGNRHLFDYNVPKADKPDF* |
| Ga0126377_111026112 | 3300010362 | Tropical Forest Soil | RRYRRVQEKMAEEICAENNQHLFDYRIPIAHKPDF* |
| Ga0126377_117886722 | 3300010362 | Tropical Forest Soil | PWWGKRRYRRVQEAMLEDVCAENNLHLFDYHIPVADKPDF* |
| Ga0126377_132590302 | 3300010362 | Tropical Forest Soil | DAFNAPWSVMQRYDRIERPMDEQICAENNQHLFDYHMPVADKADF* |
| Ga0126379_105482141 | 3300010366 | Tropical Forest Soil | DAFNAPWSAIQRYRRAQPRQLGEEACAENNEHLFDYRIPVADKADF* |
| Ga0126379_125017701 | 3300010366 | Tropical Forest Soil | QPWSAVRQYRRVQQPMLEEVCAENNQHLFDYHIPVAEKPDF* |
| Ga0126379_128504641 | 3300010366 | Tropical Forest Soil | VDITFEDPDAFNAPWSVMQRYDRIERPMVEEICAENNQHLFDYHIPVANKPDF* |
| Ga0126379_137418201 | 3300010366 | Tropical Forest Soil | MQRYDRVQQPMDEQICAENNLQFFQIPVADKPDF* |
| Ga0126381_1020932661 | 3300010376 | Tropical Forest Soil | WTGTRRYRRVTQQFMEDICAENNQHLFDYKIPVADNPDF* |
| Ga0126381_1022729022 | 3300010376 | Tropical Forest Soil | DPDTYYEAWSGNQRYDRADRPLTEQICAENNQHLFDYRIPVADKPDF* |
| Ga0136449_1014441331 | 3300010379 | Peatlands Soil | TRQYRRVQEPMIEEVCAENNQHLFDYHVPVASKPDF* |
| Ga0136449_1035594552 | 3300010379 | Peatlands Soil | IQLYDRVDRPMIEEVCAENNLHLFEYHIPVADRPDF* |
| Ga0126383_128094031 | 3300010398 | Tropical Forest Soil | TFEDPDAFNAPWSVMQRYDRIERPMVEEICAENNQHLFDYHIPVANKPDF* |
| Ga0126350_107533192 | 3300010880 | Boreal Forest Soil | QRYRRVQPRQLGEEACAENNAQMFDYGTPVAEKPDF* |
| Ga0137391_113897981 | 3300011270 | Vadose Zone Soil | MRHYRRAQQEHDEIVCAENNTNNVFDYHVPKADKPDF* |
| Ga0137393_112411252 | 3300011271 | Vadose Zone Soil | QVDITFEDPDAFNAPWSVIQRYDRVQRPMAEEICAENNEHLFDYHIPVADKADF* |
| Ga0137457_11948201 | 3300011443 | Soil | PWSTVQRYTRGEQSLQEEVCAENNQHLFDYNIPEAETPDF* |
| Ga0137389_104811822 | 3300012096 | Vadose Zone Soil | DPDTYYEPWSGMRRYRRVQRQYIEEICAENNQHLFDYKIPVADKAEF* |
| Ga0137389_109061811 | 3300012096 | Vadose Zone Soil | MQVDITFEDPEAFNVPWSVMQRYDRVQRPMAEEICAENNQHLFDYHMPVANNPDF* |
| Ga0137389_109814033 | 3300012096 | Vadose Zone Soil | VMQVNITFEDPNAFNSPWCVMQRYDRIQAPMREEICAENNQQFFQIPVANKPDF* |
| Ga0137363_100751902 | 3300012202 | Vadose Zone Soil | PDTYYEPWSGMRRYRRVQRQYIEEICAENNQHLFDYKIPVADKAEF* |
| Ga0137362_101491435 | 3300012205 | Vadose Zone Soil | IRRYRRVQQEMLEEACAENNAHLFDDHIPVASRPDF* |
| Ga0137362_114345491 | 3300012205 | Vadose Zone Soil | PWTGMRRYRRVQQQPDEIVCAENNNIVFDYHIPQAAKPDF* |
| Ga0137377_103950641 | 3300012211 | Vadose Zone Soil | HPWSAIQRFRRVPTAMDEEVCAEGNFLLFDYGIPQANRFDF* |
| Ga0150985_1111435472 | 3300012212 | Avena Fatua Rhizosphere | RWGVRSYRRVQEKMGEEIRAENNQHLFDYQIPIASNPDF* |
| Ga0137372_106974631 | 3300012350 | Vadose Zone Soil | RRYRRVQEAMIEDVCAENNQHLFDYQIPVADKPDF* |
| Ga0137360_100346892 | 3300012361 | Vadose Zone Soil | GMRRYRRVQRQYIEEICAENNQHLFDYKIPVADKAEF* |
| Ga0137360_108263261 | 3300012361 | Vadose Zone Soil | WTGMRRYRRVQQQPDEIVCAENNNIVFDYHIPQAAKPDF* |
| Ga0137361_113742431 | 3300012362 | Vadose Zone Soil | EDPDTYYEPWSGMRRYRRVQRQYIEEICAENNQHLFDYKIPVADKAEF* |
| Ga0137390_112253382 | 3300012363 | Vadose Zone Soil | PWSGTRRYRRVQQPMLEEVCAENNQHLFDYHIPVANKPDF* |
| Ga0150984_1182341232 | 3300012469 | Avena Fatua Rhizosphere | RRYRRVQQEMAEDVCAENNQHLFDYKIPVAEKPDF* |
| Ga0137398_100909011 | 3300012683 | Vadose Zone Soil | DPDAFNAPWSGTRRYRRVQQPLLEEVCAENNQHLFDYHIPVANKPDF* |
| Ga0137397_103656103 | 3300012685 | Vadose Zone Soil | DAFNAPWSVMQRYDRIQQPMSEEICAENNQQFFQIPVANNPDF* |
| Ga0137419_115032741 | 3300012925 | Vadose Zone Soil | KRRYRRTELPYIEEVCAENNQHLFNYKIPVANKPDF* |
| Ga0137416_108999621 | 3300012927 | Vadose Zone Soil | RYRRVQRQYIEEICAENNQHLFDYKIPAADKADF* |
| Ga0137416_110487321 | 3300012927 | Vadose Zone Soil | PDTYYEPWSGMRRYRRVERQYVEDICAENNQHLFDYKIPVANKPDF* |
| Ga0137407_123232062 | 3300012930 | Vadose Zone Soil | DDPDAFYEPWSWMQRYDRVQQPMRKEICAEGNQHLFDYHMPVAERPDF* |
| Ga0153915_112601151 | 3300012931 | Freshwater Wetlands | AFTTPWSAIQRYRRVPDAMLEEVCAENNSVLFDYHIPQSNRADF* |
| Ga0137410_111897512 | 3300012944 | Vadose Zone Soil | FRRVQGTLQEAACAESNLNFGLFDYHIPVAHKPDF* |
| Ga0137410_114042571 | 3300012944 | Vadose Zone Soil | WQAVRRFRQVKQTLEEESCAENNQHLFDYHIPIADKPDF* |
| Ga0137410_118943141 | 3300012944 | Vadose Zone Soil | SAIGKLRRVQMPMHEEACAENNQNLFDYHIPVANKSDF* |
| Ga0126375_110739452 | 3300012948 | Tropical Forest Soil | WSAMRRFRRVQQAYVEEVCAEGNRHLFDYNVPKADKPDF* |
| Ga0126369_106100703 | 3300012971 | Tropical Forest Soil | AIQRYGRVQQPLREDICAENNQHLFDYHIPVADKPDF* |
| Ga0126369_110711803 | 3300012971 | Tropical Forest Soil | AIGALRRVQMLMHEEACAENNQHLFDYHIPVANKPDF* |
| Ga0126369_110985732 | 3300012971 | Tropical Forest Soil | DITFEDPDAFNAPWSVTQRYDRIQGPMVEEICAENNQHLFDYHIPVANSPDF* |
| Ga0126369_121706972 | 3300012971 | Tropical Forest Soil | QRYRRVQQSFREEICAENNQHLFDYHIPVANKPDF* |
| Ga0126369_122430051 | 3300012971 | Tropical Forest Soil | DTYYEPWTGMRRYRRVTQQFMEDICAENNQHLFDYKIPVADNPDF* |
| Ga0126369_128937511 | 3300012971 | Tropical Forest Soil | RVDITFDDPEAFNAPWSVMQLYDRVQRPFEEQVCSEGNHNLFDWDMPQARTPDF* |
| Ga0120127_101186901 | 3300013503 | Permafrost | TYNEAWSAVQHFGRPDQPMLEEVCAEGNFMLFDYGIPVANKPDF* |
| Ga0181535_106545151 | 3300014199 | Bog | EPWSAVNNFRRIKLPFHEEVCAENNQHLFDYHIPVANKPDF* |
| Ga0182018_107400141 | 3300014489 | Palsa | QYRRVQEPMIEEVCAENNQHLFDYHVPVASKPDF* |
| Ga0180082_10928372 | 3300014880 | Soil | HHERGRFPMVEDICAENNQNLFDYKMPVEETPDF* |
| Ga0137409_100589706 | 3300015245 | Vadose Zone Soil | WSGMRRYRRAQREITENICAENNQHLFDYHIPAASKPDF* |
| Ga0137409_111731681 | 3300015245 | Vadose Zone Soil | PWSGMRRYRRVQRQYIEEICAENNQHLFDYKIPVADKAEF* |
| Ga0137403_101199004 | 3300015264 | Vadose Zone Soil | HFRRSDQPMLEEVCAEGNFMLFDYGIPVANKPDF* |
| Ga0132258_108108013 | 3300015371 | Arabidopsis Rhizosphere | AVRSYRRMQGALQEEACAENNQHLFDYHIPIADRPDF* |
| Ga0182033_113213981 | 3300016319 | Soil | RLPPWSGMRRYRRVQQEMVEDICTENNQHLFDYHIPVASQPDF |
| Ga0182035_105666041 | 3300016341 | Soil | DDPDAFNAPWSVFQRYDRIQRPMDEEVCAENNQQFFTIPVANEPDF |
| Ga0182035_114096032 | 3300016341 | Soil | WSGMRRYRRVQQQFREDICAENNEHLFDYGIPTASRPDF |
| Ga0182035_121231901 | 3300016341 | Soil | DPDAFNAPWTVMQRYDRIERPMPEEICAENNQHLFDYHIPVANVPDF |
| Ga0182034_112178621 | 3300016371 | Soil | WSAMRRYRRVQQPMHEEVCAENNQHLFNYHIPIANKPDF |
| Ga0182034_116200333 | 3300016371 | Soil | SRRYRRARQAYTEEACAENNQHLFEYHIPTAQQSDF |
| Ga0182040_104026832 | 3300016387 | Soil | AATQRYDRVQQPFVERICAENNQHLFDYHIPQAAKADF |
| Ga0182037_101924164 | 3300016404 | Soil | AFYEPWSAVQHFRRVQEPMTEEICAENNQHLFDYHIPTAAKADF |
| Ga0187819_101412661 | 3300017943 | Freshwater Sediment | QPWSGMRRFRRVDEAMAEDVCAENNEHLFDYGIPVANKPDF |
| Ga0187783_110208272 | 3300017970 | Tropical Peatland | QPWSGMRRYRRAQRAASEDICAENNQHLFDYHIPEAKNPDF |
| Ga0187781_100817943 | 3300017972 | Tropical Peatland | DAFNAPWSSIRRYRRVQQPMAEEVCAENNRNLFDYHIPVAAKPDF |
| Ga0187781_101932062 | 3300017972 | Tropical Peatland | MSSFSLREKVPETVCAENNQHLFDYHIPLASKPDF |
| Ga0187782_114772031 | 3300017975 | Tropical Peatland | PWSVMQRYDRIQRPMDEEICAENNQQFFAIPAADRPDF |
| Ga0187804_100420501 | 3300018006 | Freshwater Sediment | QPWWGKRRYRRVQEEMIEDACAENNEHLFDYHIPVADKPDF |
| Ga0187784_101267391 | 3300018062 | Tropical Peatland | MSSFSLTEKVPETVCAENNQHLFDYHIPLASKPDF |
| Ga0187784_112111631 | 3300018062 | Tropical Peatland | NTYNAPWSGKRRYRRVEAPIEEDVCAENNQQFAYHIPIAQNPDF |
| Ga0066667_106485041 | 3300018433 | Grasslands Soil | YEPWSAMRRFRRVQQDYAEEACAENNQHLFDYKIPMAHKPDF |
| Ga0193753_103187592 | 3300020034 | Soil | QPWSTFQRYQRGVQTLEEEACAENNQHLFDYHIPQGTAADF |
| Ga0210407_107942192 | 3300020579 | Soil | KVMQVDITFEDPDAFNAPWSVMQRYDRVQRPMAEEICAENNQHLFDYHIPVANNPDF |
| Ga0210403_106218931 | 3300020580 | Soil | NEPWSGTRRYRRVQQPLLEEVCAENNQHLFDYHIPVANKPDF |
| Ga0210380_100714511 | 3300021082 | Groundwater Sediment | TFNKPWSTVQRYQRDEQTLQEEVCAENNQHLFDYHIPEAKTPDF |
| Ga0179596_100537521 | 3300021086 | Vadose Zone Soil | TLLEPWSAIQRYRRVQPRFLGEEACAENNSYFNYRTPTASEPDF |
| Ga0179596_105569371 | 3300021086 | Vadose Zone Soil | DAFYESWSGMRRYRRVQQAMREDVCAENNQHLFDYHIPVANKPDF |
| Ga0210388_116905191 | 3300021181 | Soil | DPDAFNAPWSVMQRYDLVRRPMDEEICAENNQHLFDYHIPVANKPDF |
| Ga0210393_105734321 | 3300021401 | Soil | PWSTIQRYRRVQPRELGEEACAENNYGLFDYHIPVADKPDF |
| Ga0210385_112834032 | 3300021402 | Soil | NQPWSGKRRYRRVQEQMAEDVCAENNQHLFDYHIPVANKPDF |
| Ga0210384_101432761 | 3300021432 | Soil | WSGMRRYRRAERESVEMICAENNQHLFDYHIPVAVTPDF |
| Ga0210384_116688591 | 3300021432 | Soil | SAVRQYRRVQQPMLEEVCAENNQHLFDYHIPVADKPDF |
| Ga0210391_114893501 | 3300021433 | Soil | DDPDAFNQPWTGMRRYRRAPLQVEETVCAENNQHLFDYHIPIASKSDF |
| Ga0187846_102456122 | 3300021476 | Biofilm | PWSGTRRYRRVQQPLLEEVCAENNQHLFNYHIPVADKPDF |
| Ga0187846_102921171 | 3300021476 | Biofilm | AINNFRRIQMPMHEEACAENNQHLFDYHIPIANKPDF |
| Ga0210409_114089501 | 3300021559 | Soil | DPDTFYEPWSAVQRFRRVQEPMTEEICAENNQHLFDYHIPTAAKPDF |
| Ga0126371_102944993 | 3300021560 | Tropical Forest Soil | MQVDITFDDPDAFNAPWSVQQRYNHIQRPMPEEICAENNEQFFKIPVASKPDF |
| Ga0213853_101018612 | 3300021861 | Watersheds | APWSVMQRYDRIQRPMDEEICAENNLQFFKIPVADKPDF |
| Ga0179589_102411601 | 3300024288 | Vadose Zone Soil | DDPDTFKQPWRAIVRYRRVTETLAEQVCAENNRVLFDYHIPEADEPDF |
| Ga0207693_102109051 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FNEPWTGTRRYRRVQQQFVEDICAENNQHLFDYKIPIAAKPDF |
| Ga0209890_102651242 | 3300026291 | Soil | DPDTFYQSWSAIGKLRRVQMPMHEEACAENNQNLFDYHIPVANKPDF |
| Ga0257149_10032702 | 3300026355 | Soil | RRYRRAQREITENICAENNQHLFDYHIPTASKPDF |
| Ga0257163_10350461 | 3300026359 | Soil | TFYEPWSAINNFTRVQMPMHEEACAENNQHLFDYHIPIADKPDF |
| Ga0257152_10350921 | 3300026369 | Soil | SGMRRYRRVQRQYIEEICAENNQHLFDYKIPVADKAEF |
| Ga0257160_10134211 | 3300026489 | Soil | APWLGTRRYRRVQQPLLEEVCAENNQHLFDYHIPVADKADF |
| Ga0257156_10329952 | 3300026498 | Soil | EDPDAFNAPWSVIQRYDRVQRPMAEEICAENNEHLFDYHIPVADKVDF |
| Ga0257156_10950111 | 3300026498 | Soil | PDALYQPWTGMRRYRRAQREITENICAENNQHLFDYHIPTASKPDF |
| Ga0209648_100242251 | 3300026551 | Grasslands Soil | YDPWSATQRYRRVQQPLREEICAENNQHLFDYHIPIANNPDF |
| Ga0209648_104387671 | 3300026551 | Grasslands Soil | GTRRYRRVQQPLLEEVCAENNQHLFDYHIPVADKPDF |
| Ga0179587_101727581 | 3300026557 | Vadose Zone Soil | PWSAIQRFRRVQQQMREEVCAENNQHLFDYGIPVANRSDF |
| Ga0209525_11534261 | 3300027575 | Forest Soil | QRYDRVQRPMDEEICAENNQHLFDYHIPVANQPDF |
| Ga0209076_10370812 | 3300027643 | Vadose Zone Soil | TVEDPDAFNAPWSGTRRYRRVQQPLLEEVCAENNQHLFDYRIPVANKLDF |
| Ga0209009_10822811 | 3300027667 | Forest Soil | PWSVMQHYDRIQRPMDEEICAENNQQFFPIPVANKPDF |
| Ga0209581_11663753 | 3300027706 | Surface Soil | YEPWSGMRRFRRATQKFAEDICAENNQILFDYNMPVAEKPDF |
| Ga0209448_100917712 | 3300027783 | Bog Forest Soil | RRYRRANREYVEDICAENNQHLFDYKIPIASKADF |
| Ga0209060_104645581 | 3300027826 | Surface Soil | FNAPWTVMQRYDRIERPMAEEICAENNQHLFDYHMPVANVPDF |
| Ga0209580_104166131 | 3300027842 | Surface Soil | RRSSARRVTEPMVEEVCAENNRHLFDYHIPVANKPDF |
| Ga0209180_106395701 | 3300027846 | Vadose Zone Soil | PEAFNAPWSVMQRYDRVQRPMAEEICAENNQHLFDYHMPVANNPDF |
| Ga0209380_103671441 | 3300027889 | Soil | INNFRRIQRPMHEEACAENNQHLFDYHIPVADRPDF |
| Ga0209488_102760372 | 3300027903 | Vadose Zone Soil | RKYRRATQEPDEIVCAENNTNLIDYHIPIAGKPDF |
| Ga0209488_102969061 | 3300027903 | Vadose Zone Soil | NNFTRVQMPMHEEACAENNQHLFDYRIPIADKPDF |
| Ga0209488_102999861 | 3300027903 | Vadose Zone Soil | NQPWQALRRFRRMQGTMGEEVCAENNQHLFDYHIPEAKTPDF |
| Ga0209415_101053852 | 3300027905 | Peatlands Soil | MVDDPDTFYEPWWGKRRYRRVQEAMLEDVCAENNQHLFDYHIPTADKPDF |
| Ga0209006_112411011 | 3300027908 | Forest Soil | FNAPWSVMQRYDRVQRPMDEEICAENNQHLFDYHIPVANQPDF |
| Ga0209069_102305672 | 3300027915 | Watersheds | EPWSGMRRYRRVQQQMVEEACAENNQHLFDYHIPVANKPDF |
| Ga0137415_106796402 | 3300028536 | Vadose Zone Soil | GMRRYRRVQQQQPDEIVCAENNNIVFDYHIPQAAKPDF |
| Ga0302181_102572181 | 3300030056 | Palsa | DAFNAPWSVVQRYNRIVQPMDEEICAENNQQFFPIPVANRPDF |
| Ga0265461_139252882 | 3300030743 | Soil | SIRRYRRVEQELIEEVCAENNAHLFDYHIPVANTPDF |
| Ga0311335_110114061 | 3300030838 | Fen | PWSGMRRYRRAERDDAEMICAENNQHLFDYHIPVAEKPDF |
| Ga0302180_103632482 | 3300031028 | Palsa | VVQRYNRIVQPMDEEICAENNQQFFPIPVANRPDF |
| Ga0302324_1009270383 | 3300031236 | Palsa | WSAVNNFRRIKLPFHEEVCAENNQHLFDYHIPVANKPDF |
| Ga0318516_105748902 | 3300031543 | Soil | WSGKRRYRRVDEQMAEDVCAENNQHLFDYHIPVADKPDF |
| Ga0318541_103392541 | 3300031545 | Soil | YEPWSGVRRYRRVAQPYVEDVCAENNQHFDYKIPVASRPDF |
| Ga0318515_101754272 | 3300031572 | Soil | FNAPWSLTQRYDRVQQPFVERICAENNQHLFDYHIPQAIKADF |
| Ga0318515_103219771 | 3300031572 | Soil | QVDITFEDPDAFNAPWSVMQRYDRVQRQMDEEICAENNQHLFDYHIPVANKPDF |
| Ga0310915_111051802 | 3300031573 | Soil | DPDAFNRPWSVMQRYDRVQQPMDEQICAENNTQFFQIPAADKPDF |
| Ga0310686_1078940892 | 3300031708 | Soil | YEPWSAIQRYNRVQQPLREEVCAENNLQFDYDVPVADRPDF |
| Ga0310686_1152202282 | 3300031708 | Soil | MRRYRRAQREISEDICAENNQHLFDYHIPVANKPDF |
| Ga0306917_107397731 | 3300031719 | Soil | NDPETLEPWKAVNRYRRIQRPRASEEVCAENNQILFDYRIPVASKPDF |
| Ga0318493_104622201 | 3300031723 | Soil | TRRYRRVQQQFIEDICAENNQHLFDYKIPIAAKPDF |
| Ga0306918_110394032 | 3300031744 | Soil | NQPWTGMRRYRRVQQEVPEEICAEGNRHLFDYHIPVANKSDF |
| Ga0318537_102254923 | 3300031763 | Soil | TFYEPWSGSRRYRRARQAYTEEACAENNQHLFEYHIPTAQQSDF |
| Ga0318546_108409852 | 3300031771 | Soil | APWSVFQRYDRIQRPMDEEVCAENNQQFFTIPVANKPDF |
| Ga0318546_113381071 | 3300031771 | Soil | SGMRRYRRVQQEMVEDICAENNQHLFDYHIPVANKPDF |
| Ga0318552_102897901 | 3300031782 | Soil | AFYEPWSAIQRYGRVQQPLREDICAENNQHLFDYHIPVADKPDF |
| Ga0318529_104359561 | 3300031792 | Soil | YEPWSGSRRYRRARQAYTEEACAENNQHLFEYHIPTAQQSDF |
| Ga0307473_101629503 | 3300031820 | Hardwood Forest Soil | SGLRRFRRVAQRFEEDICAENNEHIDYKIPTADKPDF |
| Ga0306919_100404915 | 3300031879 | Soil | TGTRRYRRVQQQFIEDICAENNQHLFDYKIPIAAKPDF |
| Ga0318544_101134732 | 3300031880 | Soil | INEPWTGTRRYRRVQQQFIEDICAENNQHLFDYKIPIAAKPDF |
| Ga0306925_102234971 | 3300031890 | Soil | WSAVQHYRRVSQEMQEEACAENNAHLFDYHIPVAEEPDF |
| Ga0306925_115225832 | 3300031890 | Soil | QRFRRVQQQMREEVCAENNQHLFDYDIPVANKPDF |
| Ga0306923_107797401 | 3300031910 | Soil | ITLDDPDAFNAPWSLTQRYDRVAQPFVERICAENNQHLFDYHIPQAAKADF |
| Ga0306921_103437223 | 3300031912 | Soil | TQRYDRVQQTFVERVCAENNQHLFDYHIPQAIKADF |
| Ga0306921_114681932 | 3300031912 | Soil | AVQHYRRVSQEMQEEACAENNAHLFDYHIPVAEEPDF |
| Ga0310916_111775521 | 3300031942 | Soil | YYEPWSGVRRYRRVAQPYVEDVCAENNQHFDYKIPVASRPDF |
| Ga0310909_116144371 | 3300031947 | Soil | PWSAIQRFRRVQQQMREEVCAENNQHLFDYDIPVANKPDF |
| Ga0306922_114044912 | 3300032001 | Soil | MRFASAPGIQRYDRVEQSLTEQICAENNQHLFDYQIPVSNQPDF |
| Ga0306922_119113421 | 3300032001 | Soil | VEDADTYYEPWSGIQHYDRVERPMTEQVCAENNQHLFDYQIPIAVKPDF |
| Ga0318532_103316082 | 3300032051 | Soil | VIQRFRRVEQKMREEACAENNQHLFDYQMPVAAKPDF |
| Ga0318575_103567011 | 3300032055 | Soil | FYEPWSAIQRYGRVQQPLREDICAENNQHLFDYHIPVADKPDF |
| Ga0318575_104152212 | 3300032055 | Soil | DAFNAPWSVMQRYDRVQRQMDEEICAENNQHLFDYHIPVANKPDF |
| Ga0318524_107357832 | 3300032067 | Soil | FNAPWTGMRRYRRVQQEAPEEICAENNQHLFDYHIPVANKSDF |
| Ga0318540_104667201 | 3300032094 | Soil | PDAFNRPWSVMQRYDRVQQPMDEQICAENNTQFFQIPAADKPDF |
| Ga0311301_110323111 | 3300032160 | Peatlands Soil | IQRYRRVEVRMIEQVCAENNLQSSDYKTPVADKPDF |
| Ga0307470_108825492 | 3300032174 | Hardwood Forest Soil | EPWSGMRRYRRVQQQFMEDICAENNQHLFDYEIPIARNPDF |
| Ga0306920_1001021821 | 3300032261 | Soil | PWSGKRRYRRVDELMAEDVCAENNQHLFDYHIPVADKPDF |
| Ga0306920_1028579262 | 3300032261 | Soil | VDITFDDPDAFNAPWSVMQRYDRIQRQMDEQICAENNLQFFQIPVASKPDF |
| Ga0335081_107396301 | 3300032892 | Soil | PWSGMRRFRRATQQFAEDICAENNQILFDYNIPVAEKPDF |
| Ga0335081_119151682 | 3300032892 | Soil | RRYRRVDEQMAEDVCAENNQHLFDYHIPVADKPDF |
| Ga0310914_108519481 | 3300033289 | Soil | PWSGKRRYRRVDEQMAEDVCAENNQHLFDYHIPVADKPDF |
| Ga0372943_0475327_664_774 | 3300034268 | Soil | MRRFRRVQQDYQEQVCAEGNRMLFDYGIPTADKADF |
| ⦗Top⦘ |