


| Basic Information | |
|---|---|
| Family ID | F020611 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 223 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQLDTIECESA |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 223 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.21 % |
| % of genes near scaffold ends (potentially truncated) | 91.93 % |
| % of genes from short scaffolds (< 2000 bps) | 96.41 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.955 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.386 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.534 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 11.59% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 223 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 9.42 |
| PF07969 | Amidohydro_3 | 1.79 |
| PF04392 | ABC_sub_bind | 1.35 |
| PF03401 | TctC | 0.90 |
| PF00912 | Transgly | 0.90 |
| PF01979 | Amidohydro_1 | 0.90 |
| PF13191 | AAA_16 | 0.45 |
| PF00550 | PP-binding | 0.45 |
| PF00501 | AMP-binding | 0.45 |
| PF13305 | TetR_C_33 | 0.45 |
| PF05974 | DUF892 | 0.45 |
| PF09361 | Phasin_2 | 0.45 |
| PF13467 | RHH_4 | 0.45 |
| PF13551 | HTH_29 | 0.45 |
| PF01344 | Kelch_1 | 0.45 |
| PF03979 | Sigma70_r1_1 | 0.45 |
| PF08734 | GYD | 0.45 |
| PF13202 | EF-hand_5 | 0.45 |
| PF02515 | CoA_transf_3 | 0.45 |
| PF00300 | His_Phos_1 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 223 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.35 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.90 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.45 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.45 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.45 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.40 % |
| Unclassified | root | N/A | 29.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01AZ4BO | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium radiotolerans | 520 | Open in IMG/M |
| 3300000891|JGI10214J12806_12432306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis | 545 | Open in IMG/M |
| 3300000955|JGI1027J12803_100509797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini | 649 | Open in IMG/M |
| 3300000955|JGI1027J12803_102357706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1416 | Open in IMG/M |
| 3300002568|C688J35102_119550931 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300004480|Ga0062592_101372543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis | 671 | Open in IMG/M |
| 3300005181|Ga0066678_10547362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300005187|Ga0066675_10327649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1114 | Open in IMG/M |
| 3300005187|Ga0066675_11369579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 519 | Open in IMG/M |
| 3300005329|Ga0070683_101383051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300005329|Ga0070683_101429069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 665 | Open in IMG/M |
| 3300005332|Ga0066388_102589011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300005332|Ga0066388_104429595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 715 | Open in IMG/M |
| 3300005332|Ga0066388_106629621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium YIM 77505 | 583 | Open in IMG/M |
| 3300005332|Ga0066388_108233048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 520 | Open in IMG/M |
| 3300005338|Ga0068868_102197241 | Not Available | 526 | Open in IMG/M |
| 3300005363|Ga0008090_10063817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 672 | Open in IMG/M |
| 3300005363|Ga0008090_15397344 | Not Available | 947 | Open in IMG/M |
| 3300005437|Ga0070710_10631787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
| 3300005535|Ga0070684_100803599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 879 | Open in IMG/M |
| 3300005539|Ga0068853_102272701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300005540|Ga0066697_10164544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1313 | Open in IMG/M |
| 3300005546|Ga0070696_101832523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis | 525 | Open in IMG/M |
| 3300005553|Ga0066695_10511455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300005553|Ga0066695_10796104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 546 | Open in IMG/M |
| 3300005559|Ga0066700_10893960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 591 | Open in IMG/M |
| 3300005564|Ga0070664_102292636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium YIM 77505 | 512 | Open in IMG/M |
| 3300005713|Ga0066905_100445297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1063 | Open in IMG/M |
| 3300005713|Ga0066905_101215433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 674 | Open in IMG/M |
| 3300005764|Ga0066903_102417358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
| 3300005764|Ga0066903_103980334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300005764|Ga0066903_104007509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 790 | Open in IMG/M |
| 3300005764|Ga0066903_104365014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 755 | Open in IMG/M |
| 3300005764|Ga0066903_105403635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300005764|Ga0066903_106775836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium YIM 77505 | 595 | Open in IMG/M |
| 3300005764|Ga0066903_107821323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 174MFSha1.1 | 549 | Open in IMG/M |
| 3300005840|Ga0068870_11397019 | Not Available | 513 | Open in IMG/M |
| 3300005937|Ga0081455_10703972 | Not Available | 643 | Open in IMG/M |
| 3300006028|Ga0070717_10565034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1031 | Open in IMG/M |
| 3300006034|Ga0066656_10541888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300006046|Ga0066652_100333604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1359 | Open in IMG/M |
| 3300006046|Ga0066652_101416554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium YIM 77505 | 649 | Open in IMG/M |
| 3300006046|Ga0066652_102097954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 500 | Open in IMG/M |
| 3300006163|Ga0070715_10793404 | Not Available | 574 | Open in IMG/M |
| 3300006173|Ga0070716_100396879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 991 | Open in IMG/M |
| 3300006791|Ga0066653_10270677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 863 | Open in IMG/M |
| 3300006791|Ga0066653_10309177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300006797|Ga0066659_11252226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 619 | Open in IMG/M |
| 3300006845|Ga0075421_100333981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1835 | Open in IMG/M |
| 3300006853|Ga0075420_101110125 | Not Available | 680 | Open in IMG/M |
| 3300006969|Ga0075419_10212889 | Not Available | 1283 | Open in IMG/M |
| 3300009012|Ga0066710_101785253 | Not Available | 930 | Open in IMG/M |
| 3300009098|Ga0105245_11974234 | Not Available | 637 | Open in IMG/M |
| 3300009100|Ga0075418_12354039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300009137|Ga0066709_100752998 | Not Available | 1406 | Open in IMG/M |
| 3300009137|Ga0066709_102066822 | Not Available | 788 | Open in IMG/M |
| 3300009147|Ga0114129_11170378 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300009156|Ga0111538_13262552 | Not Available | 565 | Open in IMG/M |
| 3300009162|Ga0075423_12067500 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009162|Ga0075423_12514641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 562 | Open in IMG/M |
| 3300010043|Ga0126380_12019590 | Not Available | 528 | Open in IMG/M |
| 3300010046|Ga0126384_10278095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300010047|Ga0126382_11131482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300010048|Ga0126373_10220303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1850 | Open in IMG/M |
| 3300010048|Ga0126373_12098926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300010303|Ga0134082_10344266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 630 | Open in IMG/M |
| 3300010304|Ga0134088_10590868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 552 | Open in IMG/M |
| 3300010322|Ga0134084_10066070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
| 3300010337|Ga0134062_10709202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 529 | Open in IMG/M |
| 3300010358|Ga0126370_12366945 | Not Available | 527 | Open in IMG/M |
| 3300010359|Ga0126376_12721049 | Not Available | 544 | Open in IMG/M |
| 3300010359|Ga0126376_13038131 | Not Available | 519 | Open in IMG/M |
| 3300010360|Ga0126372_10119021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2036 | Open in IMG/M |
| 3300010360|Ga0126372_10504505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1137 | Open in IMG/M |
| 3300010361|Ga0126378_10931784 | Not Available | 974 | Open in IMG/M |
| 3300010361|Ga0126378_11736861 | Not Available | 709 | Open in IMG/M |
| 3300010361|Ga0126378_13075754 | Not Available | 531 | Open in IMG/M |
| 3300010398|Ga0126383_11242719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300010398|Ga0126383_11435565 | Not Available | 780 | Open in IMG/M |
| 3300010868|Ga0124844_1230986 | Not Available | 661 | Open in IMG/M |
| 3300012198|Ga0137364_11081602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 604 | Open in IMG/M |
| 3300012199|Ga0137383_10599201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300012200|Ga0137382_10181853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1439 | Open in IMG/M |
| 3300012201|Ga0137365_10504859 | Not Available | 889 | Open in IMG/M |
| 3300012201|Ga0137365_10756223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 710 | Open in IMG/M |
| 3300012202|Ga0137363_10764110 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300012205|Ga0137362_10843752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300012206|Ga0137380_10965772 | Not Available | 730 | Open in IMG/M |
| 3300012208|Ga0137376_10951986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300012211|Ga0137377_11667260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 560 | Open in IMG/M |
| 3300012350|Ga0137372_10055753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3464 | Open in IMG/M |
| 3300012350|Ga0137372_11129353 | Not Available | 535 | Open in IMG/M |
| 3300012353|Ga0137367_10784421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 662 | Open in IMG/M |
| 3300012354|Ga0137366_10317824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1143 | Open in IMG/M |
| 3300012356|Ga0137371_10396343 | Not Available | 1070 | Open in IMG/M |
| 3300012357|Ga0137384_11219928 | Not Available | 597 | Open in IMG/M |
| 3300012359|Ga0137385_10851802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300012362|Ga0137361_10716368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 913 | Open in IMG/M |
| 3300012363|Ga0137390_10089155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3041 | Open in IMG/M |
| 3300012406|Ga0134053_1028237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 638 | Open in IMG/M |
| 3300012582|Ga0137358_10259777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
| 3300012683|Ga0137398_10580193 | Not Available | 775 | Open in IMG/M |
| 3300012918|Ga0137396_10961320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 622 | Open in IMG/M |
| 3300012923|Ga0137359_10635698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 934 | Open in IMG/M |
| 3300012930|Ga0137407_11530848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 635 | Open in IMG/M |
| 3300012930|Ga0137407_11948760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 560 | Open in IMG/M |
| 3300012948|Ga0126375_10636021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 821 | Open in IMG/M |
| 3300012971|Ga0126369_10496788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1277 | Open in IMG/M |
| 3300012976|Ga0134076_10334779 | Not Available | 662 | Open in IMG/M |
| 3300012977|Ga0134087_10600745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 570 | Open in IMG/M |
| 3300013297|Ga0157378_10093666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2735 | Open in IMG/M |
| 3300013297|Ga0157378_11236363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 787 | Open in IMG/M |
| 3300013306|Ga0163162_11839768 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300015077|Ga0173483_10082162 | Not Available | 1304 | Open in IMG/M |
| 3300015077|Ga0173483_10246229 | Not Available | 848 | Open in IMG/M |
| 3300015242|Ga0137412_10329183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300015374|Ga0132255_103571679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300016270|Ga0182036_11085182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 662 | Open in IMG/M |
| 3300016270|Ga0182036_11719619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 530 | Open in IMG/M |
| 3300016294|Ga0182041_12259964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 509 | Open in IMG/M |
| 3300016341|Ga0182035_10276191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1368 | Open in IMG/M |
| 3300016341|Ga0182035_10519157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1019 | Open in IMG/M |
| 3300016341|Ga0182035_11634851 | Not Available | 581 | Open in IMG/M |
| 3300016357|Ga0182032_10736160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 830 | Open in IMG/M |
| 3300016387|Ga0182040_11613099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 553 | Open in IMG/M |
| 3300016422|Ga0182039_10455290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1097 | Open in IMG/M |
| 3300016422|Ga0182039_11751354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300017654|Ga0134069_1017898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2108 | Open in IMG/M |
| 3300018027|Ga0184605_10082365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1405 | Open in IMG/M |
| 3300018067|Ga0184611_1302178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 556 | Open in IMG/M |
| 3300018082|Ga0184639_10404398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| 3300018431|Ga0066655_10387469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300018431|Ga0066655_10685109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 694 | Open in IMG/M |
| 3300018433|Ga0066667_12276706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300018469|Ga0190270_12662026 | Not Available | 563 | Open in IMG/M |
| 3300018482|Ga0066669_10693665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
| 3300021086|Ga0179596_10692729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 516 | Open in IMG/M |
| 3300025911|Ga0207654_11451223 | Not Available | 500 | Open in IMG/M |
| 3300025929|Ga0207664_11253947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 660 | Open in IMG/M |
| 3300025944|Ga0207661_11139807 | Not Available | 718 | Open in IMG/M |
| 3300026041|Ga0207639_10198678 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300026118|Ga0207675_101501880 | Not Available | 694 | Open in IMG/M |
| 3300026296|Ga0209235_1271371 | Not Available | 519 | Open in IMG/M |
| 3300026323|Ga0209472_1180189 | Not Available | 753 | Open in IMG/M |
| 3300026499|Ga0257181_1077715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300027643|Ga0209076_1184526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 576 | Open in IMG/M |
| 3300027748|Ga0209689_1049844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2354 | Open in IMG/M |
| 3300027748|Ga0209689_1187284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 927 | Open in IMG/M |
| 3300027882|Ga0209590_10764926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 615 | Open in IMG/M |
| 3300027903|Ga0209488_10556654 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300027903|Ga0209488_10853294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 642 | Open in IMG/M |
| 3300027907|Ga0207428_10609914 | Not Available | 786 | Open in IMG/M |
| 3300028592|Ga0247822_10864322 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300028782|Ga0307306_10087992 | Not Available | 816 | Open in IMG/M |
| 3300028790|Ga0307283_10102651 | Not Available | 749 | Open in IMG/M |
| 3300028799|Ga0307284_10375365 | Not Available | 577 | Open in IMG/M |
| 3300028807|Ga0307305_10251254 | Not Available | 808 | Open in IMG/M |
| 3300028878|Ga0307278_10465457 | Not Available | 553 | Open in IMG/M |
| 3300030987|Ga0308155_1025812 | Not Available | 566 | Open in IMG/M |
| 3300030987|Ga0308155_1033045 | Not Available | 525 | Open in IMG/M |
| 3300031422|Ga0308186_1041316 | Not Available | 502 | Open in IMG/M |
| 3300031446|Ga0170820_12817566 | Not Available | 626 | Open in IMG/M |
| 3300031543|Ga0318516_10211020 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300031545|Ga0318541_10780523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 533 | Open in IMG/M |
| 3300031564|Ga0318573_10267328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 913 | Open in IMG/M |
| 3300031564|Ga0318573_10653603 | Not Available | 565 | Open in IMG/M |
| 3300031573|Ga0310915_10372989 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300031679|Ga0318561_10271727 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300031679|Ga0318561_10403548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300031680|Ga0318574_10538940 | Not Available | 684 | Open in IMG/M |
| 3300031681|Ga0318572_10087377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1740 | Open in IMG/M |
| 3300031681|Ga0318572_10284027 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300031681|Ga0318572_10544014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300031681|Ga0318572_10985515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 501 | Open in IMG/M |
| 3300031682|Ga0318560_10328990 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031713|Ga0318496_10084777 | Not Available | 1686 | Open in IMG/M |
| 3300031713|Ga0318496_10389133 | Not Available | 770 | Open in IMG/M |
| 3300031719|Ga0306917_10638245 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus tanneri | 837 | Open in IMG/M |
| 3300031719|Ga0306917_11120285 | Not Available | 612 | Open in IMG/M |
| 3300031720|Ga0307469_10999776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300031720|Ga0307469_12366882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300031724|Ga0318500_10709678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 513 | Open in IMG/M |
| 3300031740|Ga0307468_100531508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 941 | Open in IMG/M |
| 3300031740|Ga0307468_102073290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 547 | Open in IMG/M |
| 3300031744|Ga0306918_10684651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300031744|Ga0306918_11230084 | Not Available | 577 | Open in IMG/M |
| 3300031751|Ga0318494_10428428 | Not Available | 768 | Open in IMG/M |
| 3300031768|Ga0318509_10014761 | All Organisms → cellular organisms → Bacteria | 3501 | Open in IMG/M |
| 3300031770|Ga0318521_10783902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 580 | Open in IMG/M |
| 3300031777|Ga0318543_10149631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300031780|Ga0318508_1024199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1499 | Open in IMG/M |
| 3300031782|Ga0318552_10448697 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031805|Ga0318497_10826821 | Not Available | 519 | Open in IMG/M |
| 3300031833|Ga0310917_10152131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1527 | Open in IMG/M |
| 3300031879|Ga0306919_10941762 | Not Available | 661 | Open in IMG/M |
| 3300031879|Ga0306919_11317389 | Not Available | 546 | Open in IMG/M |
| 3300031890|Ga0306925_11084480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300031890|Ga0306925_11858967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 574 | Open in IMG/M |
| 3300031890|Ga0306925_12230093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39 | 508 | Open in IMG/M |
| 3300031896|Ga0318551_10542828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 669 | Open in IMG/M |
| 3300031942|Ga0310916_10866246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 758 | Open in IMG/M |
| 3300031947|Ga0310909_10330863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1278 | Open in IMG/M |
| 3300031947|Ga0310909_11086819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300031947|Ga0310909_11235498 | Not Available | 603 | Open in IMG/M |
| 3300031954|Ga0306926_10640439 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300031981|Ga0318531_10458028 | Not Available | 578 | Open in IMG/M |
| 3300032001|Ga0306922_11138914 | Not Available | 797 | Open in IMG/M |
| 3300032041|Ga0318549_10129746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300032042|Ga0318545_10211842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300032051|Ga0318532_10183067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300032051|Ga0318532_10201456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300032054|Ga0318570_10451554 | Not Available | 586 | Open in IMG/M |
| 3300032059|Ga0318533_10358338 | Not Available | 1062 | Open in IMG/M |
| 3300032066|Ga0318514_10541558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 620 | Open in IMG/M |
| 3300032068|Ga0318553_10470589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 658 | Open in IMG/M |
| 3300032076|Ga0306924_10059129 | Not Available | 4252 | Open in IMG/M |
| 3300032076|Ga0306924_10490973 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300032205|Ga0307472_101722633 | Not Available | 620 | Open in IMG/M |
| 3300032261|Ga0306920_100508512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1787 | Open in IMG/M |
| 3300032261|Ga0306920_101325862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300033289|Ga0310914_10858867 | Not Available | 806 | Open in IMG/M |
| 3300033290|Ga0318519_10230216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1066 | Open in IMG/M |
| 3300034643|Ga0370545_092714 | Not Available | 647 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00333850 | 2170459010 | Grass Soil | MEQAEQEHRAILIVEDDAALRSLAAALFEDEQVNTIECESAEAA |
| JGI10214J12806_124323061 | 3300000891 | Soil | MGQADRKHRAVLIVEDDAELRGLTAALLEEELETI |
| JGI1027J12803_1005097971 | 3300000955 | Soil | MGQAQQKRRAVLIVEDDAGLRELTAALLEDSKLELDIIECETAEAALATMLIRGR |
| JGI1027J12803_1023577061 | 3300000955 | Soil | VGQEHQKRRAVLIVEDDAELRSLTAAFLEDEQLATIE |
| C688J35102_1195509312 | 3300002568 | Soil | MEQAEHEHRAILIVEDDAALRSLAAALFEDEQVNTIECESAEA |
| Ga0062592_1013725431 | 3300004480 | Soil | MGQADRKHRAVLIVEDDAELRGLTAALLEEELETIECESAEAALAMMLIRG |
| Ga0066678_105473621 | 3300005181 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQMDTIECES |
| Ga0066675_103276491 | 3300005187 | Soil | MGQAHQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAALATLL |
| Ga0066675_113695792 | 3300005187 | Soil | MGHTQQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAALATLL |
| Ga0070683_1013830512 | 3300005329 | Corn Rhizosphere | MEQAEQEHRAILIVEDDAALRSLAAALFEDEQVNTIECESAEAAL |
| Ga0070683_1014290691 | 3300005329 | Corn Rhizosphere | MGQGLSKRRTVLIVEDDLDLLHLTTKLLEDEQLETIECESAEAALA |
| Ga0066388_1025890113 | 3300005332 | Tropical Forest Soil | MGQAHQKRRTILIVEDDAELRSLTTALFENEQVDTIECESAE |
| Ga0066388_1044295953 | 3300005332 | Tropical Forest Soil | GQAQQKRRAVLIVEDDPELRSLTAALFEDEQVETIECESAAGGLRSP* |
| Ga0066388_1066296211 | 3300005332 | Tropical Forest Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAEAALATLLIGGREV |
| Ga0066388_1082330482 | 3300005332 | Tropical Forest Soil | MNMGQAQQNRRAVLIVEDDAELRGFAARLLEDGELDTIGCESAEAAL |
| Ga0068868_1021972412 | 3300005338 | Miscanthus Rhizosphere | MGQAQQTRGAVLIVEDDAELRGLTVALLENEQLDTIECES |
| Ga0008090_100638171 | 3300005363 | Tropical Rainforest Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESA |
| Ga0008090_153973442 | 3300005363 | Tropical Rainforest Soil | MGQAQQKRRTVMIVEDDAELRSLTAALFEDEQVDTIECESAEA |
| Ga0070710_106317871 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQAQQKRRTVLIVEDDARLRSLTAALFEDGQLETIECVATLLIGGHEDDLRRCPASRRHGRH* |
| Ga0070684_1008035991 | 3300005535 | Corn Rhizosphere | MGQGLSKRRTVLIVEDDLDLLHLTTKLLEDEQLETIECESAEAALAIMLM |
| Ga0068853_1022727012 | 3300005539 | Corn Rhizosphere | MGQAQQTRGAVLIVEDDAELRSLTVALLKDEQLDTIECESAEAALAVMLIGG |
| Ga0066697_101645443 | 3300005540 | Soil | MGQAHQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAALAT |
| Ga0070696_1018325231 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQAQQEYRAILIVEDDAELRSLAAALFEDEQVNTIECESAEAALAIMLIG |
| Ga0066695_105114553 | 3300005553 | Soil | MMGQGPQKRRAVLIVEDDAELRHLMAALFEDEQMD |
| Ga0066695_107961041 | 3300005553 | Soil | MRQAQQKRRAVMIVEDDAELRSLTASLLEDEQLDTIECESAE |
| Ga0066700_108939602 | 3300005559 | Soil | MGQAQQTRRAVLVVEDDADLRHLMAALFEDEQMDT |
| Ga0070664_1022926361 | 3300005564 | Corn Rhizosphere | MGQAQQKYRAVLIVEDDAELRSLTAALLKDEEIVTIECESAEAALA |
| Ga0066905_1004452974 | 3300005713 | Tropical Forest Soil | MGQGQQKRLGQGQQKRRAVLIVEDDVELRSLTAALFEDEQMDIIECES |
| Ga0066905_1012154332 | 3300005713 | Tropical Forest Soil | MGQGQQKRRAVLIVEDDAELRHLTAALFEDEKLDTIECESAEAGLQSC* |
| Ga0066903_1024173582 | 3300005764 | Tropical Forest Soil | MMGPDIQGMGPMGQAQQKRRAVLLVEDDAELRDLTATLLDEEFDTIECESAEAALA |
| Ga0066903_1039803341 | 3300005764 | Tropical Forest Soil | MMGPDIQGMGMGQAQQKRRAVLLVEDDAELRDLTAKLLDEEFDTIECESAEAALATML |
| Ga0066903_1040075091 | 3300005764 | Tropical Forest Soil | MGQAQQKRRAVLIVEDDAEVRSVTAALFQDEQLDTIECESAE |
| Ga0066903_1043650142 | 3300005764 | Tropical Forest Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESAE |
| Ga0066903_1054036351 | 3300005764 | Tropical Forest Soil | MGQAQQKRRAVLEDDTELRSLTAALFEDEQVETIECESAEAALATLLIGGREVAM |
| Ga0066903_1067758361 | 3300005764 | Tropical Forest Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVET |
| Ga0066903_1078213231 | 3300005764 | Tropical Forest Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTIEC |
| Ga0068870_113970191 | 3300005840 | Miscanthus Rhizosphere | VGQAQQTRGAVLIVEDDAELRSLTVALLEDEQLDTIECESAEAA |
| Ga0081455_107039721 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGQAQRKHRAVLIVEDDADLRHLTAAMLEDEQLDTIQCESA |
| Ga0070717_105650342 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEQTQQIRRAVLVVEDDAELRRFAARLLEDGELDTIECESAEAALATMLI |
| Ga0066656_105418882 | 3300006034 | Soil | MGQAQQKRRAVLIVEDDAELRHLMAALFEDEQVDTIECESAE |
| Ga0066652_1003336041 | 3300006046 | Soil | MGSAASERRTVLIVEDDAELRALIVMLFEDSDLEIV |
| Ga0066652_1014165541 | 3300006046 | Soil | MGQAHQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAAL |
| Ga0066652_1020979543 | 3300006046 | Soil | MGHTQQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAAL |
| Ga0070715_107934042 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQAVPKHRTILIVEDDAELRSLTAALLEDEQVDTIECES |
| Ga0070716_1003968791 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRAQQKRRTVLIVEDDAELRSLTAALFEDEQLETIECESAEAALATLLIG |
| Ga0066653_102706772 | 3300006791 | Soil | MMGQGPQKRRAVLIVEDDAELRHLMAALFEDEQMDTIECESAEAALATLLIGGRGRHDLRGRPASRRHERH* |
| Ga0066653_103091771 | 3300006791 | Soil | MGQAQQKRRAVLIVEDDAELRHLTAALFEDEQMDTIECESAEAALATLLIGG |
| Ga0066659_112522261 | 3300006797 | Soil | MGQAQQTRRAVLVVEDDADLRHLMAALFEDEQMDTIECESAE |
| Ga0075421_1003339813 | 3300006845 | Populus Rhizosphere | VGQEHQKRRAVLIVEDDAELRSLTAAFLEDEQLAT |
| Ga0075420_1011101252 | 3300006853 | Populus Rhizosphere | MGQAQQRRPAVLIVEDDAAVRQVTMALLEDAHVDTIECESA |
| Ga0075419_102128891 | 3300006969 | Populus Rhizosphere | LVVGQEKQKRRAVLIVEDDAELRELTAALLEDEQLDTVECESAEA |
| Ga0066710_1017852533 | 3300009012 | Grasslands Soil | MGQAQQKSRAVLIVEDDAEVRSLAATLLEDEHLNTIECESAEAALCDHVDGRT |
| Ga0105245_119742341 | 3300009098 | Miscanthus Rhizosphere | VGQAQQTRGAVLIVEDDAELRSLTVALLEDAQLDTIECESA |
| Ga0075418_123540391 | 3300009100 | Populus Rhizosphere | MGQPQKRRAVLIVEDDAELRSLTAALLADGQVVTIECESAEAALAVMLIDGREVA |
| Ga0066709_1007529983 | 3300009137 | Grasslands Soil | MGQSQQKLIVEDDAELRSLTAALFEDEQLEIIECESAEAALLIGGRKHEPI |
| Ga0066709_1020668222 | 3300009137 | Grasslands Soil | MGQAQPKRPTALIVEDDAELRSLTAALLEEEQLDTIE |
| Ga0114129_111703781 | 3300009147 | Populus Rhizosphere | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECES |
| Ga0111538_132625521 | 3300009156 | Populus Rhizosphere | MGQALPERRTILIVEDDAELRSLTAALLKDEQLDTIEC |
| Ga0075423_120675002 | 3300009162 | Populus Rhizosphere | MGQAQQNRRAVLVVEDDAELRRLAARLLEDGELDTIECESDREAGYPQRS* |
| Ga0075423_125146411 | 3300009162 | Populus Rhizosphere | MGQVQQKRRAVLIVEDDAELRRLTAALLEDGNLDTIECESAEAALA |
| Ga0126380_120195902 | 3300010043 | Tropical Forest Soil | MGQAQPKRRTALIVEDDAELRSLTAALLEEEQLEAIE |
| Ga0126384_102780953 | 3300010046 | Tropical Forest Soil | MEQAQQNRRAVLIVEDDAELRRFAARLLEDGELDTIE |
| Ga0126382_111314823 | 3300010047 | Tropical Forest Soil | MGQAQPKRRTALIVEDDAELRSLTAALLGEEQLDTIECQSA* |
| Ga0126373_102203031 | 3300010048 | Tropical Forest Soil | MATNAQGSLIMGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAEAALATL |
| Ga0126373_120989261 | 3300010048 | Tropical Forest Soil | MGRAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAEAALATL |
| Ga0134082_103442661 | 3300010303 | Grasslands Soil | MGQAQQTRRAVLVVEDDADLRHLMAALFEDEQIATIECESAEAALATLLIGG |
| Ga0134088_105908681 | 3300010304 | Grasslands Soil | MGHTQQKRRAVLIVEDDAELRSLTAALFEDEQMDAIEFESAEAALATLLIGG |
| Ga0134084_100660701 | 3300010322 | Grasslands Soil | MGQAQPKHRTALIVEDYAELRSLTAALLGEEQLETIECES |
| Ga0134062_107092021 | 3300010337 | Grasslands Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQIDTIECESAEAALAIMLIGGR |
| Ga0126370_123669451 | 3300010358 | Tropical Forest Soil | MGQAQPKRRTALIVEDDAELRSLTAALLEEEQLDT |
| Ga0126376_127210492 | 3300010359 | Tropical Forest Soil | MGQAQQNRRAVLIVEDDAELREFVARLLEDGELDTIECE |
| Ga0126376_130381311 | 3300010359 | Tropical Forest Soil | MGEAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECE |
| Ga0126372_101190214 | 3300010360 | Tropical Forest Soil | MGEAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESAEA |
| Ga0126372_105045052 | 3300010360 | Tropical Forest Soil | MGQAQQKRRAVLIVEDDPELRSLTAALFEDEQVETIECESAAGGLRSP* |
| Ga0126378_109317841 | 3300010361 | Tropical Forest Soil | MGQAQPKRRTALIVEDDAELRSLTAALLEEEQLDTIEC |
| Ga0126378_117368612 | 3300010361 | Tropical Forest Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECE |
| Ga0126378_130757541 | 3300010361 | Tropical Forest Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTIE |
| Ga0126383_112427191 | 3300010398 | Tropical Forest Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAEAALATLLI |
| Ga0126383_114355651 | 3300010398 | Tropical Forest Soil | MDQSRRAVLIVEDDAVLRELTAAMLEDSELDSIDESAEAAL |
| Ga0124844_12309862 | 3300010868 | Tropical Forest Soil | MGQAQPKCRAVLIVEDDAELRCLTAALLEDEQVET |
| Ga0137364_110816021 | 3300012198 | Vadose Zone Soil | MGQVQQKRRAVLVVEDDADLRHLMAALFEDEQMDTIECESAE |
| Ga0137383_105992012 | 3300012199 | Vadose Zone Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQMDTIECESAEAALATLLIG |
| Ga0137382_101818534 | 3300012200 | Vadose Zone Soil | MGQAQQKHRAVVIVEDDAELCSLTAALFEDEQMDTIECEAQKLR* |
| Ga0137365_105048591 | 3300012201 | Vadose Zone Soil | MGQAQQKRRAVLILEDNAELRSLTAMLFEDEQLDITDRRA* |
| Ga0137365_107562232 | 3300012201 | Vadose Zone Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAE |
| Ga0137363_107641101 | 3300012202 | Vadose Zone Soil | MGQAQQKRRALLIVEDDAELRSLTAALFEDEQMDTIECESAEAALATL |
| Ga0137362_108437521 | 3300012205 | Vadose Zone Soil | MGQAQQKRRALLIVEDDAELRSLRAALFEDEQMDTIECESAEAALATL |
| Ga0137380_109657722 | 3300012206 | Vadose Zone Soil | MGQAQQKRRPVLIVEDEAELRGLAAALLEDSDFDTIECE |
| Ga0137376_109519861 | 3300012208 | Vadose Zone Soil | MGQARQKRHAVLIVEDDAERSLTAALLEDEQLDTIRM* |
| Ga0137377_116672601 | 3300012211 | Vadose Zone Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVDTIECESAEAALATL |
| Ga0137372_100557531 | 3300012350 | Vadose Zone Soil | MGQVQQKRRAVLVVEDDADLRHLMAALFEDEQMDTIECESAEAALATLLIG |
| Ga0137372_111293531 | 3300012350 | Vadose Zone Soil | MGQEQQRHCAVLIVEDDAELRSLMAALFEDEQVDTIECESA |
| Ga0137367_107844211 | 3300012353 | Vadose Zone Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDT |
| Ga0137366_103178241 | 3300012354 | Vadose Zone Soil | MGQAQQKHRAVLIVEDDADIRSLTAALLEDDQLDTI |
| Ga0137371_103963432 | 3300012356 | Vadose Zone Soil | MGQAQPKHRTALIVEDDAELRSLTAALLEAEHLDTNECQSAEAAL |
| Ga0137384_112199281 | 3300012357 | Vadose Zone Soil | MEQAQQKRRAVLIVEDDAELRSLTAALLEDEQLDTIE |
| Ga0137385_108518023 | 3300012359 | Vadose Zone Soil | MGQAQQNRRAVLIVEDDAELRGFAARLLEDGELDTI |
| Ga0137361_107163682 | 3300012362 | Vadose Zone Soil | MGQGQQKRRAVLIVEDDAELRHLSAALFEDEKLDTIECE |
| Ga0137390_100891551 | 3300012363 | Vadose Zone Soil | MGQAQQKRRALLIVEDDAELRSLTAALFEDEQMDTIEC |
| Ga0134053_10282371 | 3300012406 | Grasslands Soil | MGQAQQKHRAVLIVEDDAELRSLMAALFEDEQVDTIECESAEAALATL |
| Ga0137358_102597771 | 3300012582 | Vadose Zone Soil | MGQAQQKRRAVLVVEDDAELRHLTAALFEDEAALFEDEKVDTIECE |
| Ga0137398_105801931 | 3300012683 | Vadose Zone Soil | MGQAQQTRGAVLIVEDDAELRSLTVALLEDEQLDTIEC |
| Ga0137396_109613201 | 3300012918 | Vadose Zone Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEAALFE |
| Ga0137359_106356982 | 3300012923 | Vadose Zone Soil | MGQAQQKRRALLIVEDDAELRSLTAALFEDEQMDTIECESAE |
| Ga0137407_115308482 | 3300012930 | Vadose Zone Soil | MGQEQQRHCAVLIVEDDAELRSLMAALFEDEQVDTIECESAEAALATLLIGGREVA |
| Ga0137407_119487601 | 3300012930 | Vadose Zone Soil | MGQSQQKRRAVLIVEDDAELRSLMAALFEAEQLDTIECESAEAALATP |
| Ga0126375_106360211 | 3300012948 | Tropical Forest Soil | MGQAQQNRRAVLIVEDDAELRGFAARLLEDGELDTIECESA* |
| Ga0126369_104967883 | 3300012971 | Tropical Forest Soil | MGQAQPKRRAVLIVGDDAELRGLTAALFEDEQVETIACESAE |
| Ga0134076_103347792 | 3300012976 | Grasslands Soil | MGQAQPKRRTALIVEDDAELRSLTAALLEEEQLDTI* |
| Ga0134087_106007452 | 3300012977 | Grasslands Soil | MGQAHQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAALATLLI |
| Ga0157378_100936663 | 3300013297 | Miscanthus Rhizosphere | MEQAEQEHRAILIVEDDAALRSLAAALFEDEQVNTIECESAEAALAI |
| Ga0157378_112363631 | 3300013297 | Miscanthus Rhizosphere | MEQAEREHRAILIVEDDAALRSLAAALFEDEQVNTIECESAEAALAI |
| Ga0163162_118397681 | 3300013306 | Switchgrass Rhizosphere | MEQAEREHRAILIVEDDAALRSLAAALFEDEQVNTI |
| Ga0173483_100821621 | 3300015077 | Soil | MGQADRKHRAVLIVEDDAELRGLTAALLEEELETIECESAEAALAM |
| Ga0173483_102462291 | 3300015077 | Soil | MGQAEPKHRAVLIVEDDAELRGLTAALLEEELETIECESAEAALAM |
| Ga0137412_103291832 | 3300015242 | Vadose Zone Soil | MGQTQQKRRAVLIVEDDAELRHLTAALFEDEKVDTI* |
| Ga0132255_1035716791 | 3300015374 | Arabidopsis Rhizosphere | MGQAQQKRLTIEDDAELRSLMAALFEDEQLETIECESAEAVL |
| Ga0182036_110851822 | 3300016270 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAEAALAVMLIDG |
| Ga0182036_117196192 | 3300016270 | Soil | MGQTQQKRRAVLIVEDDAELRSLTAALFEDEQVDTIECESAEAALATLLIG |
| Ga0182041_122599642 | 3300016294 | Soil | MGQGQQKRRAVLIVEDDAELRHLTAALFEDEKLDTIECESAEAALA |
| Ga0182035_102761913 | 3300016341 | Soil | MGQAHQKRRAILIVEDDAELRSLTTALFEDEQVDTIECESAEAALA |
| Ga0182035_105191572 | 3300016341 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAE |
| Ga0182035_116348511 | 3300016341 | Soil | MGQRQQKRRAVLIVEDDVELRSLTAALFEDEQVDTIECE |
| Ga0182032_107361602 | 3300016357 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAEAALAV |
| Ga0182040_116130991 | 3300016387 | Soil | MGQTQQKRRAVLIVEDDAELRSLTAALFEDEQVDTIECESAEAALATLLIGRPEAAM |
| Ga0182039_104552901 | 3300016422 | Soil | MGQAQQKRGAVLIVEDDAELRSLTAALFEDEPVDTIECESAEAALATLLIGGR |
| Ga0182039_117513541 | 3300016422 | Soil | MGQAQQQRRAILIVEDDAELRSLMAALFEDEELDTIE |
| Ga0134069_10178981 | 3300017654 | Grasslands Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQIDTIECESAEA |
| Ga0184605_100823652 | 3300018027 | Groundwater Sediment | MGQAQQEHRAILIVEDDAELRSLAAALFEDEQVNTIVCESA |
| Ga0184611_13021781 | 3300018067 | Groundwater Sediment | MGQAQQTRGAVLIVGDDAELRSLTAALLEDEQLDTIECESAEAALAVMLIGGQHV |
| Ga0184639_104043981 | 3300018082 | Groundwater Sediment | MGQAQQTRGAVLIVEDDAELRSLTVALLKDEQLDTIECESAEAA |
| Ga0066655_103874691 | 3300018431 | Grasslands Soil | MMGQGQQKRRAVLIVEDDAELRHLMAALFEDEQMDTIECE |
| Ga0066655_106851092 | 3300018431 | Grasslands Soil | MGHTQQKRRAVLIVEDDAELRSLTAALFEDEQMDAIECESAEAALA |
| Ga0066667_122767061 | 3300018433 | Grasslands Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTRV |
| Ga0190270_126620261 | 3300018469 | Soil | MNQQEHRAILIVEDDAELRSLAAALFEDEQVDTIVCESAEAA |
| Ga0066669_106936653 | 3300018482 | Grasslands Soil | MRQAQQKRRAVLIVEDDAELRHLMAALFEDEQMDTIECE |
| Ga0179596_106927291 | 3300021086 | Vadose Zone Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEAALFEDEKVDTIECESAEAALAVMLIGGR |
| Ga0207654_114512232 | 3300025911 | Corn Rhizosphere | MGQGLSKRCTVLIVEDDLDLRRLTTTLLEDEQLETIECESAEAAL |
| Ga0207664_112539472 | 3300025929 | Agricultural Soil | MGQAQQKRRTVLIVEDDAELRSLTAALFEDEQLETIECESAEAA |
| Ga0207661_111398071 | 3300025944 | Corn Rhizosphere | MGQGLSKRRTVLIVEDDLDLLHLTTKLLEDEQLETIECESAEAALAIMLMR |
| Ga0207639_101986782 | 3300026041 | Corn Rhizosphere | MEQAEQEHRAILIVEDDAALRSLAAALFEDEQVNTIECESAKARKLR |
| Ga0207675_1015018802 | 3300026118 | Switchgrass Rhizosphere | MGQAERKHRAVLIVEDDAELRGLTAALLEEELETIECESA |
| Ga0209235_12713711 | 3300026296 | Grasslands Soil | MGQEQQRHCAVLIVEDDAELRSLMAALFEDEQVDTIE |
| Ga0209472_11801891 | 3300026323 | Soil | MGQAQHKNRAVLIVEDDAEVRSLVATLLEDEQLNVIECESAEA |
| Ga0257181_10777151 | 3300026499 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEAALFEDEKVDTI |
| Ga0209076_11845261 | 3300027643 | Vadose Zone Soil | MGQAQQKRRAVLVVEDDAELRYLTAALFEDEKVDTIECESAEAALAG |
| Ga0209689_10498446 | 3300027748 | Soil | MGQAQHKNRAVLIVEDDAEVRSLVATLLEDEQLNVIECESAEAAAR |
| Ga0209689_11872841 | 3300027748 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEAALFEDEKVDTIECESAEAALAVMLIGGREVA |
| Ga0209590_107649261 | 3300027882 | Vadose Zone Soil | MGQAQQNRRAVLIVEDDAELRGFAARLLENGELDTIECESAEAAL |
| Ga0209488_105566542 | 3300027903 | Vadose Zone Soil | MGQAQQKRRALLIVEDDAELRSLTAALFEDEQMDTIECESAEAALAT |
| Ga0209488_108532942 | 3300027903 | Vadose Zone Soil | MGQAQQKRRALLIVEDDAELRSLTAALFEDEQMDTI |
| Ga0207428_106099142 | 3300027907 | Populus Rhizosphere | MGQADRKHRAVLIVEDDAELRGLTAALLEEELETIECESAEAAL |
| Ga0247822_108643222 | 3300028592 | Soil | MEQAEQEHRAILIVEDDAALRSLAAALFEDEQVNTIECESAEAALAIML |
| Ga0307306_100879921 | 3300028782 | Soil | MGQAQQTRGAVLIVEDDAELRSLTVALLEDEQLDTIECDSAEAA |
| Ga0307283_101026511 | 3300028790 | Soil | MGQAQQEHRAILIVEDDAELRSLAAALFEDEQVDTIV |
| Ga0307284_103753651 | 3300028799 | Soil | MGQAQQEHRAILIVEDDAELRSLAAALFEDEQVNTIVCESAEAALAIMLIG |
| Ga0307305_102512542 | 3300028807 | Soil | MGQAQQEHRAILIVEDDAELRSLAAALFEDEQVNTIVCESAEAALAI |
| Ga0307278_104654572 | 3300028878 | Soil | MGQAHPKRRAVLIVEDDAELRGLSAALLEEGELETIECE |
| Ga0308155_10258121 | 3300030987 | Soil | MGQAQQTRGAVLIVEDDAELRSLTVALLEDEQLDTI |
| Ga0308155_10330451 | 3300030987 | Soil | MGQEQQKHRDVLIVEDVAELRSLTAALLEDEEIDTIE |
| Ga0308186_10413161 | 3300031422 | Soil | MGQAQPKRRAVLIVEDDAELRGLSAALLEEGELETIECE |
| Ga0170820_128175661 | 3300031446 | Forest Soil | MGQAQQEHQAILIVEDDAELRSLAAALFEDEQVNTIVCESAEAALAI |
| Ga0318516_102110202 | 3300031543 | Soil | MEQAQQNRRAVLVVEDDAELRRLAARLLEDGELDTIECE |
| Ga0318541_107805231 | 3300031545 | Soil | MGQRQQKRRAVLIVEDDVELRSLTAALFEDEQMDII |
| Ga0318573_102673282 | 3300031564 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFGDERVDTIECESAEAALATLLI |
| Ga0318573_106536031 | 3300031564 | Soil | MGQAQPNRRAVLIVEDDAELRSLTAALFEDELLDTI |
| Ga0310915_103729892 | 3300031573 | Soil | MGQAQQNRRAVLVVEDDAELRRFAARLLEDGELDT |
| Ga0318561_102717271 | 3300031679 | Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDT |
| Ga0318561_104035482 | 3300031679 | Soil | MGQAHQKRRAILIVEDDAELRSLTTALFEDEQVDTIECESAEAALAILL |
| Ga0318574_105389401 | 3300031680 | Soil | MGQAQQNRRAVLIVEDDAELRGFAARLLEDGELDTIECE |
| Ga0318572_100873773 | 3300031681 | Soil | MGQAQQNRRAVLIVEDDAELRGFAARLLEDGELDTIECESAEA |
| Ga0318572_102840271 | 3300031681 | Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESAEAAL |
| Ga0318572_105440142 | 3300031681 | Soil | MGQAHQKRRAILIVEDDAELRSLTTALFEDEQVDTIE |
| Ga0318572_109855152 | 3300031681 | Soil | MGQGQQKRRAVLIVEDDAELRHLTAALFEDEKLDTIEC |
| Ga0318560_103289901 | 3300031682 | Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESAEAA |
| Ga0318496_100847771 | 3300031713 | Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECES |
| Ga0318496_103891333 | 3300031713 | Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDSELDTI |
| Ga0306917_106382453 | 3300031719 | Soil | MGQSQQKRRAVLIVEDDAELRSLTAALFEDEDWTS |
| Ga0306917_111202851 | 3300031719 | Soil | MGQAQENRRAVLIVEDDAELREFAARLLEDGELDTI |
| Ga0307469_109997762 | 3300031720 | Hardwood Forest Soil | MGQAQQTRGAVLIVEDDAELRSLTVALLKDEQLDTIECESAELR |
| Ga0307469_123668821 | 3300031720 | Hardwood Forest Soil | MGQPQKRRAVLIVEDDAELRSLTAALLADGQVVTIECES |
| Ga0318500_107096781 | 3300031724 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAEAALAVM |
| Ga0307468_1005315083 | 3300031740 | Hardwood Forest Soil | KQKRGAVLIVEDDAELRSLTVALLKDEQLDTIECESAELR |
| Ga0307468_1020732901 | 3300031740 | Hardwood Forest Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQLDTIECESA |
| Ga0306918_106846512 | 3300031744 | Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECES |
| Ga0306918_112300841 | 3300031744 | Soil | MGQAQQNRRAVLIVEDDAELRGFAARLLEDGELDTIEC |
| Ga0318494_104284281 | 3300031751 | Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESAE |
| Ga0318509_100147611 | 3300031768 | Soil | MGQGQRKRRAVLIVEDDAELRHLTAALFEDEKLDTIECESAEAALAIL |
| Ga0318521_107839022 | 3300031770 | Soil | MGQTQQKRRAVLIVEDDAELRSLTAALFEDEQVDTIECESAEA |
| Ga0318543_101496311 | 3300031777 | Soil | MGQAQQNRRAVLIVEDEAELREFAARLLEDGELDTIECESA |
| Ga0318508_10241991 | 3300031780 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECE |
| Ga0318552_104486972 | 3300031782 | Soil | MGQAQQNRRAVLIVEDDAELREFVARLLEDGELDT |
| Ga0318497_108268211 | 3300031805 | Soil | MGEEQQKRRAVLVVEDDAELRSLTAALLEEEQLDTIVCESAEAAL |
| Ga0310917_101521311 | 3300031833 | Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIEC |
| Ga0306919_109417623 | 3300031879 | Soil | MGQVQQNRRAVLIVEDEAELRGFAARLLEDGELDTIECESAEAALAT |
| Ga0306919_113173891 | 3300031879 | Soil | MGQAQQNRRAVLIVEDEAELREFAARLLEDGELDTIEC |
| Ga0306925_110844801 | 3300031890 | Soil | MGQAQQNRRAVLIVEDEAELREFAARLLEDGELDTIECESAE |
| Ga0306925_118589671 | 3300031890 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAEAALAVMLIDGRE |
| Ga0306925_122300931 | 3300031890 | Soil | MGQRQQKRRAVLIVEDDVELRSLTAALFEDELMDIIECESAEAALATLLI |
| Ga0318551_105428281 | 3300031896 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAEAALAVMLI |
| Ga0310916_108662462 | 3300031942 | Soil | MGQGQQKRRAVLIVEDDAELRHLTAALFEDEKLDTIECESAEAALAIL |
| Ga0310909_103308632 | 3300031947 | Soil | MGRAQQKRRAVLIVEDDPDISSLTAALFEDKELDTIECARR |
| Ga0310909_110868192 | 3300031947 | Soil | MGQAQPNRRAVLIVEDDAELRSLTAALFEDELLDTIE |
| Ga0310909_112354981 | 3300031947 | Soil | MGEEQQKRRAVLVVEDDAELRSLTAALLEEEQLDTIVCES |
| Ga0306926_106404392 | 3300031954 | Soil | MGQAQQNRRAVLVVEDDAELRRFAARLLEDGELDTI |
| Ga0318531_104580281 | 3300031981 | Soil | MEQAQQNRRAVLVVEDDAELRRLAARLLEDGELDTIECESAEA |
| Ga0306922_111389141 | 3300032001 | Soil | MGQAQQNRRAVLIVEDEAELRGFAARLLEDGELDTIECESAEAA |
| Ga0318549_101297461 | 3300032041 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAVIFADVRL |
| Ga0318545_102118422 | 3300032042 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECEKRRSS |
| Ga0318532_101830671 | 3300032051 | Soil | MGQAHQKRRAILIVEDDAELRSLTTALFEDEQVDTIECESAEAALAIL |
| Ga0318532_102014561 | 3300032051 | Soil | MGQAQQNRRAVLVVEDDAELRRFAARLLEDGELDTIECESAEA |
| Ga0318570_104515541 | 3300032054 | Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIE |
| Ga0318533_103583381 | 3300032059 | Soil | MGQAQQNRRAVLIVEDDAELREFAARLLEDGELDSIECESAK |
| Ga0318514_105415581 | 3300032066 | Soil | MGQAHQKRRAILIVEDDAELRSLTTALFEDEQVDTIECESAEAALAILLI |
| Ga0318553_104705892 | 3300032068 | Soil | MGQAQQKHRAVLIVEDDAELRHLTAALFEDEKVDTIECESAEAALA |
| Ga0306924_100591292 | 3300032076 | Soil | MGQSQQKRRAVLIVEYDAELRSLTAALFEDEDWTS |
| Ga0306924_104909733 | 3300032076 | Soil | MGAQQNRRAVLIVEDDAELREFAARLLEDGELDTIECESAEA |
| Ga0307472_1017226331 | 3300032205 | Hardwood Forest Soil | MGKAQPKRRTALIVEDDAELRSLTAALLGEEQLDTI |
| Ga0306920_1005085124 | 3300032261 | Soil | MGQAHQKRRAILIVEDDAELRSLTTALFEDEQVDTIEC |
| Ga0306920_1013258623 | 3300032261 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESA |
| Ga0310914_108588671 | 3300033289 | Soil | MGEAQQNRRAVLIVEDDAELREFAARLLEDGELDT |
| Ga0318519_102302162 | 3300033290 | Soil | MGQAQQKRRAVLIVEDDAELRSLTAALFEDEQVETIECESAVIF |
| Ga0370545_092714_326_448 | 3300034643 | Soil | MERAERENRAILIVEDDAALRSLAAALFEDEQVNTNPPIG |
| ⦗Top⦘ |