


| Basic Information | |
|---|---|
| Family ID | F020253 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.18 % |
| % of genes near scaffold ends (potentially truncated) | 42.67 % |
| % of genes from short scaffolds (< 2000 bps) | 72.89 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.444 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.889 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 8.70% Coil/Unstructured: 91.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF00268 | Ribonuc_red_sm | 12.89 |
| PF02867 | Ribonuc_red_lgC | 9.33 |
| PF01970 | TctA | 4.89 |
| PF03796 | DnaB_C | 4.44 |
| PF00574 | CLP_protease | 1.33 |
| PF00154 | RecA | 0.89 |
| PF00550 | PP-binding | 0.44 |
| PF00497 | SBP_bac_3 | 0.44 |
| PF14572 | Pribosyl_synth | 0.44 |
| PF01106 | NifU | 0.44 |
| PF12627 | PolyA_pol_RNAbd | 0.44 |
| PF13186 | SPASM | 0.44 |
| PF00271 | Helicase_C | 0.44 |
| PF03477 | ATP-cone | 0.44 |
| PF13671 | AAA_33 | 0.44 |
| PF05488 | PAAR_motif | 0.44 |
| PF06233 | Usg | 0.44 |
| PF00483 | NTP_transferase | 0.44 |
| PF00136 | DNA_pol_B | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 12.89 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 9.33 |
| COG1784 | TctA family transporter | General function prediction only [R] | 4.89 |
| COG3333 | TctA family transporter | General function prediction only [R] | 4.89 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 4.44 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 4.44 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.67 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 2.67 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.33 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.89 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.44 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.44 % |
| All Organisms | root | All Organisms | 47.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10235866 | Not Available | 586 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10230621 | Not Available | 501 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10117253 | Not Available | 938 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1002214 | All Organisms → Viruses → Predicted Viral | 1953 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1012540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1021212 | Not Available | 518 | Open in IMG/M |
| 3300000188|SI60aug11_150mDRAFT_c1014749 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300000254|SI34jun09_100mDRAFT_1036297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300000256|LP_F_10_SI03_120DRAFT_1009289 | All Organisms → Viruses → Predicted Viral | 2838 | Open in IMG/M |
| 3300000260|LP_A_09_P20_500DRAFT_1047468 | Not Available | 539 | Open in IMG/M |
| 3300000928|OpTDRAFT_10018542 | Not Available | 650 | Open in IMG/M |
| 3300001450|JGI24006J15134_10045448 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300001450|JGI24006J15134_10089551 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300001450|JGI24006J15134_10228015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300001589|JGI24005J15628_10096236 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300001589|JGI24005J15628_10156725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300002524|JGI24927J35514_1002844 | All Organisms → Viruses → Predicted Viral | 1687 | Open in IMG/M |
| 3300002754|JGI24928J39210_1018701 | Not Available | 501 | Open in IMG/M |
| 3300002913|JGI26060J43896_10054036 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300002913|JGI26060J43896_10175177 | Not Available | 534 | Open in IMG/M |
| 3300003478|JGI26238J51125_1022397 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1500 | Open in IMG/M |
| 3300003619|JGI26380J51729_10107721 | Not Available | 615 | Open in IMG/M |
| 3300003620|JGI26273J51734_10015820 | All Organisms → Viruses → Predicted Viral | 3003 | Open in IMG/M |
| 3300004097|Ga0055584_100445160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300005057|Ga0068511_1108187 | Not Available | 500 | Open in IMG/M |
| 3300005234|Ga0066613_1234922 | Not Available | 519 | Open in IMG/M |
| 3300005239|Ga0073579_1007871 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300005239|Ga0073579_1095403 | Not Available | 14004 | Open in IMG/M |
| 3300005402|Ga0066855_10014400 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300005404|Ga0066856_10004024 | Not Available | 6023 | Open in IMG/M |
| 3300005404|Ga0066856_10230911 | Not Available | 802 | Open in IMG/M |
| 3300005522|Ga0066861_10309396 | Not Available | 535 | Open in IMG/M |
| 3300005603|Ga0066853_10107886 | All Organisms → cellular organisms → Archaea | 945 | Open in IMG/M |
| 3300005604|Ga0066852_10191314 | Not Available | 705 | Open in IMG/M |
| 3300005837|Ga0078893_11402293 | Not Available | 7203 | Open in IMG/M |
| 3300005838|Ga0008649_10294319 | Not Available | 608 | Open in IMG/M |
| 3300006164|Ga0075441_10384998 | Not Available | 508 | Open in IMG/M |
| 3300006164|Ga0075441_10387098 | Not Available | 506 | Open in IMG/M |
| 3300006166|Ga0066836_10033018 | All Organisms → Viruses → Predicted Viral | 2918 | Open in IMG/M |
| 3300006190|Ga0075446_10189167 | Not Available | 577 | Open in IMG/M |
| 3300006191|Ga0075447_10058304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1406 | Open in IMG/M |
| 3300006191|Ga0075447_10060063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
| 3300006191|Ga0075447_10065542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1307 | Open in IMG/M |
| 3300006191|Ga0075447_10155489 | Not Available | 767 | Open in IMG/M |
| 3300006484|Ga0070744_10121283 | Not Available | 753 | Open in IMG/M |
| 3300006737|Ga0098037_1165913 | Not Available | 736 | Open in IMG/M |
| 3300006750|Ga0098058_1008108 | All Organisms → Viruses → Predicted Viral | 3168 | Open in IMG/M |
| 3300006752|Ga0098048_1002089 | All Organisms → cellular organisms → Bacteria | 8489 | Open in IMG/M |
| 3300006752|Ga0098048_1002796 | All Organisms → Viruses | 7243 | Open in IMG/M |
| 3300006789|Ga0098054_1001570 | All Organisms → cellular organisms → Bacteria | 11371 | Open in IMG/M |
| 3300006789|Ga0098054_1015372 | All Organisms → Viruses → Predicted Viral | 3102 | Open in IMG/M |
| 3300006789|Ga0098054_1024863 | All Organisms → Viruses → Predicted Viral | 2368 | Open in IMG/M |
| 3300006789|Ga0098054_1202173 | Not Available | 724 | Open in IMG/M |
| 3300006789|Ga0098054_1216137 | Not Available | 696 | Open in IMG/M |
| 3300006793|Ga0098055_1110997 | Not Available | 1068 | Open in IMG/M |
| 3300006793|Ga0098055_1227232 | Not Available | 705 | Open in IMG/M |
| 3300006921|Ga0098060_1209142 | Not Available | 532 | Open in IMG/M |
| 3300006925|Ga0098050_1029459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1495 | Open in IMG/M |
| 3300006928|Ga0098041_1127553 | Not Available | 820 | Open in IMG/M |
| 3300006947|Ga0075444_10368279 | Not Available | 544 | Open in IMG/M |
| 3300006990|Ga0098046_1077800 | Not Available | 749 | Open in IMG/M |
| 3300007637|Ga0102906_1008136 | All Organisms → Viruses → Predicted Viral | 3367 | Open in IMG/M |
| 3300007954|Ga0105739_1046682 | Not Available | 937 | Open in IMG/M |
| 3300007954|Ga0105739_1078850 | Not Available | 739 | Open in IMG/M |
| 3300007992|Ga0105748_10456389 | Not Available | 555 | Open in IMG/M |
| 3300008253|Ga0105349_10008549 | Not Available | 4336 | Open in IMG/M |
| 3300008253|Ga0105349_10457667 | Not Available | 533 | Open in IMG/M |
| 3300008629|Ga0115658_1007140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10453 | Open in IMG/M |
| 3300008950|Ga0102891_1020762 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300008996|Ga0102831_1127616 | Not Available | 845 | Open in IMG/M |
| 3300008999|Ga0102816_1123617 | Not Available | 796 | Open in IMG/M |
| 3300009024|Ga0102811_1014654 | All Organisms → Viruses → Predicted Viral | 3094 | Open in IMG/M |
| 3300009052|Ga0102886_1206780 | Not Available | 579 | Open in IMG/M |
| 3300009054|Ga0102826_1067271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 862 | Open in IMG/M |
| 3300009058|Ga0102854_1098162 | Not Available | 838 | Open in IMG/M |
| 3300009080|Ga0102815_10571340 | Not Available | 634 | Open in IMG/M |
| 3300009086|Ga0102812_10015620 | All Organisms → Viruses → Predicted Viral | 4445 | Open in IMG/M |
| 3300009086|Ga0102812_10018017 | All Organisms → Viruses → Predicted Viral | 4098 | Open in IMG/M |
| 3300009103|Ga0117901_1060978 | Not Available | 2421 | Open in IMG/M |
| 3300009172|Ga0114995_10169315 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300009409|Ga0114993_11309378 | Not Available | 508 | Open in IMG/M |
| 3300009420|Ga0114994_10077250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2274 | Open in IMG/M |
| 3300009420|Ga0114994_10160990 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300009420|Ga0114994_10315910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300009420|Ga0114994_10489621 | Not Available | 811 | Open in IMG/M |
| 3300009437|Ga0115556_1081105 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300009443|Ga0115557_1256705 | Not Available | 667 | Open in IMG/M |
| 3300009512|Ga0115003_10807336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300009593|Ga0115011_10000386 | Not Available | 37203 | Open in IMG/M |
| 3300009705|Ga0115000_10022226 | All Organisms → Viruses → Predicted Viral | 4530 | Open in IMG/M |
| 3300009705|Ga0115000_10106789 | All Organisms → Viruses → Predicted Viral | 1882 | Open in IMG/M |
| 3300009705|Ga0115000_10677102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300009705|Ga0115000_10789746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300009706|Ga0115002_10978277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300009706|Ga0115002_11048764 | Not Available | 557 | Open in IMG/M |
| 3300010149|Ga0098049_1030010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1770 | Open in IMG/M |
| 3300010149|Ga0098049_1136537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 760 | Open in IMG/M |
| 3300010150|Ga0098056_1294255 | Not Available | 535 | Open in IMG/M |
| 3300010150|Ga0098056_1294489 | Not Available | 535 | Open in IMG/M |
| 3300010151|Ga0098061_1212320 | Not Available | 683 | Open in IMG/M |
| 3300010153|Ga0098059_1313401 | Not Available | 598 | Open in IMG/M |
| 3300012413|Ga0138258_1027846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300012413|Ga0138258_1122404 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300012418|Ga0138261_1662720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1292 | Open in IMG/M |
| 3300012953|Ga0163179_10115928 | Not Available | 1958 | Open in IMG/M |
| 3300014959|Ga0134299_1053660 | Not Available | 578 | Open in IMG/M |
| 3300017746|Ga0181389_1114161 | Not Available | 736 | Open in IMG/M |
| 3300017763|Ga0181410_1140049 | Not Available | 683 | Open in IMG/M |
| 3300017767|Ga0181406_1190912 | Not Available | 610 | Open in IMG/M |
| 3300017773|Ga0181386_1246090 | Not Available | 529 | Open in IMG/M |
| 3300017782|Ga0181380_1193029 | Not Available | 685 | Open in IMG/M |
| 3300017786|Ga0181424_10227264 | Not Available | 785 | Open in IMG/M |
| 3300017786|Ga0181424_10259175 | Not Available | 727 | Open in IMG/M |
| 3300019756|Ga0194023_1020726 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300020165|Ga0206125_10053790 | All Organisms → Viruses → Predicted Viral | 1931 | Open in IMG/M |
| 3300020253|Ga0211685_1009437 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300020317|Ga0211688_1011936 | All Organisms → Viruses → Predicted Viral | 2006 | Open in IMG/M |
| 3300020335|Ga0211690_1065865 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 805 | Open in IMG/M |
| 3300020358|Ga0211689_1009594 | All Organisms → Viruses → Predicted Viral | 3679 | Open in IMG/M |
| 3300020379|Ga0211652_10123085 | Not Available | 786 | Open in IMG/M |
| 3300020383|Ga0211646_10154854 | Not Available | 824 | Open in IMG/M |
| 3300020399|Ga0211623_10007062 | All Organisms → Viruses → Predicted Viral | 4095 | Open in IMG/M |
| 3300020438|Ga0211576_10561667 | Not Available | 572 | Open in IMG/M |
| 3300021068|Ga0206684_1100761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300021084|Ga0206678_10001781 | All Organisms → cellular organisms → Bacteria | 13976 | Open in IMG/M |
| 3300021087|Ga0206683_10018278 | All Organisms → Viruses → Predicted Viral | 4227 | Open in IMG/M |
| 3300021375|Ga0213869_10000379 | Not Available | 36628 | Open in IMG/M |
| 3300021375|Ga0213869_10000674 | Not Available | 26909 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10115023 | Not Available | 1481 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10384703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 619 | Open in IMG/M |
| 3300024183|Ga0228603_1068156 | Not Available | 559 | Open in IMG/M |
| 3300024229|Ga0233402_1006210 | All Organisms → Viruses → Predicted Viral | 2947 | Open in IMG/M |
| 3300024229|Ga0233402_1006691 | All Organisms → Viruses → Predicted Viral | 2818 | Open in IMG/M |
| 3300024236|Ga0228655_1000743 | Not Available | 10892 | Open in IMG/M |
| 3300024236|Ga0228655_1044571 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1032 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10038951 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 2545 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10350837 | Not Available | 550 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1247961 | Not Available | 721 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10008054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8978 | Open in IMG/M |
| 3300024266|Ga0228661_1096848 | Not Available | 553 | Open in IMG/M |
| 3300024314|Ga0228657_1100813 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 575 | Open in IMG/M |
| 3300024315|Ga0228618_1098770 | Not Available | 510 | Open in IMG/M |
| 3300024321|Ga0228626_1074097 | Not Available | 774 | Open in IMG/M |
| (restricted) 3300024324|Ga0233443_1207412 | Not Available | 684 | Open in IMG/M |
| 3300024343|Ga0244777_10010174 | Not Available | 5989 | Open in IMG/M |
| 3300024346|Ga0244775_11286601 | Not Available | 566 | Open in IMG/M |
| 3300025066|Ga0208012_1001160 | Not Available | 7483 | Open in IMG/M |
| 3300025070|Ga0208667_1000049 | Not Available | 50938 | Open in IMG/M |
| 3300025070|Ga0208667_1063287 | Not Available | 572 | Open in IMG/M |
| 3300025084|Ga0208298_1010392 | Not Available | 2301 | Open in IMG/M |
| 3300025084|Ga0208298_1089156 | Not Available | 567 | Open in IMG/M |
| 3300025085|Ga0208792_1023092 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300025085|Ga0208792_1024485 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300025085|Ga0208792_1027452 | Not Available | 1147 | Open in IMG/M |
| 3300025099|Ga0208669_1008448 | Not Available | 2972 | Open in IMG/M |
| 3300025099|Ga0208669_1025719 | All Organisms → Viruses → Predicted Viral | 1472 | Open in IMG/M |
| 3300025099|Ga0208669_1087555 | Not Available | 662 | Open in IMG/M |
| 3300025108|Ga0208793_1112138 | Not Available | 753 | Open in IMG/M |
| 3300025128|Ga0208919_1032679 | All Organisms → Viruses → Predicted Viral | 1873 | Open in IMG/M |
| 3300025137|Ga0209336_10026332 | All Organisms → Viruses → Predicted Viral | 2001 | Open in IMG/M |
| 3300025151|Ga0209645_1001095 | Not Available | 13746 | Open in IMG/M |
| 3300025547|Ga0209556_1113921 | Not Available | 576 | Open in IMG/M |
| 3300025641|Ga0209833_1034148 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| 3300025676|Ga0209657_1148413 | Not Available | 663 | Open in IMG/M |
| 3300025712|Ga0209305_1020359 | All Organisms → Viruses → Predicted Viral | 2619 | Open in IMG/M |
| 3300025770|Ga0209362_1039772 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300025806|Ga0208545_1038988 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300025849|Ga0209603_1285971 | Not Available | 583 | Open in IMG/M |
| 3300025870|Ga0209666_1099273 | Not Available | 1419 | Open in IMG/M |
| 3300025876|Ga0209223_10169839 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300026119|Ga0207966_1058754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 980 | Open in IMG/M |
| 3300026434|Ga0247591_1102726 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 527 | Open in IMG/M |
| 3300026479|Ga0228622_1110888 | Not Available | 540 | Open in IMG/M |
| 3300026503|Ga0247605_1026191 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1454 | Open in IMG/M |
| 3300026517|Ga0228607_1171296 | Not Available | 517 | Open in IMG/M |
| 3300027186|Ga0208797_1021770 | Not Available | 859 | Open in IMG/M |
| 3300027191|Ga0208021_1027913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 855 | Open in IMG/M |
| 3300027197|Ga0208922_1022883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1123 | Open in IMG/M |
| 3300027206|Ga0208023_1016367 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300027501|Ga0208948_1020792 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| 3300027506|Ga0208973_1112494 | Not Available | 601 | Open in IMG/M |
| 3300027522|Ga0209384_1016432 | All Organisms → Viruses → Predicted Viral | 2450 | Open in IMG/M |
| 3300027525|Ga0208437_1027499 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
| 3300027668|Ga0209482_1001410 | Not Available | 16551 | Open in IMG/M |
| 3300027668|Ga0209482_1009393 | Not Available | 4793 | Open in IMG/M |
| 3300027672|Ga0209383_1007627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 5396 | Open in IMG/M |
| 3300027672|Ga0209383_1014898 | All Organisms → Viruses → Predicted Viral | 3508 | Open in IMG/M |
| 3300027686|Ga0209071_1008569 | All Organisms → Viruses → Predicted Viral | 3414 | Open in IMG/M |
| 3300027704|Ga0209816_1002847 | Not Available | 12062 | Open in IMG/M |
| 3300027751|Ga0208304_10306529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 554 | Open in IMG/M |
| 3300027752|Ga0209192_10121404 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300027779|Ga0209709_10124241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300027780|Ga0209502_10384448 | Not Available | 580 | Open in IMG/M |
| 3300027788|Ga0209711_10277275 | Not Available | 735 | Open in IMG/M |
| 3300027801|Ga0209091_10137590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300027813|Ga0209090_10075754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
| 3300027813|Ga0209090_10285228 | Not Available | 824 | Open in IMG/M |
| 3300027833|Ga0209092_10427809 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 688 | Open in IMG/M |
| 3300027906|Ga0209404_10000269 | Not Available | 42220 | Open in IMG/M |
| 3300028008|Ga0228674_1133964 | Not Available | 838 | Open in IMG/M |
| 3300028133|Ga0228609_1003825 | All Organisms → Viruses → Predicted Viral | 4954 | Open in IMG/M |
| 3300028134|Ga0256411_1004724 | Not Available | 3255 | Open in IMG/M |
| 3300028189|Ga0257127_1180610 | Not Available | 563 | Open in IMG/M |
| 3300028190|Ga0257108_1006444 | All Organisms → Viruses → Predicted Viral | 3401 | Open in IMG/M |
| 3300028196|Ga0257114_1344599 | Not Available | 503 | Open in IMG/M |
| 3300028197|Ga0257110_1205379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300028396|Ga0228643_1139875 | Not Available | 549 | Open in IMG/M |
| 3300028416|Ga0228614_1032201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
| 3300031142|Ga0308022_1183738 | Not Available | 590 | Open in IMG/M |
| 3300031143|Ga0308025_1004800 | Not Available | 5808 | Open in IMG/M |
| 3300031599|Ga0308007_10000790 | Not Available | 14070 | Open in IMG/M |
| 3300031599|Ga0308007_10070153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300031599|Ga0308007_10261267 | Not Available | 584 | Open in IMG/M |
| 3300031606|Ga0302119_10019366 | All Organisms → Viruses → Predicted Viral | 2897 | Open in IMG/M |
| 3300031606|Ga0302119_10384844 | Not Available | 510 | Open in IMG/M |
| 3300031628|Ga0308014_1032358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1327 | Open in IMG/M |
| 3300031659|Ga0307986_10331296 | Not Available | 628 | Open in IMG/M |
| 3300031660|Ga0307994_1013310 | All Organisms → Viruses → Predicted Viral | 3809 | Open in IMG/M |
| 3300031660|Ga0307994_1081805 | Not Available | 1194 | Open in IMG/M |
| 3300031705|Ga0308003_1048112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1492 | Open in IMG/M |
| 3300031757|Ga0315328_10089565 | Not Available | 1761 | Open in IMG/M |
| 3300031757|Ga0315328_10119931 | Not Available | 1522 | Open in IMG/M |
| 3300031774|Ga0315331_10356476 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300032130|Ga0315333_10331277 | Not Available | 720 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.22% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 8.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.22% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.44% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.11% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.11% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.11% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.22% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.78% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.33% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.33% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.33% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.44% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.44% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.44% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.44% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.44% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.44% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.44% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.44% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000188 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 150m | Environmental | Open in IMG/M |
| 3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
| 3300000256 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120 | Environmental | Open in IMG/M |
| 3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002524 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 | Environmental | Open in IMG/M |
| 3300002754 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 | Environmental | Open in IMG/M |
| 3300002913 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003619 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005234 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_100m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300014959 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubation | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020383 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024183 | Seawater microbial communities from Monterey Bay, California, United States - 3D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024315 | Seawater microbial communities from Monterey Bay, California, United States - 20D | Environmental | Open in IMG/M |
| 3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300026119 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026434 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027191 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027501 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028133 | Seawater microbial communities from Monterey Bay, California, United States - 10D | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028189 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031705 | Marine microbial communities from water near the shore, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102358662 | 3300000101 | Marine | MGKRSVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV* |
| DelMOSum2011_102306211 | 3300000115 | Marine | GEYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| DelMOWin2010_101172534 | 3300000117 | Marine | MGKRXIPGIITKXGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| LPjun09P1210mDRAFT_10022142 | 3300000168 | Marine | MGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVKNV* |
| LPjun09P1210mDRAFT_10125402 | 3300000168 | Marine | MGKRSVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV* |
| LPjun09P1210mDRAFT_10212122 | 3300000168 | Marine | MGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| SI60aug11_150mDRAFT_10147491 | 3300000188 | Marine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSK |
| SI34jun09_100mDRAFT_10362971 | 3300000254 | Marine | RKKGQRPVKKDMSHSTFTAKRHPNSKRVTSGAIT* |
| LP_F_10_SI03_120DRAFT_10092893 | 3300000256 | Marine | MGKRSIPGXITXKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| LP_A_09_P20_500DRAFT_10474683 | 3300000260 | Marine | MNREMSVGKRNIAGIITKRGAPKLKKNMSHSTFTAKRHPNSK |
| OpTDRAFT_100185422 | 3300000928 | Freshwater And Marine | MGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRARNA* |
| JGI24006J15134_100454483 | 3300001450 | Marine | MGKRSVPGIITKKGQPXVKKNMSHSTFTAKRHPNSKRVRNA* |
| JGI24006J15134_100895513 | 3300001450 | Marine | PGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA* |
| JGI24006J15134_102280152 | 3300001450 | Marine | GEYIMGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV* |
| JGI24005J15628_100962363 | 3300001589 | Marine | MGKRSIPGXITXKGQPRVKKNMSHSTFTAKRHPNSKRVKNA* |
| JGI24005J15628_101567251 | 3300001589 | Marine | PGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| JGI24927J35514_10028443 | 3300002524 | Marine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| JGI24928J39210_10187011 | 3300002754 | Marine | MGKRXIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| JGI26060J43896_100540362 | 3300002913 | Marine | MGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA* |
| JGI26060J43896_101751772 | 3300002913 | Marine | MGKRSVPGIITKKGNKVKKNMSHSTFTAKRHPNSKRVKNV* |
| JGI26238J51125_10223972 | 3300003478 | Marine | MGKRTIPYTQARKKGQPPVKKDMSHSTFTAKRHPNSKRVTSGALK* |
| JGI26380J51729_101077211 | 3300003619 | Marine | IMGKRSIPGIITKKGQPKVKKNMSHSTFTAXRHPNSKRVRNA* |
| JGI26273J51734_100158205 | 3300003620 | Marine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA* |
| Ga0055584_1004451603 | 3300004097 | Pelagic Marine | MGKRTIPYTQVRKKGQKPVKKDMSHSTFTAKRHPNSKRVTSGAFK* |
| Ga0068511_11081872 | 3300005057 | Marine Water | MGKRAIPGIIVKKGQPKLKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0066613_12349221 | 3300005234 | Marine | MGKRAVPGIIVKKGAPKIKKNMSHATFTAKRHPNSKRVVNGSIK* |
| Ga0073579_10078713 | 3300005239 | Marine | MGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV* |
| Ga0073579_10954036 | 3300005239 | Marine | MGKRSVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVKNV* |
| Ga0066855_100144004 | 3300005402 | Marine | MGKRAVPGIITKKGHPRIKKSVSHGTFRCKRHPNSKRCQNG* |
| Ga0066856_100040247 | 3300005404 | Marine | MGKRAVPGIIVKRGAPKIKKNMSHSTFTAKRHPNSKRVLNGSIKI* |
| Ga0066856_102309112 | 3300005404 | Marine | MGKRAIPGIKTVRGQTRFKKNMSHSTFTAKRHPNSKRVLNGSIK* |
| Ga0066861_103093961 | 3300005522 | Marine | VFIMGKRAIPGIKTVRGQTRFKKNMSHSTFTAKRHPNSKRVLNGSIK* |
| Ga0066853_101078863 | 3300005603 | Marine | MGKRSIRGIITKKGAPKLKKTMSHSTYTAKRHPNSKRVRNGQD* |
| Ga0066852_101913143 | 3300005604 | Marine | MGKRQIPHCQPRKRGQKPIKKDMSHSTFVAKRHPNSKRVTSGAIK* |
| Ga0078893_114022938 | 3300005837 | Marine Surface Water | MGKRAVPHVKTPKRGQKATKKNLSHSTFVAKRHPNSKRVTSGAIT* |
| Ga0008649_102943191 | 3300005838 | Marine | IMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0075441_103849982 | 3300006164 | Marine | MGKRSVPYIITKKGAPKVKKNMSHSTHTAKRHPNSKRVKNA* |
| Ga0075441_103870982 | 3300006164 | Marine | MGKRTIPHTIPRKKGQRPIKKDMSHSTHTAKRHPNSKRVTSGTMK* |
| Ga0066836_100330183 | 3300006166 | Marine | MGKRSIPGIITKKGAPKLKKNMSHSTFTAKRHPNSKRVKNA* |
| Ga0075446_101891671 | 3300006190 | Marine | MGKRTIPHTVPRKKGQRPIKKDMSHSTHTATRHPNSKRVTSGAMK* |
| Ga0075447_100583041 | 3300006191 | Marine | MGKRTIPHTVPRKKGARPIKKDMSHSTHTTKRHPNSKRVTSGAQK* |
| Ga0075447_100600633 | 3300006191 | Marine | MGKRTIPHCQPRKRGQRPIKKDMSHSTFTVKRHPNSKRVTSGTMK* |
| Ga0075447_100655421 | 3300006191 | Marine | KRTIPHTVPRKKGARPIKKDMSHSTHTTKRHPNSKRVTSGAQK* |
| Ga0075447_101554891 | 3300006191 | Marine | MGKRTIPHTVPRKKGARPIKKDMSHSTFTAKRHPNSKRVTSGTMK* |
| Ga0070744_101212833 | 3300006484 | Estuarine | MGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV* |
| Ga0098037_11659133 | 3300006737 | Marine | MGKRAIPGIIVKRGQKRLKKNMSHSTFTEKRHPNS |
| Ga0098058_10081082 | 3300006750 | Marine | MGKRQIPHCQPRKRGQKPIKKDMSHSTFVAKRHPNSKRVTSGAVK* |
| Ga0098048_100208914 | 3300006752 | Marine | MGKRAVPHVKTPKRGQKASKKNLSHSTFVAKRHPNSKRVTSGAVT* |
| Ga0098048_10027965 | 3300006752 | Marine | MGKRSVPHVKTPIRGQKASKKNMSHSTFVVKRHPNSKRVTSGAIT* |
| Ga0098048_11139071 | 3300006752 | Marine | SKRGVKQIKKNMSHGTFRVKRHPNSKRVTNGSEK* |
| Ga0098054_100157012 | 3300006789 | Marine | MGKRAVPHVKTPKRGQKATKKNLSHSTFVAKHHPNSKRVTSGAIT* |
| Ga0098054_10153722 | 3300006789 | Marine | MGKRSVPHVKTPKRGQKASKKNMSHSTFVVKRHPNSKRVTSGAIT* |
| Ga0098054_10248633 | 3300006789 | Marine | MGKRAIPGIIVKRGQKSLKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0098054_12021732 | 3300006789 | Marine | MGKRQIPHCQPRKRGQRPIKKDMSHSTFVVKRHPNSKRVTSGART* |
| Ga0098054_12161372 | 3300006789 | Marine | MGKRSIPGIIVKRGQKSLKKNMSHSTFTAKRHPNSKRVKNA* |
| Ga0098055_11109972 | 3300006793 | Marine | MGKRAVPGIIVKKGAQRIKKNMSHATFTAKRHPNSKRVLNGSIK* |
| Ga0098055_12272321 | 3300006793 | Marine | MGKRTIPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGAIT* |
| Ga0098060_12091421 | 3300006921 | Marine | PKRRGEYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0098050_10294591 | 3300006925 | Marine | TPKRGQKASKKNLSHSTFVAKRHPNSKRVTSGAVT* |
| Ga0098041_11275532 | 3300006928 | Marine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVKNA* |
| Ga0075444_103682791 | 3300006947 | Marine | MGKRTIPHVIPRKKGQRASKKDMSHSTFTATRHPNSKRIT |
| Ga0098046_10778001 | 3300006990 | Marine | TIPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGSIR* |
| Ga0102906_10081362 | 3300007637 | Estuarine | MGKRTIPHCQPRKRGQKPIKKDMSHSTFVVKRHPNSKRVTSGART* |
| Ga0105739_10466823 | 3300007954 | Estuary Water | SIPRRITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA* |
| Ga0105739_10788501 | 3300007954 | Estuary Water | MGKRSIPGIITKKGQPRVKKNMSHSPFTAKRHPNSKRVRNA* |
| Ga0105748_104563891 | 3300007992 | Estuary Water | IMGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVKNV* |
| Ga0105349_100085494 | 3300008253 | Methane Seep Mesocosm | MGKRTIPYTQIRKKGQKPIKKDMSHSTFTAKRHPNSKRVTSGALK* |
| Ga0105349_104576672 | 3300008253 | Methane Seep Mesocosm | MGKRSVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0115658_10071402 | 3300008629 | Marine | MGKRTVPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGSIR* |
| Ga0102891_10207622 | 3300008950 | Estuarine | MGKRTIPYTQARKKGQRPVKKDMSHSTFTAKRHPNSKRVTSGAIT* |
| Ga0102831_11276163 | 3300008996 | Estuarine | MGKRSIPGIITKKGQPKWKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0102816_11236173 | 3300008999 | Estuarine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNS |
| Ga0102811_10146545 | 3300009024 | Estuarine | MGKRAVPHVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGAVT* |
| Ga0102886_12067801 | 3300009052 | Estuarine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRV |
| Ga0102826_10672711 | 3300009054 | Estuarine | ARKKGQPPVKKDMSHSTFTAKRHPNSKRVTSGALK* |
| Ga0102854_10981623 | 3300009058 | Estuarine | GIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV* |
| Ga0102815_105713403 | 3300009080 | Estuarine | MGKRSVPGIITKKGQPKVKKNMSHSTFTAKRHPNS |
| Ga0102812_100156203 | 3300009086 | Estuarine | MGKRTVPYTQARKKGQPAIKKDMSHSTFTVKRHPNSKRVTSGAFK* |
| Ga0102812_100180171 | 3300009086 | Estuarine | RAVPHVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGAVT* |
| Ga0117901_10609782 | 3300009103 | Marine | MGKRAVPGIIVKKGVPRIKKNMSHATFTAKRHPNSKRVLNGSIK* |
| Ga0114995_101693153 | 3300009172 | Marine | MGKRAIPGIITKKGQPKVKKNVSHSTFTEKRHPNSKRVKNA* |
| Ga0114993_113093783 | 3300009409 | Marine | MGKRSVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVR |
| Ga0114994_100772501 | 3300009420 | Marine | KRTIPHTVPRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGAMK* |
| Ga0114994_101609901 | 3300009420 | Marine | KRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0114994_103159101 | 3300009420 | Marine | PRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGALK* |
| Ga0114994_104896213 | 3300009420 | Marine | MGKRAVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0115556_10811051 | 3300009437 | Pelagic Marine | SIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0115557_12567051 | 3300009443 | Pelagic Marine | RRGEYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0115003_108073361 | 3300009512 | Marine | AVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV* |
| Ga0115011_1000038657 | 3300009593 | Marine | MGKRAVPGIKTVRGQPRFKKNMSHATFTAKRHPNSKRVLNGSIK* |
| Ga0115000_100222262 | 3300009705 | Marine | MGKRTIPHTVPRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGAMK* |
| Ga0115000_101067894 | 3300009705 | Marine | MGKRTIPHTLPRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGAMK* |
| Ga0115000_106771021 | 3300009705 | Marine | GEYIMGTRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA* |
| Ga0115000_107897461 | 3300009705 | Marine | RSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV* |
| Ga0115002_109782771 | 3300009706 | Marine | RSVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV* |
| Ga0115002_110487643 | 3300009706 | Marine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVR |
| Ga0098049_10300105 | 3300010149 | Marine | VPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGAIT* |
| Ga0098049_11365371 | 3300010149 | Marine | LNIMGKRAVPHVKTPKRGQKATKKNLSHSTFVAKRHPNSKRVTSGAIT* |
| Ga0098056_12942551 | 3300010150 | Marine | MGKRTVPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVT |
| Ga0098056_12944892 | 3300010150 | Marine | MGKRAVPGIIVKKGAPRIKKNMSHATFTAKRHPNSKRVLNGSIK* |
| Ga0098061_12123203 | 3300010151 | Marine | MGKRSVPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGAIT* |
| Ga0098059_13134013 | 3300010153 | Marine | PHCQPRKRGQKPIKKDMSHSTFVAKRHPNSKRVTSGAVK* |
| Ga0138258_10278461 | 3300012413 | Polar Marine | RTIPHTVPRKKGQKPIKKDMSHSTHTTTRHPNSKRVTSGAMK* |
| Ga0138258_11224042 | 3300012413 | Polar Marine | MGKRSVPGIITKKGNKLKKNMSHSTFTAKRHPNSKRVKNV* |
| Ga0138261_16627203 | 3300012418 | Polar Marine | MGKRTIPHTVPRKKGQKPIKKDMSHSTNTAKRHPNSKRVTSGAMK* |
| Ga0163179_101159283 | 3300012953 | Seawater | MGKRAVPGIVVKKGQPKIKKNMSHATFTAKRHPNSKRVLNGSIR* |
| Ga0134299_10536603 | 3300014959 | Marine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRN |
| Ga0181389_11141611 | 3300017746 | Seawater | YIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVKNA |
| Ga0181410_11400493 | 3300017763 | Seawater | MGKRSVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA |
| Ga0181406_11909122 | 3300017767 | Seawater | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0181386_12460901 | 3300017773 | Seawater | MGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA |
| Ga0181380_11930291 | 3300017782 | Seawater | IPGIITKKGAPKLKKNMSHSTFTAKRHPNSKRARNA |
| Ga0181424_102272643 | 3300017786 | Seawater | MGKRSIPGIITKKGQPKVKKNMRHSTFTTKRHPNSKRVRNA |
| Ga0181424_102591753 | 3300017786 | Seawater | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKR |
| Ga0194023_10207263 | 3300019756 | Freshwater | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0206125_100537902 | 3300020165 | Seawater | MGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0211685_10094373 | 3300020253 | Marine | MGKRSVPGIITKKGNKVKKNMSHSTFTAKRHPNSKRVKNV |
| Ga0211688_10119363 | 3300020317 | Marine | MGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0211690_10658653 | 3300020335 | Marine | MGKRTVPYTQIRKKGQKPIKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0211689_10095942 | 3300020358 | Marine | MGKRTIPHTQARKKGQPPIKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0211652_101230853 | 3300020379 | Marine | MGKRAIPGIIVKRGQKRLKKNMSHSTFTEKRHPNSKRVRNA |
| Ga0211646_101548541 | 3300020383 | Marine | EMGKRSIRGIITKKGAPKLKKTMSHSTYTAKRHPNSKRVRNGQD |
| Ga0211623_100070623 | 3300020399 | Marine | MNREMSVGKRSIAGIITKRGAPRLKKNMSHSTYTAKRHPNSKRVKNG |
| Ga0211576_105616672 | 3300020438 | Marine | MGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0206684_11007611 | 3300021068 | Seawater | MGKRQIPHCQPRKRGQRPIKKDMSHSTFVVKRHPNSKRVTSGART |
| Ga0206678_1000178118 | 3300021084 | Seawater | MGKRAVPHVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGAVT |
| Ga0206683_100182787 | 3300021087 | Seawater | MGKRQIPHCQPRKRGQKPIKKDMSHSTFVVKRHPNSKRVTSGART |
| Ga0213869_100003795 | 3300021375 | Seawater | MGKRAVPFIKVKKGQPRVKKNMSHSTFKVKRHPNSKRVKNGALG |
| Ga0213869_1000067415 | 3300021375 | Seawater | MGKRAVPHVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGALK |
| (restricted) Ga0233432_101150233 | 3300023109 | Seawater | MGKRTIPYTQARKKGQPPVKKDMSHSTFTAKRHPNSKRVTSGAL |
| (restricted) Ga0233432_103847031 | 3300023109 | Seawater | KTMGKRTIPYTQARKKGQPPVKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0228603_10681561 | 3300024183 | Seawater | MGKRAVPHVKTPKRGQKASKKNLSHSTFVAKRHPN |
| Ga0233402_10062102 | 3300024229 | Seawater | MGKRAVPHVKTPKRGQKASKKNLSHSTFVAKRHPNSKRVTSGAVT |
| Ga0233402_10066912 | 3300024229 | Seawater | MGKRAIPHVKTPKRGQKATKKNLSHSTFVAKRHPNSKRVTSGAIT |
| Ga0228655_10007438 | 3300024236 | Seawater | MGKRTIPYTQARKKGQRPVKKDMSHSTFTAKRHPNSKRVTSGAIT |
| Ga0228655_10445713 | 3300024236 | Seawater | MGKRAVPGIIVKKGAPKIKKNMSHSTFTAKRHPNSKRVLNGSIKI |
| (restricted) Ga0233438_100389517 | 3300024255 | Seawater | MGKRTIPYTQARKKGQPPVKKDMSHSTFTAKRHPNSKRVTSGALK |
| (restricted) Ga0233438_103508373 | 3300024255 | Seawater | GKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA |
| (restricted) Ga0233437_12479611 | 3300024259 | Seawater | SIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| (restricted) Ga0233444_1000805418 | 3300024264 | Seawater | MGKRAVPHVKTPKRGQRATKKNLSHSTFISKRHPNSKRVTSGAVT |
| Ga0228661_10968482 | 3300024266 | Seawater | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVKNA |
| Ga0228657_11008132 | 3300024314 | Seawater | MGKRAVPGIIVKKGAPKIKKNMSHSTFTAKRHPNSKRVLNGSI |
| Ga0228618_10987702 | 3300024315 | Seawater | MGKRSIPGIITKKGKQKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0228626_10740973 | 3300024321 | Seawater | KTMGKRAVPHVKTPKRGQKASKKNLSHSTFVAKRHPNSKRVTSGAVT |
| (restricted) Ga0233443_12074121 | 3300024324 | Seawater | NRRGEYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0244777_100101747 | 3300024343 | Estuarine | MGKRTIPHCQPRKRGQKPIKKDMSHSTFVVKRHPNSKRVTSGART |
| Ga0244775_112866013 | 3300024346 | Estuarine | RRGEYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208012_100116011 | 3300025066 | Marine | MGKRQIPHCQPRKRGQKPIKKDMSHSTFVAKRHPNSKRVTSGAVK |
| Ga0208667_100004955 | 3300025070 | Marine | MGKRSVPHVKTPKRGQKASKKNMSHSTFVVKRHPNSKRVTSGAIT |
| Ga0208667_10632873 | 3300025070 | Marine | TIPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGSIR |
| Ga0208298_10103925 | 3300025084 | Marine | MGKRSIPGIITKKGAPKLKKNMSHSTFTAKRHPNSKRVKNA |
| Ga0208298_10891562 | 3300025084 | Marine | MGKRTVPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGAIT |
| Ga0208792_10230923 | 3300025085 | Marine | MGKRSIPGIIVKRGQKSLKKNMSHSTFTAKRHPNSKRVKNA |
| Ga0208792_10244852 | 3300025085 | Marine | MGKRAIPGIIVKRGQKSLKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208792_10274522 | 3300025085 | Marine | MGKRTIPHVKTPKRGQKASKKNMSHSTFVAKRHPNSKRVTSGAIT |
| Ga0208669_10084484 | 3300025099 | Marine | MGKRAVPGIIVKKGAPRIKKNMSHATFTAKRHPNSKRVLNGSIK |
| Ga0208669_10257191 | 3300025099 | Marine | PKRRGEYIMGKRSIPGIITKKGAPKLKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208669_10875553 | 3300025099 | Marine | YIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208793_11121382 | 3300025108 | Marine | MGKRAVPGIIVKKGAQRIKKNMSHATFTAKRHPNSKRVLNGSIK |
| Ga0208919_10326791 | 3300025128 | Marine | KRRGEYIMGKRSIPGIITKKGAPKLKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209336_100263323 | 3300025137 | Marine | MGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0209645_100109515 | 3300025151 | Marine | MGKRAIPGIIVKKGQPKLKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209556_11139211 | 3300025547 | Marine | GEYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA |
| Ga0209833_10341481 | 3300025641 | Pelagic Marine | RSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209657_11484131 | 3300025676 | Marine | ARKKGQPPVKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0209305_10203591 | 3300025712 | Pelagic Marine | EYIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209362_10397721 | 3300025770 | Marine | RRGEHIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208545_10389881 | 3300025806 | Aqueous | KRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209603_12859713 | 3300025849 | Pelagic Marine | MGKRSIPGIITKKGHPKLKKNMSHSTFTAKRHPNSK |
| Ga0209666_10992733 | 3300025870 | Marine | MGKRTIPYTQARKKGQRPVKKDMSHSTFTAKRHPN |
| Ga0209223_101698391 | 3300025876 | Pelagic Marine | IPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0207966_10587543 | 3300026119 | Marine | MGKRSVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0247591_11027263 | 3300026434 | Seawater | GKRAVPHVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGAVT |
| Ga0228622_11108882 | 3300026479 | Seawater | MGKRTIPYTQIRKKGQKPIKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0247605_10261911 | 3300026503 | Seawater | KTPKRGQKASKKNLSHSTFVAKRHPNSKRVTSGAVT |
| Ga0228607_11712962 | 3300026517 | Seawater | VKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208797_10217701 | 3300027186 | Estuarine | RGEHIMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208021_10279134 | 3300027191 | Estuarine | RQIPHCQPRKRGQRPIKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0208922_10228834 | 3300027197 | Estuarine | MGKRTIPYTQARKKGQRPVKKDMSHSTFTAKRHPNSKRVTSGALK |
| Ga0208023_10163673 | 3300027206 | Estuarine | GEHIMGKRSVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0208948_10207922 | 3300027501 | Marine | MGKRNIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0208973_11124941 | 3300027506 | Marine | IMGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209384_10164325 | 3300027522 | Marine | MGKRTIPHTVPRKKGARPIKKDMSHSTHTTKRHPNSKRVTSGAQK |
| Ga0208437_10274992 | 3300027525 | Estuarine | MGKRSIPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA |
| Ga0209482_100141021 | 3300027668 | Marine | MGKRTIPHTVPRKKGQKPIKKDMSHSTNTAKRHPNSKRVTSGAMK |
| Ga0209482_10093934 | 3300027668 | Marine | MGKRSVPYIITKKGAPKVKKNMSHSTHTAKRHPNSKRVKNA |
| Ga0209383_10076272 | 3300027672 | Marine | MGKRTIPHTVPRKKGQRPIKKDMSHSTHTTTRHPNSKRVTSGAMK |
| Ga0209383_10148982 | 3300027672 | Marine | MGKRTIPHTVPRKKGARPIKKDMSHSTFTAKRHPNSKRVTSGTMK |
| Ga0209071_10085698 | 3300027686 | Marine | MGKRTIPHTVPRKKGQKPIKKDMSHSTHTTTRHPNSKRVTSGAMK |
| Ga0209816_10028474 | 3300027704 | Marine | MGKRTIPHTIPRKKGQRPIKKDMSHSTHTAKRHPNSKRVTSGTMK |
| Ga0208304_103065293 | 3300027751 | Estuarine | RAVPHVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGAVT |
| Ga0209192_101214043 | 3300027752 | Marine | MGKRAIPGIITKKGQPKVKKNVSHSTFTEKRHPNSKRVKNA |
| Ga0209709_101242413 | 3300027779 | Marine | MGKRTIPHTLPRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGAMK |
| Ga0209502_103844482 | 3300027780 | Marine | LFRPKRRGEYIMGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0209711_102772751 | 3300027788 | Marine | YIMGKRAVPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0209091_101375903 | 3300027801 | Marine | MGKRTIPHTVPRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGAMK |
| Ga0209090_100757541 | 3300027813 | Marine | NTMGKRTIPHTLPRKKGQRPIKKDMSHSTNTAKRHPNSKRVTSGALK |
| Ga0209090_102852282 | 3300027813 | Marine | MGKRAVPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNA |
| Ga0209092_104278093 | 3300027833 | Marine | TPKRGQSATKKNLSHSTFVSKRHPNSKRVTSGAVT |
| Ga0209404_1000026962 | 3300027906 | Marine | MGKRAVPGIKTVRGQPRFKKNMSHATFTAKRHPNSKRVLNGSIK |
| Ga0228674_11339642 | 3300028008 | Seawater | MGKRAVPGIIVKKGAARIKKNMSHATFTAKRHPNSKRVLNGSIK |
| Ga0228609_10038251 | 3300028133 | Seawater | PYTQARKKGQRPVKKDMSHSTFTAKRHPNSKRVTSGAIT |
| Ga0256411_10047245 | 3300028134 | Seawater | FKDNIIMGKRAVPGIIVKKGAPKIKKNMSHSTFTAKRHPNSKRVLNGSIKI |
| Ga0257127_11806101 | 3300028189 | Marine | IPGIITKKGQPKVKKNMSHSTFTAKRHPNSKRARNA |
| Ga0257108_10064443 | 3300028190 | Marine | MNREMSVGKRNIAGIITKRGAPKLKKNMSHSTFTAKRHPNSKRVKNG |
| Ga0257114_13445992 | 3300028196 | Marine | MGKRAVPGIIVKKGAPKIKKNMSHATFTAKRHPNSKRVVNGS |
| Ga0257110_12053791 | 3300028197 | Marine | PGIITKKGQPRVKKNMSHSTFTAKRHPNSKRVRNV |
| Ga0228643_11398752 | 3300028396 | Seawater | MGKRTIPYTQIRKKGQKPIKKDMSHSTFTAKRHPNSKRVT |
| Ga0228614_10322011 | 3300028416 | Seawater | HVKTPKRGQRATKKNLSHSTFVSKRHPNSKRVTSGAVT |
| Ga0308022_11837383 | 3300031142 | Marine | MGKRSVPGIITKKGNKVKKNMSHSTFTAKRHPNSKR |
| Ga0308025_10048003 | 3300031143 | Marine | MGKRTIPGIITKKGQPKVKKNVSHSTFTEKRHPNSKRVKNA |
| Ga0308007_100007903 | 3300031599 | Marine | MGKRNVPHVIPRKRGFKASKKDMSHGTHTAKRHPNSKRVTSGAMK |
| Ga0308007_100701533 | 3300031599 | Marine | TIPHTVPRKKGARPIKKDMSHSTHTTKRHPNSKRVTSGAQK |
| Ga0308007_102612672 | 3300031599 | Marine | MGKRSVPGIITKKGNKLKKNMSHSTFTAKRHPNSKRVKNV |
| Ga0302119_100193662 | 3300031606 | Marine | MGKRTIPYTVPRKKGRRPIKKDMSHSTFTAKRHPNSKRVTSGAMK |
| Ga0302119_103848442 | 3300031606 | Marine | MGKRTIPHTVPRKKGARPIKKDMSHSTFTVKRHPNSKRVTSGTMK |
| Ga0308014_10323583 | 3300031628 | Marine | NTMGKRTIPHTVPRKKGARPIKKDMSHSTHTTKRHPNSKRVTSGAQK |
| Ga0307986_103312963 | 3300031659 | Marine | MGKRSVPGIITKKGNKLKKNMSHSTFTAKRHPNSKR |
| Ga0307994_10133101 | 3300031660 | Marine | MGKRTIPHTVPRKKGQRPIKKDMSHSTHTTTRHPNSKRV |
| Ga0307994_10818053 | 3300031660 | Marine | MGKRNVPHVIPRKRGFKATKKDMSHGTHTAKRHPNSKRVTSGAMK |
| Ga0308003_10481123 | 3300031705 | Marine | MGKRTIPHTVPRKKGQRPIKKDMSHSTHTATRHPNSKRVTSGAMK |
| Ga0315328_100895653 | 3300031757 | Seawater | MGKRAVPGIKTVRGQPRIKKSMSHASFTAKRHPNSKRVRNGSIK |
| Ga0315328_101199313 | 3300031757 | Seawater | MGKRTVPGIITKKGQPRIKKSMSHASFTAKRHPNSKRVRNGSIK |
| Ga0315331_103564761 | 3300031774 | Seawater | MGKRSIPGIITKKGQPRVKKNMSHSTFTAKRHPNSKRARNA |
| Ga0315333_103312772 | 3300032130 | Seawater | MGKRTVPGIITKKGQPRIKKSMSHASFTAKRHPNSKR |
| ⦗Top⦘ |