


| Basic Information | |
|---|---|
| Family ID | F020263 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RTTSSGVGFQGTGAAAKPEDYAAHLLELYGKCLNAVAGKK |
| Number of Associated Samples | 183 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.67 % |
| % of genes from short scaffolds (< 2000 bps) | 85.33 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.444 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF03729 | DUF308 | 8.00 |
| PF00572 | Ribosomal_L13 | 6.67 |
| PF08442 | ATP-grasp_2 | 6.22 |
| PF12969 | DUF3857 | 6.22 |
| PF00999 | Na_H_Exchanger | 6.22 |
| PF00326 | Peptidase_S9 | 4.00 |
| PF01476 | LysM | 4.00 |
| PF02897 | Peptidase_S9_N | 2.67 |
| PF00380 | Ribosomal_S9 | 1.78 |
| PF00886 | Ribosomal_S16 | 1.33 |
| PF13442 | Cytochrome_CBB3 | 1.33 |
| PF04020 | Phage_holin_4_2 | 1.33 |
| PF13620 | CarboxypepD_reg | 0.89 |
| PF13517 | FG-GAP_3 | 0.89 |
| PF03328 | HpcH_HpaI | 0.89 |
| PF06439 | 3keto-disac_hyd | 0.89 |
| PF13506 | Glyco_transf_21 | 0.89 |
| PF00196 | GerE | 0.44 |
| PF00149 | Metallophos | 0.44 |
| PF13432 | TPR_16 | 0.44 |
| PF05239 | PRC | 0.44 |
| PF06736 | TMEM175 | 0.44 |
| PF00549 | Ligase_CoA | 0.44 |
| PF00903 | Glyoxalase | 0.44 |
| PF00383 | dCMP_cyt_deam_1 | 0.44 |
| PF05161 | MOFRL | 0.44 |
| PF07238 | PilZ | 0.44 |
| PF00318 | Ribosomal_S2 | 0.44 |
| PF08388 | GIIM | 0.44 |
| PF14559 | TPR_19 | 0.44 |
| PF16313 | DUF4953 | 0.44 |
| PF01894 | UPF0047 | 0.44 |
| PF03460 | NIR_SIR_ferr | 0.44 |
| PF14534 | DUF4440 | 0.44 |
| PF11604 | CusF_Ec | 0.44 |
| PF02629 | CoA_binding | 0.44 |
| PF00069 | Pkinase | 0.44 |
| PF02687 | FtsX | 0.44 |
| PF08240 | ADH_N | 0.44 |
| PF01960 | ArgJ | 0.44 |
| PF01663 | Phosphodiest | 0.44 |
| PF02569 | Pantoate_ligase | 0.44 |
| PF00782 | DSPc | 0.44 |
| PF01797 | Y1_Tnp | 0.44 |
| PF00198 | 2-oxoacid_dh | 0.44 |
| PF00717 | Peptidase_S24 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 12.44 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 8.00 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 6.67 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 6.67 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 6.22 |
| COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 6.22 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 6.22 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 6.22 |
| COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 6.22 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 6.22 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 6.22 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 6.22 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 2.67 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 2.67 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 1.78 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.78 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 1.33 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 1.33 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.89 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.44 |
| COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 0.44 |
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.44 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.44 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.44 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.44 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.44 |
| COG2379 | Glycerate-2-kinase | Carbohydrate transport and metabolism [G] | 0.44 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.67 % |
| Unclassified | root | N/A | 17.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16934438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 2189573004|GZGWRS402HHCP3 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 2199352024|deeps_contig28010.18012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1153 | Open in IMG/M |
| 2228664022|INPgaii200_c0728578 | Not Available | 661 | Open in IMG/M |
| 3300000567|JGI12270J11330_10076235 | Not Available | 1617 | Open in IMG/M |
| 3300000955|JGI1027J12803_107766727 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300001356|JGI12269J14319_10132800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1113 | Open in IMG/M |
| 3300001431|F14TB_111317336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300001471|JGI12712J15308_10120048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 671 | Open in IMG/M |
| 3300001546|JGI12659J15293_10038913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1131 | Open in IMG/M |
| 3300001661|JGI12053J15887_10257577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300002568|C688J35102_118091641 | Not Available | 529 | Open in IMG/M |
| 3300004480|Ga0062592_101056458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 747 | Open in IMG/M |
| 3300004635|Ga0062388_100308207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300005175|Ga0066673_10723778 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005335|Ga0070666_10502311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 879 | Open in IMG/M |
| 3300005436|Ga0070713_101079960 | Not Available | 775 | Open in IMG/M |
| 3300005439|Ga0070711_101518729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 584 | Open in IMG/M |
| 3300005440|Ga0070705_101591813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300005445|Ga0070708_100602137 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005446|Ga0066686_10430870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 901 | Open in IMG/M |
| 3300005458|Ga0070681_11899610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005471|Ga0070698_102148346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300005541|Ga0070733_10197735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1314 | Open in IMG/M |
| 3300005541|Ga0070733_10222374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1238 | Open in IMG/M |
| 3300005541|Ga0070733_10247706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1171 | Open in IMG/M |
| 3300005557|Ga0066704_10274127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1144 | Open in IMG/M |
| 3300005557|Ga0066704_10811527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 581 | Open in IMG/M |
| 3300005574|Ga0066694_10501159 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005610|Ga0070763_10566431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 656 | Open in IMG/M |
| 3300005712|Ga0070764_10026217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2919 | Open in IMG/M |
| 3300005712|Ga0070764_10210892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1093 | Open in IMG/M |
| 3300005719|Ga0068861_101593662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005921|Ga0070766_11126936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005944|Ga0066788_10005617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2534 | Open in IMG/M |
| 3300005944|Ga0066788_10047579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1006 | Open in IMG/M |
| 3300005994|Ga0066789_10008931 | All Organisms → cellular organisms → Bacteria | 4438 | Open in IMG/M |
| 3300005994|Ga0066789_10310836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 659 | Open in IMG/M |
| 3300006028|Ga0070717_11949629 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006059|Ga0075017_101247673 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006086|Ga0075019_10325180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 929 | Open in IMG/M |
| 3300006102|Ga0075015_100011441 | All Organisms → cellular organisms → Bacteria | 3753 | Open in IMG/M |
| 3300006162|Ga0075030_100222253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1517 | Open in IMG/M |
| 3300006162|Ga0075030_100853184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 719 | Open in IMG/M |
| 3300006163|Ga0070715_10803832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
| 3300006172|Ga0075018_10029731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2173 | Open in IMG/M |
| 3300006804|Ga0079221_10711053 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006871|Ga0075434_102158456 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006893|Ga0073928_10064942 | All Organisms → cellular organisms → Bacteria | 3200 | Open in IMG/M |
| 3300007076|Ga0075435_100942530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 753 | Open in IMG/M |
| 3300009012|Ga0066710_101803317 | Not Available | 924 | Open in IMG/M |
| 3300009012|Ga0066710_102782471 | Not Available | 693 | Open in IMG/M |
| 3300009089|Ga0099828_11483807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300009617|Ga0116123_1170903 | Not Available | 556 | Open in IMG/M |
| 3300009630|Ga0116114_1038586 | Not Available | 1376 | Open in IMG/M |
| 3300009634|Ga0116124_1116460 | Not Available | 752 | Open in IMG/M |
| 3300010048|Ga0126373_10166839 | Not Available | 2108 | Open in IMG/M |
| 3300010048|Ga0126373_11537943 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010048|Ga0126373_12863416 | Not Available | 538 | Open in IMG/M |
| 3300010339|Ga0074046_10940346 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 500 | Open in IMG/M |
| 3300010359|Ga0126376_11431381 | Not Available | 717 | Open in IMG/M |
| 3300010361|Ga0126378_13359987 | Not Available | 508 | Open in IMG/M |
| 3300010373|Ga0134128_12944595 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010376|Ga0126381_102287457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300010379|Ga0136449_100026036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 14486 | Open in IMG/M |
| 3300010379|Ga0136449_101686917 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010379|Ga0136449_102121317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 824 | Open in IMG/M |
| 3300010398|Ga0126383_11231788 | Not Available | 838 | Open in IMG/M |
| 3300011082|Ga0138526_1048943 | Not Available | 772 | Open in IMG/M |
| 3300011120|Ga0150983_10947462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300011269|Ga0137392_10000939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 16173 | Open in IMG/M |
| 3300011269|Ga0137392_10859143 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300011270|Ga0137391_10796338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300011270|Ga0137391_10815086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300011271|Ga0137393_11293577 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012010|Ga0120118_1080430 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012096|Ga0137389_10138153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1983 | Open in IMG/M |
| 3300012096|Ga0137389_11688967 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012198|Ga0137364_10396626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300012198|Ga0137364_10862939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300012199|Ga0137383_11014313 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012205|Ga0137362_10735367 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012207|Ga0137381_11634205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012212|Ga0150985_122218790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 506 | Open in IMG/M |
| 3300012354|Ga0137366_10537914 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300012469|Ga0150984_100915890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1298 | Open in IMG/M |
| 3300012683|Ga0137398_10572794 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012960|Ga0164301_10701278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300012971|Ga0126369_11176116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 856 | Open in IMG/M |
| 3300012972|Ga0134077_10020462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2266 | Open in IMG/M |
| 3300013306|Ga0163162_10783174 | Not Available | 1072 | Open in IMG/M |
| 3300014159|Ga0181530_10314086 | Not Available | 818 | Open in IMG/M |
| 3300014159|Ga0181530_10643876 | Not Available | 515 | Open in IMG/M |
| 3300014164|Ga0181532_10672207 | Not Available | 559 | Open in IMG/M |
| 3300014168|Ga0181534_10046344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2142 | Open in IMG/M |
| 3300014169|Ga0181531_10161603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1356 | Open in IMG/M |
| 3300014489|Ga0182018_10325516 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300014498|Ga0182019_10059588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2235 | Open in IMG/M |
| 3300014657|Ga0181522_10731128 | Not Available | 605 | Open in IMG/M |
| 3300014657|Ga0181522_10934212 | Not Available | 536 | Open in IMG/M |
| 3300014969|Ga0157376_11902494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300016750|Ga0181505_10421642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300017657|Ga0134074_1201326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
| 3300017823|Ga0187818_10436047 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300017936|Ga0187821_10052723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300017955|Ga0187817_10313503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300017970|Ga0187783_10052135 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300017970|Ga0187783_11302481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 523 | Open in IMG/M |
| 3300017995|Ga0187816_10320737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300018006|Ga0187804_10215221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300018006|Ga0187804_10475402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300018012|Ga0187810_10287325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 679 | Open in IMG/M |
| 3300018023|Ga0187889_10218732 | Not Available | 869 | Open in IMG/M |
| 3300018023|Ga0187889_10318312 | Not Available | 685 | Open in IMG/M |
| 3300018033|Ga0187867_10815802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300018040|Ga0187862_10441796 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300018042|Ga0187871_10466115 | Not Available | 698 | Open in IMG/M |
| 3300018064|Ga0187773_10380912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300018085|Ga0187772_10184706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1394 | Open in IMG/M |
| 3300018085|Ga0187772_10205327 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea → Reduviidae → Triatominae → Panstrongylus → Panstrongylus lignarius | 1325 | Open in IMG/M |
| 3300018085|Ga0187772_11226880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300018482|Ga0066669_10575131 | Not Available | 985 | Open in IMG/M |
| 3300019787|Ga0182031_1041683 | Not Available | 560 | Open in IMG/M |
| 3300019787|Ga0182031_1365213 | Not Available | 1456 | Open in IMG/M |
| 3300019787|Ga0182031_1494909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1941 | Open in IMG/M |
| 3300019878|Ga0193715_1029404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300019890|Ga0193728_1038513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2358 | Open in IMG/M |
| 3300019890|Ga0193728_1292822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300020580|Ga0210403_10123509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2108 | Open in IMG/M |
| 3300020580|Ga0210403_11499461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300020581|Ga0210399_10042724 | All Organisms → cellular organisms → Bacteria | 3633 | Open in IMG/M |
| 3300021168|Ga0210406_10305916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1291 | Open in IMG/M |
| 3300021170|Ga0210400_10261880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300021180|Ga0210396_11705898 | Not Available | 512 | Open in IMG/M |
| 3300021406|Ga0210386_10730451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300021407|Ga0210383_10066980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2998 | Open in IMG/M |
| 3300021407|Ga0210383_10089355 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300021420|Ga0210394_10727870 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300021432|Ga0210384_11630858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 550 | Open in IMG/M |
| 3300021478|Ga0210402_10635630 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300023019|Ga0224560_112247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300024225|Ga0224572_1014067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1528 | Open in IMG/M |
| 3300024227|Ga0228598_1130109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 512 | Open in IMG/M |
| 3300024249|Ga0247676_1085293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300025321|Ga0207656_10158410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
| 3300025414|Ga0208935_1026124 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300025453|Ga0208455_1100477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300025898|Ga0207692_10921874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300025916|Ga0207663_10606371 | Not Available | 861 | Open in IMG/M |
| 3300025916|Ga0207663_10695562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300025927|Ga0207687_11928335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300025928|Ga0207700_10667304 | Not Available | 927 | Open in IMG/M |
| 3300025981|Ga0207640_12171864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300026035|Ga0207703_10376971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1311 | Open in IMG/M |
| 3300026041|Ga0207639_12156064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026215|Ga0209849_1019808 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300026291|Ga0209890_10243213 | Not Available | 562 | Open in IMG/M |
| 3300026320|Ga0209131_1301698 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026861|Ga0207503_1007984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027109|Ga0208603_1042684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300027313|Ga0207780_1004027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3654 | Open in IMG/M |
| 3300027667|Ga0209009_1139458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300027738|Ga0208989_10000913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9191 | Open in IMG/M |
| 3300027767|Ga0209655_10176022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300027825|Ga0209039_10153456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300027829|Ga0209773_10024980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2357 | Open in IMG/M |
| 3300027829|Ga0209773_10175469 | Not Available | 895 | Open in IMG/M |
| 3300027867|Ga0209167_10342658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 811 | Open in IMG/M |
| 3300027875|Ga0209283_10736768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300027879|Ga0209169_10011718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4880 | Open in IMG/M |
| 3300027898|Ga0209067_10087769 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300027905|Ga0209415_10135459 | Not Available | 2538 | Open in IMG/M |
| 3300027905|Ga0209415_10533882 | Not Available | 891 | Open in IMG/M |
| 3300027911|Ga0209698_10131533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2065 | Open in IMG/M |
| 3300027911|Ga0209698_10238660 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300027911|Ga0209698_10490463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300028536|Ga0137415_10221301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1707 | Open in IMG/M |
| 3300028536|Ga0137415_10562594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300028773|Ga0302234_10312606 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300028773|Ga0302234_10488993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 526 | Open in IMG/M |
| 3300028808|Ga0302228_10039510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2316 | Open in IMG/M |
| 3300028906|Ga0308309_11639169 | Not Available | 547 | Open in IMG/M |
| 3300029636|Ga0222749_10036980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2103 | Open in IMG/M |
| 3300029903|Ga0247271_104736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2535 | Open in IMG/M |
| 3300029910|Ga0311369_10678739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300029944|Ga0311352_10325465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1275 | Open in IMG/M |
| 3300029953|Ga0311343_10388909 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300030004|Ga0302186_10262660 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300030005|Ga0302174_10028696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1452 | Open in IMG/M |
| 3300030053|Ga0302177_10000026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 134106 | Open in IMG/M |
| 3300030618|Ga0311354_10279964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1736 | Open in IMG/M |
| 3300030618|Ga0311354_11521039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300030624|Ga0210251_11165291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300030741|Ga0265459_12186168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300030743|Ga0265461_12774091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 584 | Open in IMG/M |
| 3300030743|Ga0265461_12830057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 580 | Open in IMG/M |
| 3300030813|Ga0265750_1076548 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031057|Ga0170834_113671346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300031231|Ga0170824_109014627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 705 | Open in IMG/M |
| 3300031231|Ga0170824_120357712 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031231|Ga0170824_121273542 | Not Available | 753 | Open in IMG/M |
| 3300031249|Ga0265339_10021469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3756 | Open in IMG/M |
| 3300031474|Ga0170818_103080629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300031708|Ga0310686_110592446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1644 | Open in IMG/M |
| 3300031715|Ga0307476_11049089 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031718|Ga0307474_10033685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3763 | Open in IMG/M |
| 3300031823|Ga0307478_10762272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300031823|Ga0307478_11352748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300031890|Ga0306925_11281195 | Not Available | 729 | Open in IMG/M |
| 3300031910|Ga0306923_10073171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3830 | Open in IMG/M |
| 3300031939|Ga0308174_10132591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1833 | Open in IMG/M |
| 3300031942|Ga0310916_10217969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1601 | Open in IMG/M |
| 3300032180|Ga0307471_103072741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300032205|Ga0307472_100278076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300032515|Ga0348332_10166803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300032770|Ga0335085_10179409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2618 | Open in IMG/M |
| 3300032770|Ga0335085_10483693 | Not Available | 1417 | Open in IMG/M |
| 3300032805|Ga0335078_10469620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1627 | Open in IMG/M |
| 3300032828|Ga0335080_11488530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300032954|Ga0335083_10574968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 932 | Open in IMG/M |
| 3300033134|Ga0335073_10647226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1168 | Open in IMG/M |
| 3300033402|Ga0326728_10534234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300033412|Ga0310810_11200545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 615 | Open in IMG/M |
| 3300033755|Ga0371489_0321421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.22% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.44% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.44% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026861 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030004 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300030005 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01492340 | 2088090014 | Soil | MTTGYGRTTSTGVGFSGSGSAAKPEDYADKLLELYGRCLGAV |
| FG2_03388050 | 2189573004 | Grass Soil | SSTGVGFQGTGAASKPEDYASHLLELYGKCLQAIGKK |
| deeps_03370450 | 2199352024 | Soil | RTTSTGVGFQGTGSAAKPEDYAERLLELYGKCLGAVGGKK |
| INPgaii200_07285782 | 2228664022 | Soil | GVGFTGTGSAAKPEDYAEKLLELYGRCLGAVGGKK |
| JGI12270J11330_100762351 | 3300000567 | Peatlands Soil | AVGFQGTAATDKPEDYAAHLLELYGRCLQSVGGK* |
| JGI1027J12803_1077667273 | 3300000955 | Soil | RTSSTGVGFQGGGAASKPEDYATHLLELYAKCLQAVAGKK* |
| JGI12269J14319_101328002 | 3300001356 | Peatlands Soil | RTSASGVGFQGSGAAAKPEEYAAHLLELYGRCLEAVQRKK* |
| F14TB_1113173362 | 3300001431 | Soil | GDGKTSSSGVGFQGGGAAAKPEEYASHLLELYGKCLSAVEKK* |
| JGI12712J15308_101200481 | 3300001471 | Forest Soil | TSTGVGFQGTGAAAKPEDYATHLLELYGKCLAAVEGAPPGSGKK* |
| JGI12659J15293_100389131 | 3300001546 | Forest Soil | TTSTGVGFQGTGSAAKPEDFAEKLLELYGKCLGAVSGKK* |
| JGI12053J15887_102575771 | 3300001661 | Forest Soil | GVGFQGTGAAAKPEDYAAHLLELYGKCLNAVAGKK* |
| C688J35102_1180916411 | 3300002568 | Soil | GRTSSTGVGFQGTGTAAKPEEYAAHLLELYGKCLQAVGKK* |
| Ga0062592_1010564581 | 3300004480 | Soil | YGRTTSSGVGFQGTGAAAKPEEYAGHLLELYSKCLQTVAGKK* |
| Ga0062388_1003082071 | 3300004635 | Bog Forest Soil | TGYGKTASSGGVGFSGGGAAAKPEDYAAHLLELYGKCLSAVGAKK* |
| Ga0066673_107237782 | 3300005175 | Soil | RTSSSGVGFQGSGAASKPEEYAGHLLELYGRCLQAVAGGKK* |
| Ga0070666_105023112 | 3300005335 | Switchgrass Rhizosphere | RTTSSGVGFQGTGAAAKPEEYAGHLLELYGKCLQAVAGKK* |
| Ga0070713_1010799602 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YGRTASGGVGFQGGGAVAKPEEYAAHLLELYGKCLSAVAKK* |
| Ga0070711_1015187292 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YGRTTSSGVGFQGTGAAAKPEEYAGHLLELYGKCLQAVAGKK* |
| Ga0070705_1015918131 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTGYGRTTSSGVGFQGTGAAAKPEEYAGHLLDLYSKCLQTVAGKK* |
| Ga0070708_1006021373 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GYGRTTSSGVGFQGTGAAAKPEDYAARLLELYGKCLGAVGAKK* |
| Ga0066686_104308701 | 3300005446 | Soil | TSSSGVGFQGSGAASKPEEYAGHLLELYGRCLQAVAGGKK* |
| Ga0070681_118996101 | 3300005458 | Corn Rhizosphere | KTSSTGVGFQGGGAAAKPEDYAAHLLELYGKCLNALEKK* |
| Ga0070698_1021483462 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GYGRTTSSGVGFQGSGAASKPEEYAGHLLELYTKCLNTVQQKKGG* |
| Ga0070733_101977352 | 3300005541 | Surface Soil | VGFTGGGAAAKPEEYAAHLLELYGKCLGAVGGAVGGKK* |
| Ga0070733_102223741 | 3300005541 | Surface Soil | VGFQGSGAASKPEDYAIHLLELYGRCLEAVQRKK* |
| Ga0070733_102477061 | 3300005541 | Surface Soil | YGRTTSSGVGFQGGGSAAKPEDYADHLLDLYGKCLTAVAAKK* |
| Ga0066704_102741271 | 3300005557 | Soil | SGVGFQGSGAASKPEEYAGHLLELYGRCLHAVAGGKK* |
| Ga0066704_108115272 | 3300005557 | Soil | TTGYGRTTSSGVGFQGTGTAAKPEEYAAHLLELYGKCLQTVGRK* |
| Ga0066694_105011591 | 3300005574 | Soil | TSTGVGFSGSGSAAKPEDYADKLLELYGRCLGAVGGKK* |
| Ga0070763_105664311 | 3300005610 | Soil | YGRTSSSGVGFQGSGAASKPEDYATHLLELYGRCLEAVQRKK* |
| Ga0070764_100262171 | 3300005712 | Soil | SSGVGFQGSGAASKPEDYASHLLELYGRCLEAVQRKK* |
| Ga0070764_102108923 | 3300005712 | Soil | SSGVGFQGTGSASKPEEYAAHLLELYGKCRAAVEGKK* |
| Ga0068861_1015936622 | 3300005719 | Switchgrass Rhizosphere | SSGVGFQGTGSAAKPEDYAAHLLELYGRCLTAVQGKK* |
| Ga0070766_111269362 | 3300005921 | Soil | SAGVGFQGGGAAAKPEEYANHLLELYGRCLQAVQNKK* |
| Ga0066788_100056171 | 3300005944 | Soil | TSTGVGFQGSGAASKPEEYAGHLLELYGKCLQAVAKK* |
| Ga0066788_100475791 | 3300005944 | Soil | FTGGGAAAKPEEYAAHLLELYGKCLGAVGGKKIAQ* |
| Ga0066789_100089311 | 3300005994 | Soil | TTSSGVGFQGTGSASKPEDYATHLLELYGKCLGAVAAKK* |
| Ga0066789_103108361 | 3300005994 | Soil | TGAPGVGFQGSSLTKAAEEYAGHLLELYGRCLDAVQGKK* |
| Ga0070717_119496291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TGYGRTTSTGVGFQGTGSAAKPEEYAAHLLELYGKCLSAVGKK* |
| Ga0075017_1012476731 | 3300006059 | Watersheds | GGAGVGFQGGGAATKPEEYADHLLELFGKCLKAVDGK* |
| Ga0075019_103251801 | 3300006086 | Watersheds | GKTIGTGVGFQGGGAAAKPEDYADHLLELYGRCLKAVGGK* |
| Ga0075015_1000114411 | 3300006102 | Watersheds | RTTSTGVGFQGTGSAAKPEDYAERLLELYGKCLSAVGGKNGKK* |
| Ga0075030_1002222535 | 3300006162 | Watersheds | KTTGTGVGFQGTGAAAKPEDYASHLLELYGRCLQSVGGK* |
| Ga0075030_1008531841 | 3300006162 | Watersheds | TGTGVGFQGTGAAAKPEDYAAHLLELYGRCLQSVGGK* |
| Ga0070715_108038321 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SGGGPGGVGFQGTGAASKPEDYAGHLLELYGKCLSAVGKK* |
| Ga0075018_100297311 | 3300006172 | Watersheds | MKFVAMTTGYGRTSSSGVGFQGTGAATKPEEYADHLLELYGK |
| Ga0079221_107110532 | 3300006804 | Agricultural Soil | SASAGFQGGAPAKPGEYADHLLELYGKCLNAIQGKK* |
| Ga0075434_1021584561 | 3300006871 | Populus Rhizosphere | GAGFQGTAAAAKPEEYAGHLLELYGKCLHAVAKK* |
| Ga0073928_100649426 | 3300006893 | Iron-Sulfur Acid Spring | SGVGFQGSGAASKPEDYANHLLELYGRCLDAVQRKK* |
| Ga0075435_1009425301 | 3300007076 | Populus Rhizosphere | MTTGYGRTTSSGVGFTGTGSAAKPEDYAEKLLELYSRCLGTVGGKK* |
| Ga0066710_1018033172 | 3300009012 | Grasslands Soil | GRTTSTGVGFSGSGSAAKPEDYADKLLELYGRCLGAVGGKK |
| Ga0066710_1027824712 | 3300009012 | Grasslands Soil | YGRTTSTGVGFQGTGSAAKPEEYAAHLLELYGKCLSAVGKK |
| Ga0099828_114838071 | 3300009089 | Vadose Zone Soil | TSSVGAGFQGSGAASKPEEYAAHLLELYGKCLAAVAGKK* |
| Ga0116123_11709032 | 3300009617 | Peatland | YGKTTGAGVGFQGTAATDKPEEYAAHLLELYGRCLQSVGGK* |
| Ga0116114_10385862 | 3300009630 | Peatland | TGYGKTTGAGVGFQGTGAAAKPEDYAAQLLELYGRCLQSIGGK* |
| Ga0116124_11164602 | 3300009634 | Peatland | GVGFQGTGAAAKPEEYAAHLLELYGRCLQSVGAK* |
| Ga0126373_101668391 | 3300010048 | Tropical Forest Soil | RTTTTGVGFQGSGSTAKPEDYAERLLELYGRCLGAVSGKK* |
| Ga0126373_115379432 | 3300010048 | Tropical Forest Soil | GVGFQGSGSAAKPEDYAEKLLELYGKCLGAVSGKK* |
| Ga0126373_128634162 | 3300010048 | Tropical Forest Soil | PGLGFQGSVSPHAAEEYAQHLLELYGRCLEAVQGKK* |
| Ga0074046_109403462 | 3300010339 | Bog Forest Soil | GVGFQGTGSAAKPEDYAERLLELYGKCLGAVAGHK* |
| Ga0126376_114313812 | 3300010359 | Tropical Forest Soil | GYGRTSGAGGVGFQGSAAVAKPEEYAGHLLELYGRCLSAVARK* |
| Ga0126378_133599871 | 3300010361 | Tropical Forest Soil | VTSSGVGFQGSGTAAKPEDYAEKLLELYSKCLHTVGGKK* |
| Ga0134128_129445952 | 3300010373 | Terrestrial Soil | GGVGFQGTGAAAKPEYFAAHLLELYAKCLGAVQGKK* |
| Ga0126381_1022874571 | 3300010376 | Tropical Forest Soil | GVGFQGSGSAAKPEDYAERLLELYGKCLSAVSGKK* |
| Ga0136449_1000260361 | 3300010379 | Peatlands Soil | RTASSGVGFQGTGSAAKPEDYAEHLLELYGKCLNAVGAKK* |
| Ga0136449_1016869171 | 3300010379 | Peatlands Soil | TGVGFQGTGATDKPEEYAAHLLELYGRCLHSVGGK* |
| Ga0136449_1021213171 | 3300010379 | Peatlands Soil | AGVGFQGGGAASKPDEYAAHLLELYRKCLDSVGGKR* |
| Ga0126383_112317881 | 3300010398 | Tropical Forest Soil | PGVGFQGTVSSSAAEEYAQHLLDLYGRCLEAVQGKK* |
| Ga0138526_10489431 | 3300011082 | Peatlands Soil | RTTSTGVGFQGSGSAAKPEEYAERLLELYGQCLSAVGGKK* |
| Ga0150983_109474621 | 3300011120 | Forest Soil | SGVGFQGSGAAAKPEDYAAHLLELYGKCLTAVAKK* |
| Ga0137392_100009391 | 3300011269 | Vadose Zone Soil | GGGFQVSGAAAKPEDYAAHLLELYGKCLKAVDGK* |
| Ga0137392_108591432 | 3300011269 | Vadose Zone Soil | GRTTSSGAGFQGAGAAAKPEEYAGHLLELYSKCLQAVGKK* |
| Ga0137391_107963381 | 3300011270 | Vadose Zone Soil | VGFQGSGAASKPEEYAGHLLELYGKCLQVLGKKDTQK* |
| Ga0137391_108150861 | 3300011270 | Vadose Zone Soil | KTTGAGVGFQGGGAADKPEEYAAHLLELYGRCLQSVAGK* |
| Ga0137393_112935772 | 3300011271 | Vadose Zone Soil | GVGFQGTGAAAKPEDYAAHLLELYGRCLHAVTGRK* |
| Ga0120118_10804301 | 3300012010 | Permafrost | GVGFQGSGAASKPEEYAGHLLELYGKCLQAVAKK* |
| Ga0137389_101381533 | 3300012096 | Vadose Zone Soil | GAGVGFQGGGAADKPEEYAAHLLELYGRCLQSVAGK* |
| Ga0137389_116889671 | 3300012096 | Vadose Zone Soil | GKTIGTGVGFQGGGAAAKPEDYAAHLLELYGRCLQSVGGK* |
| Ga0137364_103966261 | 3300012198 | Vadose Zone Soil | SSSGVGFQGSGAASKPEEYAGHLLELYGRCLHAVAGKK* |
| Ga0137364_108629392 | 3300012198 | Vadose Zone Soil | TTSSGVGFQGGGAASKPEEYAGHLLELYTKCLNTVQQKKGA* |
| Ga0137383_110143131 | 3300012199 | Vadose Zone Soil | TGYGKTIGSGVGFQGGGAAAKPEDYAAHLLELYGRCLQSVGSK* |
| Ga0137362_107353671 | 3300012205 | Vadose Zone Soil | ISSGVGFQGGGAASKPEEYASHLLELYTKCLNTVQQKKGG* |
| Ga0137381_116342051 | 3300012207 | Vadose Zone Soil | VGFQGTGSAAKPEDYAAHLLELYGKCLGAVGAKK* |
| Ga0150985_1222187902 | 3300012212 | Avena Fatua Rhizosphere | TTSTGVGFQGTGSAAKPEDYADRLLELYGRCLGAVSGKK* |
| Ga0137366_105379141 | 3300012354 | Vadose Zone Soil | VGFQGGGAASKPEEYAGHLLELYTKCLNTVQQKKGG* |
| Ga0150984_1009158901 | 3300012469 | Avena Fatua Rhizosphere | AGTGVGFQGSSATAKPEDYAAHLLELYGKCLKAIDGK* |
| Ga0137398_105727941 | 3300012683 | Vadose Zone Soil | GSGVGFQGGGAAAKPEDYAAHLLELYGRCLQSVSGK* |
| Ga0164301_107012782 | 3300012960 | Soil | SSGVGFQGTGAAAKPEEYAGHLLDLYSKCLQTVAGKK* |
| Ga0126369_111761161 | 3300012971 | Tropical Forest Soil | GVGFQGGGTASKPEEYADHLLELYGKCLKAVDGKK* |
| Ga0134077_100204621 | 3300012972 | Grasslands Soil | VGFQGGGAALKPEEYAGHLLELYGKCLAAVQGRK* |
| Ga0163162_107831741 | 3300013306 | Switchgrass Rhizosphere | GGVGFQGGGAAAKPEEYAGHVLELYGKCLGAVAKK* |
| Ga0181530_103140861 | 3300014159 | Bog | GKTTGAGVGFQGTGAAAKPEDYAAQLLELYGRCLQSIGGK* |
| Ga0181530_106438761 | 3300014159 | Bog | GKTTGAGVGFQGTAATDKPEDYAAHLLELYGRCLQSVAGK* |
| Ga0181532_106722071 | 3300014164 | Bog | MTTSYGKTTGTGGGFQGTGAAAKPEDYATQLLELYGRCLQTVGGK* |
| Ga0181534_100463443 | 3300014168 | Bog | RTTSSGVGFQGGGSAAKPEDYATHLLELYGKCRAAVEGKK* |
| Ga0181531_101616031 | 3300014169 | Bog | TGVGFQGTGAAAKPEDYAAQLLELYGRCLQSVEGK* |
| Ga0182018_103255163 | 3300014489 | Palsa | YGRTSASGVGFQGSGAASKPEDYASHLLELYGRCLEAVQRKK* |
| Ga0182019_100595884 | 3300014498 | Fen | GKTSGAGVGFQGSGAADKPEEYAAHLLELYGRCLQSVGGK* |
| Ga0181522_107311282 | 3300014657 | Bog | GAGVGFQGGGAADKPEDYAAHLLELYGRCLQSVGGK* |
| Ga0181522_109342121 | 3300014657 | Bog | IAMTTSYGKTTGSGVGFQGTGAAAKPEDYAAHLLELYSRCLQSVGGK* |
| Ga0157376_119024941 | 3300014969 | Miscanthus Rhizosphere | SSGVGFQGTGSAAKPEEYAGHLLELYGRCLTAVQGKK* |
| Ga0181505_104216422 | 3300016750 | Peatland | RTTSSGVGFQGTGSAAKPEEYATHLLELYGKCRAAVEGKK |
| Ga0134074_12013261 | 3300017657 | Grasslands Soil | GVGFQGGGAALKPEEYAGHLLELYGKCLAAVQGGK |
| Ga0187818_104360472 | 3300017823 | Freshwater Sediment | GAGVGFQGTGATDKPEEYAAHLLELYGRCLNSVGGK |
| Ga0187821_100527232 | 3300017936 | Freshwater Sediment | MTTGYGRTTSTGVGFQGTGSAAKPEDYAERLLELYGKCLGAVSGRK |
| Ga0187817_103135033 | 3300017955 | Freshwater Sediment | GVGFQGTGSAAKPEDYADRLLELYGKCLGAVSGKNGKK |
| Ga0187817_107658652 | 3300017955 | Freshwater Sediment | MKFVAMTTGYGRTSSSGVGFQGGGAAAKPEEYAGHLLDLYGKCLDAVGGKK |
| Ga0187783_100521351 | 3300017970 | Tropical Peatland | TGVGFQGTGSTAKPEDYAERLLELYSRCLGAVSGKK |
| Ga0187783_113024811 | 3300017970 | Tropical Peatland | TTSTGVGFQGTGSAAKPEDYAERLLELYGKCLHAVTGKK |
| Ga0187816_103207371 | 3300017995 | Freshwater Sediment | YGRTTSTGVGFQGTGSAAKPEDYADKLLELYEKCLGAVTGKK |
| Ga0187804_102152211 | 3300018006 | Freshwater Sediment | SSSGVGFQGSGAASKPEDYANHLLELYGRCLEAVQKKK |
| Ga0187804_104754022 | 3300018006 | Freshwater Sediment | FVAMTTGYGRTTSTGVGFQGTGSASKPEEYADRLLELYAKCLTAVENAK |
| Ga0187810_102873251 | 3300018012 | Freshwater Sediment | MKFVAMTTGYGRTTSTGVGFQGAGSAAKPEEYADRLLELYAKCLNTVENAK |
| Ga0187889_102187321 | 3300018023 | Peatland | IAMTTSYGKTTGTGVSFQGTGAAAKPEEYAAHLLELYGRCLQSVGAK |
| Ga0187889_103183122 | 3300018023 | Peatland | GRTTSTGVGFQGTGSAAKPEGYADRLLELYAKCLSTVENAK |
| Ga0187867_108158022 | 3300018033 | Peatland | TTSYGKTTGTGVGFQGTGAAAKPEDYATQLLELYGRCLQSVGGK |
| Ga0187862_104417961 | 3300018040 | Peatland | AGVGFKGTAATDKPEDYAAHLLELYGRCLQSVGGK |
| Ga0187871_104661152 | 3300018042 | Peatland | YGKTTGAGVGFQGTGAAAKPEDYAAQLLELYGRCLQSVEGK |
| Ga0187773_103809121 | 3300018064 | Tropical Peatland | STTGVGFQGGGASAKPEDYADHLLELYGKCLEAVQGKK |
| Ga0187772_101847062 | 3300018085 | Tropical Peatland | TTGYGRTTSTGVGFQGTGSAAKPEEYADRLLELYAKCLTAVENAK |
| Ga0187772_102053272 | 3300018085 | Tropical Peatland | TTGYGRTTSTGVGFQGTGSAAKPEEYAERLLELYAKCLTTVENAK |
| Ga0187772_112268802 | 3300018085 | Tropical Peatland | TGYGRTTSTGVGFQGTGSAAKPEEYADRLLELYAKCLTAVENAK |
| Ga0066669_105751311 | 3300018482 | Grasslands Soil | TSSGVGFQGGGAASKPEEYAGHLLELYTKCLNTVQQKKGA |
| Ga0182031_10416831 | 3300019787 | Bog | QGTGFQGTGAAAKPEEYAAHLLELYGRCLQSVGAK |
| Ga0182031_13652132 | 3300019787 | Bog | KTTGTGVGFQGTGAAAKPEEYAAHLLELYGRCLQSVGAK |
| Ga0182031_14949095 | 3300019787 | Bog | MTTSYGKTTGTGVGFQGTGAAAKPEEYAAHLLELYGRCLQSVGAKVAHRVIETFRD |
| Ga0193715_10294043 | 3300019878 | Soil | GYGRTSSSGVGFQGTGAAAKPEEYAAHLLELYAKCLQAVAGKK |
| Ga0193728_10385131 | 3300019890 | Soil | SGVGFQGSGAAAKPEDYAAHLLELYGKCLQTVAGKK |
| Ga0193728_12928222 | 3300019890 | Soil | TSSTGVGFQGTGAAAKPEDYAAHLLELYNKCLHAVTGKK |
| Ga0210403_101235091 | 3300020580 | Soil | YGKSASSGGVGFTGGGSAAKPEEYAAHLLELYGKCLIAVEGGK |
| Ga0210403_114994612 | 3300020580 | Soil | TGYGKTASSGGVGFTGGGGAAKPEDYAAHLLELYGKCLGAVVAKK |
| Ga0210399_100427244 | 3300020581 | Soil | TSSGVGFQGTGSAAKPEDYATHLLELYGRCLGAVGAKK |
| Ga0210406_103059161 | 3300021168 | Soil | YGKTIGTGVGFQGGGAAAKPEDYAAHLLELYGRCLQSVGGK |
| Ga0210400_102618802 | 3300021170 | Soil | KTASSGGVGFTGGGAAAKPEDYAAHLLELYGKCLGAVGAKK |
| Ga0210396_117058982 | 3300021180 | Soil | SGVGFQGTGSAAKPEDYAANLLELYGKCLGAVAAKK |
| Ga0210386_107304511 | 3300021406 | Soil | SGVGFQGSGSASKPEEYAGHLLELYGQCLGAVGAKK |
| Ga0210383_100669801 | 3300021407 | Soil | SSGVGFQGSGAASKPEDYAIHLLELYGRCLEAVQRKK |
| Ga0210383_100893551 | 3300021407 | Soil | YGRTTSSGVGFQGTGSASKPGEYAAQLLELYGKCKAAVGGKK |
| Ga0210394_107278702 | 3300021420 | Soil | GTGVGFQGGGAAAKPEDYAAHLLELYGRCLQSVGGK |
| Ga0210384_116308581 | 3300021432 | Soil | SSSGVGFQGSGAASKPEDYANHLLELYGRCLEAVQRKK |
| Ga0210402_106356301 | 3300021478 | Soil | TGYGRTATAGGAGFTGSGATAKPEDYAAHLLELYGKCLSAVGAKK |
| Ga0224560_1122472 | 3300023019 | Soil | GVGFQGTGSASKPDEYAAQLLELYGKCRAAVGGKK |
| Ga0224572_10140673 | 3300024225 | Rhizosphere | TSSSGVGFQGSGAASKPEDYATHLLELYGRCLEAVQRKK |
| Ga0228598_11301091 | 3300024227 | Rhizosphere | GRTTSSGVGFQGTGSASKPEEYAAHLLELYGKCRTAVEGRK |
| Ga0247676_10852931 | 3300024249 | Soil | YGRTTSSGVGFQGTGAAAKPEEYAGHLLDLYSKCLQTVAGKK |
| Ga0207656_101584102 | 3300025321 | Corn Rhizosphere | GYGKTSSAGIGFQGVGASLKPEEYASHLLELYGRCLDAVQAKK |
| Ga0208935_10261241 | 3300025414 | Peatland | MTTGYGKTTGAGVGFQGTGAAAKPEDYAAQLLELYGRCLHSVDGK |
| Ga0208455_11004771 | 3300025453 | Peatland | AMTTGYGKTTGAGVGFQGTGAAAKPEDYAAQLLELYGRCLQSIGGK |
| Ga0207692_109218741 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TSTGVGFQGSGSAAKPEDYADKLLELYGRCLGALSGKK |
| Ga0207663_106063711 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SGGVGFTGGGSAAKPEDYAEKLLELYGRCLGAVSGKK |
| Ga0207663_106955621 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YGRTTSSGVGFQGTGAAAKPEEYAGHLLELYGKCLQAVAGKK |
| Ga0207687_119283352 | 3300025927 | Miscanthus Rhizosphere | TTGYGKTTSSGVGFQGSGAASKPEDYATHLLELYRKCVAAVEKK |
| Ga0207700_106673042 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GSVGFQGTGAAAKPEEYAAHLLELYGKCLTAVARK |
| Ga0207640_121718642 | 3300025981 | Corn Rhizosphere | STGVGFQGSGSAAKPEDYAEKLLELYGRCLGAVSGKK |
| Ga0207703_103769711 | 3300026035 | Switchgrass Rhizosphere | TGYGRTTSSGVGFQGTGAAAKPEEYAGHLLELYAKCLQSVAGKK |
| Ga0207639_121560642 | 3300026041 | Corn Rhizosphere | GRTTSSGVGFQGTGAAAKPEEYAGHLLELYSKCLQTVAGKK |
| Ga0209849_10198081 | 3300026215 | Soil | FTGGGAAAKPEEYAAHLLELYGKCLGAVGGKKIAQ |
| Ga0209890_102432132 | 3300026291 | Soil | YGKTGAPGVGFQGSSLTKAAEEYAGHLLELYSRCLDAVQAKK |
| Ga0209131_13016981 | 3300026320 | Grasslands Soil | YGRTAGSGVGFQGSGAAAKPEDYAAHLLELYGKCLKAVDAK |
| Ga0207503_10079842 | 3300026861 | Soil | TTGYGRTTSSGVGFQGTGAAAKPEEYAGHLLDLYSKCLQTVAGKK |
| Ga0208603_10426841 | 3300027109 | Forest Soil | TSSGVGFQGTGSAAKPEDYADHLLELYGKCLSAVAAKK |
| Ga0207780_10040272 | 3300027313 | Tropical Forest Soil | TGYGRTTSTGVGFQGSGSAAKPEDYATHLLELYGKCLGAVAAKK |
| Ga0209009_11394581 | 3300027667 | Forest Soil | SSGVGFQGSGAASKPEEYAGHLLELYGRCLQAVAGGKK |
| Ga0208989_100009131 | 3300027738 | Forest Soil | RTTSSGVGFQGTGAAAKPEDYAAHLLELYGKCLNAVAGKK |
| Ga0209655_101760223 | 3300027767 | Bog Forest Soil | SSGVGFQGTGSASKPEEYAAHLLELYGKCRAAVEGKK |
| Ga0209039_101534561 | 3300027825 | Bog Forest Soil | SGVGFQGTGSAAKPEEYATHLLELYGKCRAAVDGKK |
| Ga0209773_100249803 | 3300027829 | Bog Forest Soil | SGVGFQGSGAASKPEDYATHLLELYGRCLEAVQRKK |
| Ga0209773_101754691 | 3300027829 | Bog Forest Soil | GYGKTASSGGVGFSGGGAAAKPEDYAAHLLELYGKCLSAVGAKK |
| Ga0209167_103426582 | 3300027867 | Surface Soil | MTTGYGRTTSSGVGFQGGGSAAKPEDYADHLLDLYGKCLTAVAAKK |
| Ga0209283_107367682 | 3300027875 | Vadose Zone Soil | YGRTSSVGAGFQGSGAASKPEEYAAHLLELYGKCLAAVAGKK |
| Ga0209169_100117181 | 3300027879 | Soil | SSGVGFQGSGAASKPEDYASHLLELYGRCLEAVQRKK |
| Ga0209067_100877691 | 3300027898 | Watersheds | TSTGVGFSGSGSAAKPEDYADKLLELYGRCLGAVGGKK |
| Ga0209415_101354592 | 3300027905 | Peatlands Soil | GRTTSSGVGFQGTGSAAKPEDYADHLLELYGKCLGAVAAKK |
| Ga0209415_105338822 | 3300027905 | Peatlands Soil | AGVGFQGTAATDKPEDYAAHLLELYGRCLQSVGGK |
| Ga0209698_101315332 | 3300027911 | Watersheds | RTTSTGVGFQGTGSAAKPEDYAERLLELYGKCLGAVGGKNGKK |
| Ga0209698_102386601 | 3300027911 | Watersheds | TTSSGVGFQGTGSAAKPEDYAEKLLELYGKCLGAVSKK |
| Ga0209698_104904631 | 3300027911 | Watersheds | RTTSTGVGFQGTGSAAKPEDYAERLLELYGKCLSAVGGKNGKK |
| Ga0137415_102213014 | 3300028536 | Vadose Zone Soil | YGRTAGSGVGFQGSCAAAKPKDYAAHLLELYGKCLKAVDRKYP |
| Ga0137415_105625941 | 3300028536 | Vadose Zone Soil | TGYGRTTSSGVGFQGTGAAAKPEEYASHLLELYGKCLHAVAKK |
| Ga0302234_103126062 | 3300028773 | Palsa | TASSGGVGFSGGGAAAKPEDYATHLLELYGKCLGAVGAKK |
| Ga0302234_104889931 | 3300028773 | Palsa | ASTGVGFQGTGSAAKPEEYATHLLELYGKCRAAVDGKK |
| Ga0302228_100395102 | 3300028808 | Palsa | KTASSGGVGFSGGGAAAKPEDYATHLLELYGKCLGAVGAKK |
| Ga0308309_116391691 | 3300028906 | Soil | SAVGFQGSGSAAKPEEYAEKLLELYGKCLGAVGGKK |
| Ga0222749_100369804 | 3300029636 | Soil | AGGVGFEKATGGASKPEDYAAHLLELYAKCLNAVKK |
| Ga0247271_1047361 | 3300029903 | Soil | TTGAGVGFQGTGAAAKPEDYAAQLLELYGRCLQSVEGK |
| Ga0311369_106787391 | 3300029910 | Palsa | SGVGFQGTGSASKPEEYAIHLLELYSKCRAAVDGKK |
| Ga0311352_103254651 | 3300029944 | Palsa | TSGAGVGFQGSGAADKPEDYAAHLLELYGRCLQSVGK |
| Ga0311343_103889091 | 3300029953 | Bog | GRTTSSGVGFQGTGSASKPEEYATHLLELYGKCRAAVGGKK |
| Ga0302186_102626602 | 3300030004 | Bog | KTTGAGVGFQGTGAAAKPEDYAAHLLELYGRCLQSVGGK |
| Ga0302174_100286961 | 3300030005 | Fen | KTSGTGVGFQGGGAAAKPEDYADHLLELYGKCLKAVGGK |
| Ga0302177_100000261 | 3300030053 | Palsa | SGVGFQGTGSASKPEEYAAQLLELYGKCKAAVGGKK |
| Ga0311354_102799643 | 3300030618 | Palsa | AMTTGYGKTASSGGVGFTGGGAAAKPEDYATHLLELYGKCLGAVGAKK |
| Ga0311354_115210391 | 3300030618 | Palsa | GVGFTGGGAASKPEDYAAHLLELYGKCRAAVEGKK |
| Ga0210251_111652912 | 3300030624 | Soil | YGRTTSSGVGFQGTGSAAKPEDYAEHLLELYGKCRAAVEGEK |
| Ga0265459_121861682 | 3300030741 | Soil | GRTTSSGVGFQGTGSAAKPEDYAEHLLELYGKCRAAVEGEK |
| Ga0265461_127740911 | 3300030743 | Soil | SGVGFQGTGSASKPEEYASHLLELYGKCRTAVESKK |
| Ga0265461_128300571 | 3300030743 | Soil | PSSSGVGFQGSGAASKPEDYANHLLELYGRCLEAVQRKK |
| Ga0265750_10765481 | 3300030813 | Soil | GVGFSGSGSAAKPEDYATHLLELYGKCLGAVSAKK |
| Ga0170834_1136713461 | 3300031057 | Forest Soil | SGVGFQGSGSAAKPEEYAAHLLELYGKCRAAVEGKK |
| Ga0170824_1090146272 | 3300031231 | Forest Soil | STGVGFQGTGAAAKPEDYATHLLELYGKCLAAVEGAPPGSGKK |
| Ga0170824_1203577121 | 3300031231 | Forest Soil | TGYGRTSSSGVGFQGTGAASKPEEYAGHLLELYGKCLHAVAKK |
| Ga0170824_1212735421 | 3300031231 | Forest Soil | TTSSGVGFQGTGAAAKPEEYAGHLLELYSRCLQTVQAKK |
| Ga0265339_100214696 | 3300031249 | Rhizosphere | VGAGVGFQGGGAASKPEEYADHLLELYGKCLKAVGGK |
| Ga0170818_1030806292 | 3300031474 | Forest Soil | TASSGVGFQGTGSAAKPEDYAAHLLELYGKCLSAVAGKK |
| Ga0310686_1105924461 | 3300031708 | Soil | MTTGYGRTTSSGVGFQGTGSVSKPDEYAAQLLELYGKCLAAIGSKK |
| Ga0307476_110490892 | 3300031715 | Hardwood Forest Soil | GVGFQGSGSAAKPEDYAAHLLELYGKCLGAVGAKK |
| Ga0307474_100336851 | 3300031718 | Hardwood Forest Soil | GRTTSAGVGFQGTGSAAKPEEYATHLLELYGKCLNAIAPKK |
| Ga0307478_107622721 | 3300031823 | Hardwood Forest Soil | TGYGRTTSSGVGFQGTGSASKPDEYAAQLLEVYGKCRAAVGGNVAGKK |
| Ga0307478_113527482 | 3300031823 | Hardwood Forest Soil | TGYGRTTSSGVGFQGTGAAAKPEDYAARLLELYGKCLGAVGAKK |
| Ga0306925_112811952 | 3300031890 | Soil | TSYGKAGAAGVGFQGSVSPNAADEYAKHLLELYGRCLEAVAGKK |
| Ga0306923_100731715 | 3300031910 | Soil | PGVGFQGNVSPHAAEEYAQHLLELYGRCLEAVQGKK |
| Ga0308174_101325911 | 3300031939 | Soil | RTTSTGVGFQGSGSAAKPEDYAEKLLELYGRCLGAVSGKK |
| Ga0310916_102179693 | 3300031942 | Soil | APGVGFQGSVSSKAAEDYALQLLQLYGRCLDAVQGKK |
| Ga0307471_1030727412 | 3300032180 | Hardwood Forest Soil | GLGFQGSGAAAKPEEYAAHLLELYGKCLQAVAARK |
| Ga0307472_1002780761 | 3300032205 | Hardwood Forest Soil | MTTGYGRVTSTGVGFQGSGAAAKPEDYAEKLLELYSKCLSTVGAKK |
| Ga0348332_101668031 | 3300032515 | Plant Litter | STGVGFQGSGSASKPEEYAAHLLELYSKCRGAVEGKK |
| Ga0335085_101794091 | 3300032770 | Soil | TTSSGVGFTGTGSAAKPEDYAEKLLELYSRCLSTVGGKK |
| Ga0335085_104836931 | 3300032770 | Soil | AAMAGFQGSGAAAKPEDYAAHLLELYGRCLSAVAGKG |
| Ga0335078_104696201 | 3300032805 | Soil | RQAPGSVGFQGTGSAAKPDEYAEKLLELYGRCLGQVSGKK |
| Ga0335080_114885302 | 3300032828 | Soil | STAGVGFQGGGAASKPEDYATHLLELYGQCLKAVEGK |
| Ga0335083_105749681 | 3300032954 | Soil | ASGGVGFTGSGSAAKPEDYADKLLELYGRCLGSVSGKK |
| Ga0335073_106472263 | 3300033134 | Soil | SSGTAVGLGFQGGPGSSKPEEYADHLLELYGKCLKAVEGK |
| Ga0326728_105342342 | 3300033402 | Peat Soil | STGVGFQGAGSAAKPEDYAERLLELYGKCLNAVGKK |
| Ga0310810_112005451 | 3300033412 | Soil | GYGRTSSAGGVGFTGGGAAAKPEDYAAHLLELYGRCLGAVGGKK |
| Ga0371489_0321421_3_110 | 3300033755 | Peat Soil | GVGFQGTGSASKPDEYAAQLLELYAKCKAAVEGKK |
| ⦗Top⦘ |