


| Basic Information | |
|---|---|
| Family ID | F020706 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 222 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKRREFITLLGGALSVFLCVSAAAQEGYYGAGHDKWHQGFYSKLN |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.64 % |
| % of genes near scaffold ends (potentially truncated) | 92.79 % |
| % of genes from short scaffolds (< 2000 bps) | 94.59 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.045 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.928 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.378 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 50.45 |
| PF03401 | TctC | 4.05 |
| PF07969 | Amidohydro_3 | 1.35 |
| PF11684 | DUF3280 | 1.35 |
| PF00903 | Glyoxalase | 0.90 |
| PF00106 | adh_short | 0.45 |
| PF08028 | Acyl-CoA_dh_2 | 0.45 |
| PF01220 | DHquinase_II | 0.45 |
| PF02705 | K_trans | 0.45 |
| PF13620 | CarboxypepD_reg | 0.45 |
| PF07045 | DUF1330 | 0.45 |
| PF02371 | Transposase_20 | 0.45 |
| PF03288 | Pox_D5 | 0.45 |
| PF08402 | TOBE_2 | 0.45 |
| PF13936 | HTH_38 | 0.45 |
| PF01699 | Na_Ca_ex | 0.45 |
| PF07883 | Cupin_2 | 0.45 |
| PF08734 | GYD | 0.45 |
| PF13442 | Cytochrome_CBB3 | 0.45 |
| PF13193 | AMP-binding_C | 0.45 |
| PF03358 | FMN_red | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 50.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.05 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.45 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.45 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.45 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.45 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.45 |
| COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 0.45 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.45 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.05 % |
| Unclassified | root | N/A | 4.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002IVK1F | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10107373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1029692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300000956|JGI10216J12902_122726051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1158 | Open in IMG/M |
| 3300001661|JGI12053J15887_10494297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300004267|Ga0066396_10038618 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300004479|Ga0062595_100617840 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005171|Ga0066677_10335883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300005332|Ga0066388_101269435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1266 | Open in IMG/M |
| 3300005332|Ga0066388_101431048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1203 | Open in IMG/M |
| 3300005332|Ga0066388_101783356 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005332|Ga0066388_102086292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1019 | Open in IMG/M |
| 3300005332|Ga0066388_103429856 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005332|Ga0066388_104788740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300005332|Ga0066388_104845545 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005332|Ga0066388_107168210 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005332|Ga0066388_107534627 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005471|Ga0070698_100424250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300005536|Ga0070697_100200470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1696 | Open in IMG/M |
| 3300005536|Ga0070697_100727258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300005555|Ga0066692_10029647 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
| 3300005557|Ga0066704_10406247 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005557|Ga0066704_10425623 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005713|Ga0066905_101150432 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005764|Ga0066903_101935302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1130 | Open in IMG/M |
| 3300005764|Ga0066903_106036389 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005764|Ga0066903_107533240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300005764|Ga0066903_107670362 | Not Available | 556 | Open in IMG/M |
| 3300005764|Ga0066903_109063216 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005937|Ga0081455_10539196 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006050|Ga0075028_101023347 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006354|Ga0075021_10818488 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006578|Ga0074059_12124688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
| 3300006794|Ga0066658_10554577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300006845|Ga0075421_100832322 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300006845|Ga0075421_100931803 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300006847|Ga0075431_100803701 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300006853|Ga0075420_100732044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 852 | Open in IMG/M |
| 3300006904|Ga0075424_102485796 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009137|Ga0066709_101830193 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300009792|Ga0126374_10309697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1063 | Open in IMG/M |
| 3300009792|Ga0126374_10458397 | Not Available | 908 | Open in IMG/M |
| 3300009792|Ga0126374_10484835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300009792|Ga0126374_10856154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300009792|Ga0126374_11002398 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300009792|Ga0126374_11752551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300010043|Ga0126380_10118843 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300010043|Ga0126380_11485588 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010043|Ga0126380_12306780 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010046|Ga0126384_10330251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1264 | Open in IMG/M |
| 3300010046|Ga0126384_10510672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
| 3300010046|Ga0126384_10810742 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300010047|Ga0126382_10121641 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300010358|Ga0126370_10723509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 877 | Open in IMG/M |
| 3300010358|Ga0126370_12448315 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010359|Ga0126376_11172338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300010359|Ga0126376_12271418 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010359|Ga0126376_13246550 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010360|Ga0126372_10710140 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010360|Ga0126372_11116843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 808 | Open in IMG/M |
| 3300010361|Ga0126378_10481253 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300010361|Ga0126378_12199529 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010362|Ga0126377_10023030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5158 | Open in IMG/M |
| 3300010362|Ga0126377_10052541 | All Organisms → cellular organisms → Bacteria | 3559 | Open in IMG/M |
| 3300010362|Ga0126377_10389030 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300010362|Ga0126377_13443129 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010366|Ga0126379_10392543 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300010376|Ga0126381_102627306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300010376|Ga0126381_103155205 | Not Available | 652 | Open in IMG/M |
| 3300010398|Ga0126383_10041376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 3761 | Open in IMG/M |
| 3300010398|Ga0126383_10664204 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300010403|Ga0134123_13121886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300010868|Ga0124844_1226009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300011271|Ga0137393_11623763 | Not Available | 536 | Open in IMG/M |
| 3300012198|Ga0137364_10343917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1112 | Open in IMG/M |
| 3300012199|Ga0137383_10119942 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300012201|Ga0137365_11172804 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012211|Ga0137377_10292163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1564 | Open in IMG/M |
| 3300012211|Ga0137377_10656597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LTSP849 | 984 | Open in IMG/M |
| 3300012211|Ga0137377_11553272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300012349|Ga0137387_10778870 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012359|Ga0137385_10686847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300012922|Ga0137394_10455923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300012948|Ga0126375_10165381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1413 | Open in IMG/M |
| 3300012948|Ga0126375_11108437 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012955|Ga0164298_10191425 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300012960|Ga0164301_10976318 | Not Available | 664 | Open in IMG/M |
| 3300012975|Ga0134110_10448732 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300013306|Ga0163162_11098433 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300015371|Ga0132258_10380828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3499 | Open in IMG/M |
| 3300015371|Ga0132258_11118568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1991 | Open in IMG/M |
| 3300015371|Ga0132258_13039610 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300015371|Ga0132258_13572348 | Not Available | 1064 | Open in IMG/M |
| 3300015373|Ga0132257_103254467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300016294|Ga0182041_12233319 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300016319|Ga0182033_10674923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 903 | Open in IMG/M |
| 3300016319|Ga0182033_11959114 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300016357|Ga0182032_10652080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 880 | Open in IMG/M |
| 3300016371|Ga0182034_10691757 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300016387|Ga0182040_10618168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300016422|Ga0182039_11204018 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300016445|Ga0182038_11564594 | Not Available | 593 | Open in IMG/M |
| 3300018027|Ga0184605_10036115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2060 | Open in IMG/M |
| 3300018027|Ga0184605_10136712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1097 | Open in IMG/M |
| 3300018027|Ga0184605_10253797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300018028|Ga0184608_10340867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 658 | Open in IMG/M |
| 3300018061|Ga0184619_10057122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1707 | Open in IMG/M |
| 3300018066|Ga0184617_1045565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1097 | Open in IMG/M |
| 3300018066|Ga0184617_1150356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300018067|Ga0184611_1280352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 583 | Open in IMG/M |
| 3300018072|Ga0184635_10235088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 727 | Open in IMG/M |
| 3300018081|Ga0184625_10172426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1132 | Open in IMG/M |
| 3300018081|Ga0184625_10207516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1027 | Open in IMG/M |
| 3300018468|Ga0066662_12693654 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300019878|Ga0193715_1052160 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300019996|Ga0193693_1015171 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300020001|Ga0193731_1024756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1574 | Open in IMG/M |
| 3300020002|Ga0193730_1152513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300020018|Ga0193721_1081744 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300021078|Ga0210381_10083597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1013 | Open in IMG/M |
| 3300021088|Ga0210404_10657480 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300021363|Ga0193699_10012275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3075 | Open in IMG/M |
| 3300021560|Ga0126371_10465718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1411 | Open in IMG/M |
| 3300021560|Ga0126371_11366663 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300022557|Ga0212123_10782369 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300022694|Ga0222623_10168561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300022756|Ga0222622_10333796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1052 | Open in IMG/M |
| 3300025910|Ga0207684_10369434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300025910|Ga0207684_11184699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300026316|Ga0209155_1246287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300026532|Ga0209160_1216595 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300027480|Ga0208993_1013074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1438 | Open in IMG/M |
| 3300027527|Ga0209684_1018031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1094 | Open in IMG/M |
| 3300027537|Ga0209419_1022924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1148 | Open in IMG/M |
| 3300027576|Ga0209003_1073339 | Not Available | 630 | Open in IMG/M |
| 3300027587|Ga0209220_1172659 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027633|Ga0208988_1115547 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027654|Ga0209799_1067647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
| 3300027812|Ga0209656_10166412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300027909|Ga0209382_10857078 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300028707|Ga0307291_1092941 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300028707|Ga0307291_1093376 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300028708|Ga0307295_10033016 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300028708|Ga0307295_10124609 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300028711|Ga0307293_10029405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1655 | Open in IMG/M |
| 3300028712|Ga0307285_10030367 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300028712|Ga0307285_10040572 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300028713|Ga0307303_10195984 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300028715|Ga0307313_10122772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300028717|Ga0307298_10213540 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028720|Ga0307317_10043445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1429 | Open in IMG/M |
| 3300028721|Ga0307315_10084615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 919 | Open in IMG/M |
| 3300028722|Ga0307319_10179943 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300028722|Ga0307319_10186184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 678 | Open in IMG/M |
| 3300028722|Ga0307319_10271542 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300028771|Ga0307320_10315516 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300028784|Ga0307282_10162102 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300028784|Ga0307282_10163222 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300028793|Ga0307299_10070722 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300028793|Ga0307299_10071856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1283 | Open in IMG/M |
| 3300028793|Ga0307299_10088110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1156 | Open in IMG/M |
| 3300028793|Ga0307299_10114725 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300028796|Ga0307287_10062196 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300028796|Ga0307287_10081612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1212 | Open in IMG/M |
| 3300028796|Ga0307287_10113351 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300028796|Ga0307287_10138135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 925 | Open in IMG/M |
| 3300028807|Ga0307305_10082538 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300028807|Ga0307305_10231316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 846 | Open in IMG/M |
| 3300028814|Ga0307302_10100477 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300028819|Ga0307296_10016003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3925 | Open in IMG/M |
| 3300028819|Ga0307296_10122667 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300028819|Ga0307296_10165619 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300028819|Ga0307296_10200388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1083 | Open in IMG/M |
| 3300028819|Ga0307296_10253548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300028819|Ga0307296_10271681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
| 3300028819|Ga0307296_10390308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 760 | Open in IMG/M |
| 3300028819|Ga0307296_10614421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 595 | Open in IMG/M |
| 3300028824|Ga0307310_10163638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300028828|Ga0307312_10015504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 4276 | Open in IMG/M |
| 3300028828|Ga0307312_10148414 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300028875|Ga0307289_10069123 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300028875|Ga0307289_10097191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1200 | Open in IMG/M |
| 3300028876|Ga0307286_10104757 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300028881|Ga0307277_10356364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300028884|Ga0307308_10050458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
| 3300028884|Ga0307308_10397410 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300028885|Ga0307304_10131153 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300030990|Ga0308178_1017357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1101 | Open in IMG/M |
| 3300031093|Ga0308197_10066390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300031094|Ga0308199_1028118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
| 3300031095|Ga0308184_1006340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1016 | Open in IMG/M |
| 3300031170|Ga0307498_10050286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1125 | Open in IMG/M |
| 3300031170|Ga0307498_10145335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 781 | Open in IMG/M |
| 3300031572|Ga0318515_10354162 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031573|Ga0310915_10230230 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300031679|Ga0318561_10378069 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031719|Ga0306917_10397804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1075 | Open in IMG/M |
| 3300031744|Ga0306918_10965806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 662 | Open in IMG/M |
| 3300031744|Ga0306918_11215302 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031763|Ga0318537_10031871 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300031768|Ga0318509_10327025 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031770|Ga0318521_10549341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 696 | Open in IMG/M |
| 3300031832|Ga0318499_10270796 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031890|Ga0306925_10091342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3232 | Open in IMG/M |
| 3300031912|Ga0306921_10749533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1119 | Open in IMG/M |
| 3300031912|Ga0306921_11774497 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031942|Ga0310916_11088538 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031945|Ga0310913_10924909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300031946|Ga0310910_10128864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1914 | Open in IMG/M |
| 3300031954|Ga0306926_12660911 | Not Available | 544 | Open in IMG/M |
| 3300032001|Ga0306922_11575518 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032060|Ga0318505_10349675 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300032068|Ga0318553_10543171 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032076|Ga0306924_11556934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300032076|Ga0306924_11675197 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300032090|Ga0318518_10292328 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300032180|Ga0307471_101567847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 815 | Open in IMG/M |
| 3300032205|Ga0307472_102443128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300032261|Ga0306920_104095759 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300033290|Ga0318519_10482154 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.45% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.45% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_05875770 | 2170459003 | Grass Soil | MIANMKRREFITLLGGAISLFLCVSATAQEGYYGVGHDKWHQGFYSKLKR |
| AF_2010_repII_A1DRAFT_101073732 | 3300000597 | Forest Soil | VKRRTFITLLGGAVSVFLCVSAAAQEGYYGVGHDKWHQ |
| AP72_2010_repI_A100DRAFT_10296922 | 3300000837 | Forest Soil | VKRRTFITLLGGAVSLLLCVSAAAQEGYYGIGHDKWHQGFYSTLRRNDGG |
| JGI10216J12902_1227260511 | 3300000956 | Soil | MRRRTFIGPLGSAVSVFLCVNAAAQEGYYGTGHDKWHQGFYSTLKRN |
| JGI12053J15887_104942972 | 3300001661 | Forest Soil | MKRREFITMLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL* |
| Ga0066396_100386182 | 3300004267 | Tropical Forest Soil | MPFDQLHRREVITLLGGAVSVFLCVSAAAQEGYYGIGHDKWHRD |
| Ga0062595_1006178403 | 3300004479 | Soil | MELLTRRWTFIMLVGSWLSVFCFGSTAAQEGYYGVGHDQWHQ |
| Ga0066677_103358832 | 3300005171 | Soil | MNRREFITLLGGAISLFLCVSATAQEGYYGVGHDKWHQGFYSK |
| Ga0066388_1012694351 | 3300005332 | Tropical Forest Soil | MIARLNRRAFITLLGGAVSVFLCVSAAAQEGYYGVGHDKWHQGFYSKL |
| Ga0066388_1014310481 | 3300005332 | Tropical Forest Soil | MKRREFITLIGGAVSVFLCISAAAQEGYYGIGHDKWHRDFY |
| Ga0066388_1017833562 | 3300005332 | Tropical Forest Soil | MKRREFITLLGGALSVSLCMSGAAQEGYSGAGHDKWHQGFYSKLNR |
| Ga0066388_1020862921 | 3300005332 | Tropical Forest Soil | MTVTIGRRELLAALGGTASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGG |
| Ga0066388_1034298562 | 3300005332 | Tropical Forest Soil | MKRRDFITLLGGAASLFFCVNAAAQEGYYGVGHDKWHEGFYSKLRRDDGGLC |
| Ga0066388_1047887401 | 3300005332 | Tropical Forest Soil | MRRREFISLLGAAVFLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGGLCCN |
| Ga0066388_1048455451 | 3300005332 | Tropical Forest Soil | MTAKMKRREFITLLGGAVSVFLCVSAAAQEGYYGAGHDKWHQDFYSKLPKRNDG* |
| Ga0066388_1071682102 | 3300005332 | Tropical Forest Soil | MLDMERREFITLLGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRN |
| Ga0066388_1075346271 | 3300005332 | Tropical Forest Soil | MRFLGGMADFITPLRGGALGILLCVSAAAQEGYYGVDHDKWHQNFYSKLKRNDG |
| Ga0070698_1004242501 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSANMGRRDFITLLGGAISLFPCVSATAQEGYYGVGHDKWHQG |
| Ga0070697_1002004701 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRDFITLLSGPASMFLCVSAVAQEGYYGVGHDKWHQGFYSTL |
| Ga0070697_1007272581 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIANMKRREFITLLGGAISLFLCVSATAQEGYYGVGHDKWHQGFYSK |
| Ga0066692_100296474 | 3300005555 | Soil | MRRRDFITLLGGGAFLFLCVNAAAQEGYYGVGHDKWHQGFYS |
| Ga0066704_104062473 | 3300005557 | Soil | LKREFIILLGGAIAVFLCVRAAAQEGYYGVGHDKWHQGFYS |
| Ga0066704_104256231 | 3300005557 | Soil | VTLKRRAFITLLGSAVSVFLCVNAAAQEGYYGVGHDKWHQGFYSKLKRND |
| Ga0066905_1011504322 | 3300005713 | Tropical Forest Soil | MQFDQLKRRKFITLIGGAVSLFLCVSAAAQEGYYGVGHDKWHQGFYS* |
| Ga0066903_1019353022 | 3300005764 | Tropical Forest Soil | MKRREFITLLGGALSVSLCMSGAAQEGYSGAGHDKWHQGFYSKLNRNDGKG |
| Ga0066903_1060363891 | 3300005764 | Tropical Forest Soil | MTSRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYSQLR |
| Ga0066903_1075332402 | 3300005764 | Tropical Forest Soil | VKRREFIALLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGF |
| Ga0066903_1076703621 | 3300005764 | Tropical Forest Soil | MSSYVTRRAFIHLLGSAVSVFLWVGAAVAQEGYYGQGHDKWH |
| Ga0066903_1090632162 | 3300005764 | Tropical Forest Soil | MPFDQLHRREVITLLGGAVSVFLCVSAAAQEGYYGIGHDKWHRDFYSKLKRNDGRG |
| Ga0081455_105391961 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRRRAFITLLGGGAFLFLCANAAAQEGYYGAGHDKWHQGF |
| Ga0075028_1010233472 | 3300006050 | Watersheds | MKRREFITLLGGAISLFLCVSATAQEGYYGVGHDKWHQGFYSKLKRN |
| Ga0075021_108184883 | 3300006354 | Watersheds | MRRREFIAALVGVFFVFLCESASAQEGYYGADHDNWHQNFYSKLQRNDG |
| Ga0074059_121246882 | 3300006578 | Soil | VKRREFITLLGGALSAFHCVSASAQEGYYGAGHDK |
| Ga0066658_105545772 | 3300006794 | Soil | LKRRAFITLLGSAVSVFLCVNAAAQEGYYGVGHDKWHQGFYS |
| Ga0075421_1008323221 | 3300006845 | Populus Rhizosphere | MRCREFTTLFAGAVSVCLCLSAAAQEGYYGVGHDKWHRDFYSKLKRNDGR |
| Ga0075421_1009318032 | 3300006845 | Populus Rhizosphere | MIRRREFITLLGGGAASVLLYASTAAQEGHYGAGHDKWHQDFYSKLRRNDGGLC |
| Ga0075431_1008037012 | 3300006847 | Populus Rhizosphere | MSSMKRREFITLLGGAVSVFVCVGAAAQEGYYGVGHDKWHQGF |
| Ga0075420_1007320442 | 3300006853 | Populus Rhizosphere | MQLDQLKRREFITLLGGVVSVFLCVSAAAQEGYYGVGHDKWHQGFYSKLKR |
| Ga0075424_1024857961 | 3300006904 | Populus Rhizosphere | MLDLRRRQFLTLLGGAVSVFLCVNAAAQEGYYGAGHDKWHQGFYSKLKR |
| Ga0066709_1018301932 | 3300009137 | Grasslands Soil | MRRRGFIVLFGSAVSVFLCVSATAQEGYYGADHDKWHQGFYSKLKR |
| Ga0126374_103096971 | 3300009792 | Tropical Forest Soil | MAQGEEVPMLDMNRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQG |
| Ga0126374_104583971 | 3300009792 | Tropical Forest Soil | MNVAKRDCITLLGSAVSVFLCVSASAQEGYYGVGHDKWHQGFYSTLKRNDG |
| Ga0126374_104848352 | 3300009792 | Tropical Forest Soil | MILGFGLSAMKRREFITLLGGAGSLLFCVSAAAQEGYYGVG |
| Ga0126374_108561541 | 3300009792 | Tropical Forest Soil | MRRREFISLLGAAVFLFFCVNAAAQEGYYGAGHDKWHQGFYSQLR |
| Ga0126374_110023981 | 3300009792 | Tropical Forest Soil | MRRREYITLIGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGGSCCN |
| Ga0126374_117525511 | 3300009792 | Tropical Forest Soil | MKRRAVISLLGGAVSLFLCISAAAQEGYYGVGHDKWHQ |
| Ga0126380_101188434 | 3300010043 | Tropical Forest Soil | MRRHDFITLLGGGAFLCLCVNAAAQEGYYGADHDK |
| Ga0126380_114855881 | 3300010043 | Tropical Forest Soil | MTVSIGRRELLAALGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGGSC |
| Ga0126380_123067801 | 3300010043 | Tropical Forest Soil | MAQGEEVPMLDMNRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDG |
| Ga0126384_103302512 | 3300010046 | Tropical Forest Soil | MKRREFITLIGGAVSVFLCISAAAQEGYYGIGHDKWHRDFYSKLKRNDGRGSC |
| Ga0126384_105106722 | 3300010046 | Tropical Forest Soil | VKRREFIALLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRN |
| Ga0126384_108107423 | 3300010046 | Tropical Forest Soil | MRHRDFITLLGSGAFLFLCVNAAAQEGYYGADHDKWHQGFYSKLKR |
| Ga0126382_101216414 | 3300010047 | Tropical Forest Soil | MRRRDFITLLGGGAFLFLYVNAAAQEGYYGADHDKWHQGFY |
| Ga0126370_107235092 | 3300010358 | Tropical Forest Soil | MTVTIGRRELLAALGGAPSLFFCVNAAAQEGYYGAGHD |
| Ga0126370_124483153 | 3300010358 | Tropical Forest Soil | MKRRAFITLLGGAVSVFLCVNAAAQEGYYGIGHDKWHRDFYS |
| Ga0126376_111723381 | 3300010359 | Tropical Forest Soil | MSQRELIMLLGGALSVSLCMSGAAQEGYSGAGHDKWHQGFYSKLNINDGKGKKA* |
| Ga0126376_122714182 | 3300010359 | Tropical Forest Soil | MSGRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRR |
| Ga0126376_132465502 | 3300010359 | Tropical Forest Soil | VNRREFIMLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGGL |
| Ga0126372_107101401 | 3300010360 | Tropical Forest Soil | MPFDQLHRREVITLLGGAVSVFLCVNAAAQEGYYGIGHDKWHRDFY |
| Ga0126372_111168431 | 3300010360 | Tropical Forest Soil | VRRREFITLLGGAVSVFLCVSAAAQEGYYGIGHDKWHRDFY |
| Ga0126378_104812533 | 3300010361 | Tropical Forest Soil | MKRRAFITLLGGAVSVFLCVNAAAQEGYYGIGHDK |
| Ga0126378_121995291 | 3300010361 | Tropical Forest Soil | MTSRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFY |
| Ga0126377_100230308 | 3300010362 | Tropical Forest Soil | MKRREFITLIGGAVSVFLCISAAAQEGYYGIGHDKWHRDFYSK |
| Ga0126377_100525416 | 3300010362 | Tropical Forest Soil | MKRRAFITLLGGAVSVFLCVNAAAQEGYYGIGHDKWHRDF |
| Ga0126377_103890302 | 3300010362 | Tropical Forest Soil | MPFDQLKRLEFIKLLGGAISMLLGVSATAQEGYYGVGHDKW |
| Ga0126377_134431292 | 3300010362 | Tropical Forest Soil | VRRREFVTLLGGAVSVFLCVNAAAQEGYYGADYDKWHRDFYSKLKRN |
| Ga0126379_103925431 | 3300010366 | Tropical Forest Soil | VNKREFITLLGGAASLFFGVNAAAQEGYYGAGHDKWHQG |
| Ga0126381_1026273062 | 3300010376 | Tropical Forest Soil | MKRREFITLFGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRND |
| Ga0126381_1031552051 | 3300010376 | Tropical Forest Soil | MSGMRRRAFITLLGGAVSWFLCVSAAAQEGYYGVGHDKWHQ |
| Ga0126383_100413761 | 3300010398 | Tropical Forest Soil | MRRRECITLIGGAASLFFCVNAAAQEGYYGAGHDK |
| Ga0126383_106642041 | 3300010398 | Tropical Forest Soil | MILGFGLSAMKRREFITLLGGAGSLLFCVSAAAQEGYYGVGHEKWHQGFYSKLRRNDGGL |
| Ga0134123_131218861 | 3300010403 | Terrestrial Soil | MCTFVNRRAFISLLGSAVSVFLCASTVGAQEGYYGVGHDKWHQGFYSI |
| Ga0124844_12260091 | 3300010868 | Tropical Forest Soil | MRRRDFITLLSGAFSVSLCMSGAAQEGYSGAGHDKWHQG |
| Ga0137393_116237631 | 3300011271 | Vadose Zone Soil | MRFNHLRRREFVTLLGGALSVFLCVSAAAQEGHYGASHD |
| Ga0137364_103439171 | 3300012198 | Vadose Zone Soil | MRRREFITLLGGAVSLFLCVSAAAQEGYYGVGHDKWHQGFYSTLKRNDGGGSCC |
| Ga0137383_101199421 | 3300012199 | Vadose Zone Soil | VTLKRRAFITLLGSAVSVFLCVNAAAQEGYYGVDHDKWHHGFYSNLKRNDGQ |
| Ga0137365_111728041 | 3300012201 | Vadose Zone Soil | VTLKRRAFITLLGSAVSVFLCVNAAAQEGYYGVGHDKWHQGFYS |
| Ga0137377_102921631 | 3300012211 | Vadose Zone Soil | MIANMKRREFITLLGGAISLFLCVSATAQEGYYGVGHDKWHQSFYSKLKRNDGQGS |
| Ga0137377_106565971 | 3300012211 | Vadose Zone Soil | MRRKKDFIMLLGGAISVLVCVSAAAQEGYYGAGHDKWHEGFYSK |
| Ga0137377_115532721 | 3300012211 | Vadose Zone Soil | MNVLKRDCITLLGSAVSVFLCVSAAAQEGYYGVGHDKWHQGFYSTLKRND |
| Ga0137387_107788702 | 3300012349 | Vadose Zone Soil | MRRREFVTLLGGALSVFLCASAAAQEGYYGAGHDKWHQGFYS |
| Ga0137385_106868472 | 3300012359 | Vadose Zone Soil | VNIPRRDYVTLLTSAVAMFLCLNATAQEGYYGVGHDKWHRDFYSKLKRNDG |
| Ga0137394_104559231 | 3300012922 | Vadose Zone Soil | MFGMKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLAEL* |
| Ga0126375_101653813 | 3300012948 | Tropical Forest Soil | MKRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFY |
| Ga0126375_111084372 | 3300012948 | Tropical Forest Soil | MPFDQLKRREFFTLLGGAISLFLCVSAAAQEGYYGVGHDK |
| Ga0164298_101914251 | 3300012955 | Soil | VKRRQFITLFGGALSAFLCVSASAQEGYYGEGHDKWHQGFYS |
| Ga0164301_109763182 | 3300012960 | Soil | VTAFFGRREFITLLGGALFAFHFVSASAQEGYYGAGHDKW |
| Ga0134110_104487322 | 3300012975 | Grasslands Soil | MMRRRGFIVLFGSAVSVFLCVSATAQEGYYGADHEKWHQGFYSKLKRND* |
| Ga0163162_110984332 | 3300013306 | Switchgrass Rhizosphere | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQ |
| Ga0132258_103808281 | 3300015371 | Arabidopsis Rhizosphere | MIGRREFITLLGGAASVLLYESAAAQEGHYGVVHEKWHQDFYSKLRRNDG |
| Ga0132258_111185683 | 3300015371 | Arabidopsis Rhizosphere | MIRRREFITLLGGAASVLLYASAAAQEGYYGVGHEKWHQDFYSKL |
| Ga0132258_130396102 | 3300015371 | Arabidopsis Rhizosphere | VIRRREFITFLGGAASVLLYASAAAQEGHYGVGHEKWHQDFYSKLRRND |
| Ga0132258_135723481 | 3300015371 | Arabidopsis Rhizosphere | MTDFIGRREFITLLGGALFAFHFVSASAQEGYYGAGH |
| Ga0132257_1032544671 | 3300015373 | Arabidopsis Rhizosphere | MCTLVTRRPFISLLGSAVSAFLGVSTAGAQEGYYGVGHDK |
| Ga0182041_122333191 | 3300016294 | Soil | MLDMKRREFFTLLGGAASLFFCVNAAAQEGYYGAGHDKWHQGF |
| Ga0182033_106749231 | 3300016319 | Soil | MLDMKRREFFTLLGGAASLFFCVNAAAQEGYYGAG |
| Ga0182033_119591142 | 3300016319 | Soil | MKRREFITLLGGAASLLFCVNAAAQEGYYGAGHDKWHQGFYSQL |
| Ga0182032_106520801 | 3300016357 | Soil | MAQGEEVPMLDMKRREFFTLLGGAGALFFCVNAAAQEGYYGAGHDKWHQGFYSQL |
| Ga0182034_106917573 | 3300016371 | Soil | MTVTIGRRELLAALGGTASLFFCVNAAAQEGYYGAG |
| Ga0182040_106181683 | 3300016387 | Soil | MTVTIGRRELLAALGGAASLFFCANAVAQEGYYGADHNKWHQNFYSQLRRNDG |
| Ga0182039_112040182 | 3300016422 | Soil | MTVIIGRRELLAALGGAASLFFCVNAAAQEGYYGAGHDKWHQ |
| Ga0182038_115645942 | 3300016445 | Soil | MTVIIGRRELLAALGGAASLFFCVNAAAQEGYYGAGHD |
| Ga0184605_100361152 | 3300018027 | Groundwater Sediment | MKRREFITMLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0184605_101367121 | 3300018027 | Groundwater Sediment | MKRREFITLLGGALSAFHCASASAQEGYYGAGHDKWHQGFYSTLKRNDGQGS |
| Ga0184605_102537971 | 3300018027 | Groundwater Sediment | MKRREFIALLGGALSLILCISASAQEGYYGAGHDKWHQGFYST |
| Ga0184608_103408671 | 3300018028 | Groundwater Sediment | MKRRQFITLLGGALSVSLGISSAAQEGYYGAGHDKWHQGFYSNLKRND |
| Ga0184619_100571223 | 3300018061 | Groundwater Sediment | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGS |
| Ga0184617_10455653 | 3300018066 | Groundwater Sediment | MKRRDFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSC |
| Ga0184617_11503561 | 3300018066 | Groundwater Sediment | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSC |
| Ga0184611_12803522 | 3300018067 | Groundwater Sediment | MKRRDFITMLGGAVSVLLCVSAAAQEGDYGVGHGKWHRDFYSK |
| Ga0184635_102350881 | 3300018072 | Groundwater Sediment | MKRRQFVTLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSC |
| Ga0184625_101724261 | 3300018081 | Groundwater Sediment | MKRREFITPLGGALSVLLCVSAAAQEGYYGVGHDKWHQG |
| Ga0184625_102075162 | 3300018081 | Groundwater Sediment | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFY |
| Ga0066662_126936542 | 3300018468 | Grasslands Soil | MEFLGSRSNFITLLVGALSPFLCVSAVAQEGYYGAGHHNWHQGFYSKLK |
| Ga0193715_10521602 | 3300019878 | Soil | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSCC |
| Ga0193693_10151711 | 3300019996 | Soil | MKRRQFITLLGGALSVSLCISSAAQEGYYGAGRDKW |
| Ga0193731_10247562 | 3300020001 | Soil | MKRREFITLLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0193730_11525131 | 3300020002 | Soil | ACRRGDRMKRREFITLLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0193721_10817441 | 3300020018 | Soil | MGRRKFITLLGGALSVFLCVSAAAQEGYYGEGHDKWHQGFYSK |
| Ga0210381_100835971 | 3300021078 | Groundwater Sediment | ITMLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0210404_106574803 | 3300021088 | Soil | AFITLLSGVFVFLCISVEAQEGYYGVGHDKWHQGFYSTLKRK |
| Ga0193699_100122754 | 3300021363 | Soil | RMKRREFITLLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0126371_104657183 | 3300021560 | Tropical Forest Soil | MSGRREFITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYS |
| Ga0126371_113666631 | 3300021560 | Tropical Forest Soil | VKRREFITLLGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGG |
| Ga0212123_107823691 | 3300022557 | Iron-Sulfur Acid Spring | MKRREFITLLAGALSVVLCVGATAQEGYYGAGHDKW |
| Ga0222623_101685611 | 3300022694 | Groundwater Sediment | DRMKRREFITMLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0222622_103337961 | 3300022756 | Groundwater Sediment | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTL |
| Ga0207684_103694341 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIANMKRREFITLLGGAISLFLCVSATAQEGYYGVGHDKW |
| Ga0207684_111846991 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDMRRREFITLLGGAVSLFLCVSAAAQEGYYGVGHDKWHQGFYSTLKRND |
| Ga0209155_12462871 | 3300026316 | Soil | MEVDGVNRRVFITLGSAVSVVFSAGAAAQEGYHGVGHDKWHQGFYSTLKRNDGQ |
| Ga0209160_12165951 | 3300026532 | Soil | MTRRAFITLLGGAVSLFLCVSAAAQEGYYGVGHDK |
| Ga0208993_10130741 | 3300027480 | Forest Soil | MKGREFISMLGGALSAFHCASASAQEGYYGAGHDNWHQGFYSTLKRND |
| Ga0209684_10180311 | 3300027527 | Tropical Forest Soil | MPFDQLHRREVITLLGGAVSVFLCVSAAAQEGYYGIGHDKWHRDFYSKLK |
| Ga0209419_10229241 | 3300027537 | Forest Soil | MESLGSRRDFITLLAGALTMFLCVSVAAQEGYYGAG |
| Ga0209003_10733394 | 3300027576 | Forest Soil | MNVPKRDCITLLGSAVSVFLCVSAAAQEGYYGVGHDKWHQGFYSTLKRNDGG |
| Ga0209220_11726591 | 3300027587 | Forest Soil | MKFPGKGQDFTTLLGGGLAVFLFASAAAQDGYYGVGHDKWHQNFYSKLKRNDGQGS |
| Ga0208988_11155473 | 3300027633 | Forest Soil | MKIPRRDFVALLGGALSGFLCVSASAQEGYYGAGHDKWHEGFYSKL |
| Ga0209799_10676472 | 3300027654 | Tropical Forest Soil | MKRREFITLIGGAVSVFLCISAAAQEGYYGIGHDKWHRDFYSKL |
| Ga0209656_101664122 | 3300027812 | Bog Forest Soil | MKFPGKGQDFTTLLGGGLAVFLFASAAAQDGYYGVGHDKWHQNFYSKLKRND |
| Ga0209488_103841291 | 3300027903 | Vadose Zone Soil | GSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0209382_108570781 | 3300027909 | Populus Rhizosphere | MIRRREFITLLGGGAASVLLYASTAAQEGHYGAGHDKWHQDFYS |
| Ga0307291_10929411 | 3300028707 | Soil | VRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSCC |
| Ga0307291_10933761 | 3300028707 | Soil | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKW |
| Ga0307295_100330162 | 3300028708 | Soil | VRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTL |
| Ga0307295_101246091 | 3300028708 | Soil | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQG |
| Ga0307293_100294054 | 3300028711 | Soil | MKRRDFITLLGGALSVFHCVRASAQEGYYGAGHDKWH |
| Ga0307285_100303671 | 3300028712 | Soil | VKRREFITLLGGALSVLLCVSAGAQEGYYGAGHDKWHQGFYSTLKR |
| Ga0307285_100405721 | 3300028712 | Soil | MSCRREFILLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSCC |
| Ga0307303_101959841 | 3300028713 | Soil | MGRRKFITLLGGALSVFLCVSAAAQEGYYGEGHDKWH |
| Ga0307313_101227722 | 3300028715 | Soil | TLLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0307298_102135402 | 3300028717 | Soil | MKRREFISLLGGALSAFHCASASAQEGYYGAGHDKWH |
| Ga0307317_100434452 | 3300028720 | Soil | MKRRQFITLVGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQG |
| Ga0307315_100846151 | 3300028721 | Soil | VRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKEMTAKA |
| Ga0307319_101799432 | 3300028722 | Soil | VKRREFITLLGGALSVLLCVSAGAQEGYYGAGHDKWHQGFYSTL |
| Ga0307319_101861843 | 3300028722 | Soil | MKRRDFITLLGGALSVFHCVRASAQEGYYGAGHDKWHQGFYS |
| Ga0307319_102715422 | 3300028722 | Soil | MKRREFISLLGGALSAFHCASASAQEGYYGAGHDKW |
| Ga0307320_103155161 | 3300028771 | Soil | VKRREFITLLGGALSVLLCVSAGAQEGYYGAGHDKWHQ |
| Ga0307282_101621021 | 3300028784 | Soil | MKRREFISLLGGAFSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRN |
| Ga0307282_101632221 | 3300028784 | Soil | MKRREFITLLGGALSVFLCVSAAAQEGYYGAGHDKWHQGFYSKLN |
| Ga0307299_100707221 | 3300028793 | Soil | VRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRND |
| Ga0307299_100718563 | 3300028793 | Soil | MSAELKRREFITLLGGALSVFLCVSAAAQEGYYGAGHDKWHQGFYSKLNRNDGKG |
| Ga0307299_100881101 | 3300028793 | Soil | MKIPRRDFIALVGSAFSILLSVSAPAQEGYLGAGHDKWHQGFYSTLKRND |
| Ga0307299_101147252 | 3300028793 | Soil | MKRRQFITLVGGALSAFHCVSASAQEGYYGAGHDKW |
| Ga0307299_101576561 | 3300028793 | Soil | MLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0307287_100621962 | 3300028796 | Soil | MKRREFISLLGGALSAFHCASASAQEGYYGAGHDKWHQGFYSTLKRNDG |
| Ga0307287_100816121 | 3300028796 | Soil | VKRREFISLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQG |
| Ga0307287_101133512 | 3300028796 | Soil | MKRREFITLLGGALSAFHCASASAQEGYYGAGHDNGIKAST |
| Ga0307287_101381353 | 3300028796 | Soil | MKRRDFITLLGGALSVFHCVRASAQEGYYGAGHDKWHQGFYSTLKRNDGQGSC |
| Ga0307305_100825383 | 3300028807 | Soil | VRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYS |
| Ga0307305_102313161 | 3300028807 | Soil | MKRRDFITLLGGALSVFHCVRASAQEGYYGAGHDKWHQ |
| Ga0307302_101004771 | 3300028814 | Soil | MKRRQFITLVGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDSQGSCC |
| Ga0307296_100160031 | 3300028819 | Soil | MGRRKFITLLGGALSPFLCVSAAAQEGYYGEGHDKWHQ |
| Ga0307296_101226671 | 3300028819 | Soil | MKRREFISLLGGALSAFHCASASAQEGYYGAGHDKWHQGFYSTLKRNDGQGS |
| Ga0307296_101656193 | 3300028819 | Soil | MKRREFIALLGGALSLILCISASAQEGYYGAGHDKWHQGFYS |
| Ga0307296_102003881 | 3300028819 | Soil | MKRREFITPLGGALSVLLCVSAAAQEGYYGVGHDKWH |
| Ga0307296_102535481 | 3300028819 | Soil | MRRREFIALLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRN |
| Ga0307296_102716812 | 3300028819 | Soil | MRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWH |
| Ga0307296_103903081 | 3300028819 | Soil | VKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKW |
| Ga0307296_106144212 | 3300028819 | Soil | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRN |
| Ga0307310_101636382 | 3300028824 | Soil | MKKREFITLLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0307312_100155046 | 3300028828 | Soil | MKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWH |
| Ga0307312_101484141 | 3300028828 | Soil | MKRRQFITLLGGALSVSLGISSAAQEGYYGAGHDKWHQGFYSNLKRN |
| Ga0307289_100691232 | 3300028875 | Soil | MKRRQFITLLGGALSVSLGISSAAQEGYYGAGHDKWHQGFYSNLKR |
| Ga0307289_100971911 | 3300028875 | Soil | VKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGF |
| Ga0307286_101047572 | 3300028876 | Soil | MKRREFITLLGGALSAFHCASASAQEGYYGAGHDKWHQGFYSTLKRN |
| Ga0307277_103563642 | 3300028881 | Soil | MKRREFITLFGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQG |
| Ga0307308_100504585 | 3300028884 | Soil | MKIPRRDFIALLAGALSGFLCVSASAQEGYYGAGHDKWHEGFYSKLKRNDGQGS |
| Ga0307308_103974103 | 3300028884 | Soil | VRRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQ |
| Ga0307304_101311532 | 3300028885 | Soil | VKRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLKRNDGQGS |
| Ga0308178_10173572 | 3300030990 | Soil | VNRREFITLLGSALSVFLCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0308197_100663901 | 3300031093 | Soil | MIRREFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0308199_10281181 | 3300031094 | Soil | MKIPRRDFIALLGGALSEFLCVSASAQEGYYGAGHDKWHQGFYST |
| Ga0308184_10063402 | 3300031095 | Soil | MKRRNFITLLGGALSAFHCVSASAQEGYYGAGHDKWHQGFYSTLAEL |
| Ga0307498_100502863 | 3300031170 | Soil | VKRREFITLLGGALSVLLCVSAGAQEGYYGAGHDKWHQGFYSTLKRNDGQGSCCN |
| Ga0307498_101453351 | 3300031170 | Soil | MMRRRGFITLLGGALSAFHYVSASAQEGYYGAGHDKWHQGFY |
| Ga0318515_103541622 | 3300031572 | Soil | VTRREFITLLGGAASLFFCVNAAAQEGYYGAGHDKWHHGFYSQLR |
| Ga0310915_102302302 | 3300031573 | Soil | MTVTIGRRELLAALGGAASLFFCVNAAAQEGYYGAGHDKWAPTR |
| Ga0318561_103780691 | 3300031679 | Soil | VNRRDFITLLGGAASLFFCVNAAAQEGYYGAGHDKWHQGF |
| Ga0306917_103978043 | 3300031719 | Soil | VTRREFITLLGGAASLFFCVNAAAQEGYYGAGHDKWHHGFYSQLRRND |
| Ga0306918_109658062 | 3300031744 | Soil | RRELLAALGGAASLFFCVNAAAQEGYYGAGHDKWAPTR |
| Ga0306918_112153022 | 3300031744 | Soil | VTRREFITLLGGAASLFFCVNAAAQEGYYGAGHDK |
| Ga0318537_100318711 | 3300031763 | Soil | VNRRSLITLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFY |
| Ga0318509_103270251 | 3300031768 | Soil | VNRRDFITLLGGAASLFFCVNATAQEGYYGAGHDKWHQGFYS |
| Ga0318521_105493411 | 3300031770 | Soil | RMTVTIGRRELLAALGGAASLFFCVNAAAQEGYYGAGHDKWAPTR |
| Ga0318499_102707963 | 3300031832 | Soil | MRRRDFIPLLGGGAFLFLCVNAAAQEGYYGMGHDKWHQG |
| Ga0306925_100913425 | 3300031890 | Soil | MKRREFITLLGGAASLLFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGGLC |
| Ga0306921_107495331 | 3300031912 | Soil | MRRRDFTTLLGGAVSLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRND |
| Ga0306921_117744972 | 3300031912 | Soil | MTVTIGRRELLAALGGAASLFFCVNAAAQEGYYGAGHDKWHQG |
| Ga0310916_110885381 | 3300031942 | Soil | MLDMKRREFFTLLGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYS |
| Ga0310913_109249092 | 3300031945 | Soil | MTVTIGRRELLAALGGTASLFFCVNAAAQEGYYGAGHDKWHQG |
| Ga0310910_101288641 | 3300031946 | Soil | MTVTIGRRELLAALGGAASLFFCANAVAQEGYYGADHNKWH |
| Ga0306926_126609112 | 3300031954 | Soil | MRRRDFITLLGGGAFLFLFLYVNAAAQEGYYGADH |
| Ga0306922_115755183 | 3300032001 | Soil | MRRRECITLIGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLSRNDGGSCCN |
| Ga0318505_103496751 | 3300032060 | Soil | MRRRDFIPLLGGGAFLFLCVNAAAQEGYYGMGHDKWHQGFYSQL |
| Ga0318553_105431711 | 3300032068 | Soil | MKRREFITLLGGAASLLFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGGLCC |
| Ga0306924_115569341 | 3300032076 | Soil | MTVTIGRRELLAALGGAASLFFCVNAVAQEGYYGAGH |
| Ga0306924_116751971 | 3300032076 | Soil | MLDMKRREFFTLLGGAASLFFCVNAAAQEGYYGAGHDKWHQGFYSQLRRNDGG |
| Ga0318518_102923281 | 3300032090 | Soil | MRRRDFIPLLGGGAFLFLCVNAAAQEGYYGMGHDKWHQGFYSQLRRNDG |
| Ga0307471_1015678471 | 3300032180 | Hardwood Forest Soil | MKRREFITLLGGAISLFLCVSATAQEGYYGVGHDKW |
| Ga0307472_1024431281 | 3300032205 | Hardwood Forest Soil | MKRREFITLLGGALSAFHCVSALAQEGYYGAGHDKWH |
| Ga0306920_1040957591 | 3300032261 | Soil | MLDMKRREFITLLGGAASLFFCVNAAAQEGYYGAGHDKWH |
| Ga0318519_104821542 | 3300033290 | Soil | MKRREFITLLGGAASLLFCVNAAAQEGYYGAGHDKW |
| ⦗Top⦘ |